PHP File Manager

Editing File: awstats122023.kentishfootball.co.uk.txt

AWSTATS DATA FILE 7.8 (build 20200416) # If you remove this file, all statistics for date 202312 will be lost/reset. # Last config file used to build this data file was /home/kentishfootball/tmp/awstats/awstats.kentishfootball.co.uk.conf. # Position (offset in bytes) in this file for beginning of each section for # direct I/O access. If you made changes somewhere in this file, you should # also remove completely the MAP section (AWStats will rewrite it at next # update). BEGIN_MAP 28 POS_GENERAL 2025 POS_TIME 2713 POS_VISITOR 151137 POS_DAY 256410 POS_DOMAIN 3840 POS_LOGIN 5131 POS_ROBOT 5286 POS_WORMS 7751 POS_EMAILSENDER 7882 POS_EMAILRECEIVER 8025 POS_SESSION 257466 POS_SIDER 257685 POS_FILETYPES 8160 POS_DOWNLOADS 8595 POS_OS 9944 POS_BROWSER 10599 POS_SCREENSIZE 25974 POS_UNKNOWNREFERER 26048 POS_UNKNOWNREFERERBROWSER 28203 POS_ORIGIN 29601 POS_SEREFERRALS 29756 POS_PAGEREFS 29994 POS_SEARCHWORDS 30885 POS_KEYWORDS 31214 POS_MISC 2375 POS_ERRORS 31442 POS_CLUSTER 4987 POS_SIDER_404 31591 END_MAP # LastLine = Date of last record processed - Last record line number in last log - Last record offset in last log - Last record signature value # FirstTime = Date of first visit for history file # LastTime = Date of last visit for history file # LastUpdate = Date of last update - Nb of parsed records - Nb of parsed old records - Nb of parsed new records - Nb of parsed corrupted - Nb of parsed dropped # TotalVisits = Number of visits # TotalUnique = Number of unique visitors # MonthHostsKnown = Number of hosts known # MonthHostsUnKnown = Number of hosts unknown BEGIN_GENERAL 8 LastLine 20240101000017 2909 873879 15699872784550 FirstTime 20231201000006 LastTime 20231231235106 LastUpdate 20240101121347 2909 0 2908 0 0 TotalVisits 5772 TotalUnique 2170 MonthHostsKnown 0 MonthHostsUnknown 2895 END_GENERAL # Misc ID - Pages - Hits - Bandwidth BEGIN_MISC 10 RealPlayerSupport 0 0 0 QuickTimeSupport 0 0 0 PDFSupport 0 0 0 FlashSupport 0 0 0 WindowsMediaPlayerSupport 0 0 0 DirectorSupport 0 0 0 JavascriptDisabled 0 0 0 TotalMisc 0 0 0 JavaEnabled 0 0 0 AddToFavourites 0 993 0 END_MISC # Hour - Pages - Hits - Bandwidth - Not viewed Pages - Not viewed Hits - Not viewed Bandwidth BEGIN_TIME 24 0 1472 2284 185910432 5521 5974 62301866 1 710 1359 149362369 4520 5005 82395517 2 603 808 50023532 3878 4353 54324644 3 652 861 56934397 5207 5567 101386197 4 981 1300 83200883 5964 6315 79050149 5 1033 1354 79139585 5700 6190 77233656 6 1005 1543 148448664 6716 7134 65794271 7 905 2072 362072394 9335 9852 96459961 8 1055 2899 484326595 9405 10001 71474729 9 1020 3195 553679628 10761 11381 129468260 10 1146 3115 509058396 6199 6679 57618937 11 1194 3118 530988727 3682 4100 76333903 12 1549 3377 504761691 4021 4583 104928344 13 1210 2821 468940774 4134 4696 126294278 14 1429 3595 648464467 4073 4673 148022642 15 1252 3388 572051627 4384 4863 178958456 16 1029 2536 448407711 4106 4778 160526303 17 7698 9653 694429542 3217 3825 150010983 18 5004 6950 602137311 3381 3939 237263389 19 3413 5594 605720053 3672 4306 139612429 20 2582 5077 705682605 3658 4311 101029292 21 914 2816 513701926 3829 4359 117133974 22 935 3326 671287927 3823 4533 101068156 23 976 2385 344627770 4930 5449 47728769 END_TIME # Domain - Pages - Hits - Bandwidth # The 25 first Pages must be first (order not required for others) BEGIN_DOMAIN 68 us 23919 27790 1227414547 gb 7755 37552 8255009823 se 3764 3804 28314022 ru 1221 1583 90052082 fr 1020 1023 27629423 ca 860 934 8685601 bh 248 248 2095394 cn 150 287 8834597 au 115 827 183197012 de 110 132 6583448 ua 70 70 498112 in 46 99 15537692 kr 35 65 599507 dz 33 33 135828 md 33 33 274005 nl 32 39 405676 jp 28 68 579711 vn 26 26 192597 be 18 18 105588 tw 18 18 112386 eu 17 86 10647893 sa 17 44 5220125 at 16 75 20409968 ro 15 44 6356933 il 14 18 178138 sg 4 5 141959 jm 6 33 5311005 tr 3 12 109497 pl 12 34 5501028 ao 2 4 337041 it 10 32 2368846 bo 2 2 12208 th 2 2 24262 gr 11 41 15191142 my 2 2 24262 by 2 2 12202 cd 1 1 13719 tz 3 3 10569 zz 0 5 95849 za 7 7 33605 eg 4 51 10340796 pt 2 25 5085996 ch 1 2 16606 mx 12 18 96048 hk 1 2 15785 cz 3 4 181278 hu 5 5 21228 qa 1 5 4888652 bf 1 1 12131 no 3 11 138532 pa 5 5 27904 ae 1 18 5031483 ir 6 6 29604 az 3 3 34036 mm 1 1 13702 sc 13 29 2431111 ma 1 24 5469950 ss 1 1 3666 kz 2 2 13019 ke 10 10 47715 ie 1 32 5596215 es 6 29 5158717 sk 1 1 12969 br 1 1 12131 rs 0 4 217422 bg 12 12 80570 id 10 10 53005 cl 13 13 71433 END_DOMAIN # Cluster ID - Pages - Hits - Bandwidth BEGIN_CLUSTER 0 END_CLUSTER # Login - Pages - Hits - Bandwidth - Last visit # The 10 first Pages must be first (order not required for others) BEGIN_LOGIN 0 END_LOGIN # Robot ID - Hits - Bandwidth - Last visit - Hits on robots.txt # The 25 first Hits must be first (order not required for others) BEGIN_ROBOT 56 AhrefsBot/ 26440 123363665 20231231235741 115 SemrushBot/ 18676 84612036 20231231235829 241 BLEXBot/ 14218 55443584 20231230010752 13 seek 10838 143230283 20231224193409 3 DotBot/ 10802 159700971 20231231235202 656 MJ12bot/ 9977 48175938 20231231135943 279 link 9545 48493229 20231231052439 10 Barkrowler 4759 19914909 20231228005532 7 bot[\s_+:,\.\;\/\\-] 3716 47428008 20231231231522 599 unknown 2507 54956 20231231184032 2507 Applebot/ 2328 12785424 20231231235219 30 Googlebot/ 1064 9877334 20231231232410 49 urllib 1018 1449675118 20231229231944 0 CCBot/ 878 4323840 20231209171036 7 zoominfobot 775 3123151 20231231072847 50 Mediatoolkitbot 747 2720509 20231231225717 0 facebookexternalhit/ 476 66223933 20231231232636 1 DuckDuckBot-Https 317 80762449 20231214225651 2 CFNetwork 296 26568064 20231231233655 0 bingbot/ 231 21915788 20231231210759 31 feed 188 44939447 20231231234025 22 YisouSpider 150 812206 20231230190103 10 Apache\-HttpClient/ 142 512449 20231225175218 1 Go\-http\-client/ 124 477404 20231231141935 11 baidu 108 742716 20231231082505 0 java 3 47263 20231222213612 2 YandexBot/ 11 8469 20231221161405 8 linkdexbot/ 35 137578 20231221030039 3 DomainStatsBot/ 54 813492 20231229173402 2 fetcher 2 27581 20231231003806 0 Dalvik/ 6 31459 20231206203934 0 DuckDuckGo\-Favicons\-Bot/ 21 76637 20231231234059 0 Screaming[\x20]Frog[\x20]SEO[\x20]Spider/ 1 4082 20231215001707 0 (firefox/)([0-9]\.|[0-1][0]\.) 31 139290 20231230041047 3 yak 45 4559872 20231230071737 3 Google\-Adwords\-Instant 1 3729 20231204134022 0 Googlebot\-Image/ 55 1372089 20231230110746 0 archive\.org_bot 47 10718722 20231227013344 1 YandexImages/ 1 99668 20231221161405 0 Python\-urllib/ 1 13820 20231219204726 0 Velen 45 129511 20231231163030 22 netEstate[\x20]NE[\x20]Crawler 92 375381 20231209082206 13 360Spider 7 25714 20231231232916 0 Mail\.RU_Bot/ 1 22 20231207013210 1 [\s_+:,\.\;\/\\-]bot 1 4823 20231205052550 0 robot 9 2203848 20231231192603 0 Yahoo![\x20]Slurp 28 288711 20231231063518 12 MojeekBot 37 82011 20231230094431 17 no_user_agent 88 5718905 20231231210921 25 SeznamBot/ 47 676861 20231230212052 15 bingpreview 3 101361 20231219211644 0 Baiduspider/ 47 237393 20231231082501 0 nbot 9 148249 20231228020040 2 crawl 67 10664542 20231228000757 9 Firefox/1\.5 1 2151 20231207003301 0 LinkedInBot/ 1 244872 20231209115512 0 END_ROBOT # Worm ID - Hits - Bandwidth - Last visit # The 5 first Hits must be first (order not required for others) BEGIN_WORMS 0 END_WORMS # EMail - Hits - Bandwidth - Last visit # The 20 first Hits must be first (order not required for others) BEGIN_EMAILSENDER 0 END_EMAILSENDER # EMail - Hits - Bandwidth - Last visit # The 20 first hits must be first (order not required for others) BEGIN_EMAILRECEIVER 0 END_EMAILRECEIVER # Files type - Hits - Bandwidth - Bandwidth without compression - Bandwidth after compression BEGIN_FILETYPES 22 htm 2 0 0 0 txt 64 4735 0 0 c 6 22266 0 0 net 1 0 0 0 php7 14 0 0 0 xml 13 297170 0 0 env 3 10856 0 0 info 1 0 0 0 jpeg 127 1446657 0 0 Unknown 30690 449896001 0 0 uk 42 0 0 0 php 210 114983 0 0 jpg 6296 263039392 0 0 tv 1 0 0 0 css 4565 33611316 0 0 com 6 0 0 0 html 8765 32938057 0 0 js 6030 36183234 0 0 org 4 0 0 0 json 1 0 0 0 php4 8 0 0 0 png 18577 9155794339 0 0 END_FILETYPES # Downloads - Hits - Bandwidth BEGIN_DOWNLOADS 18 /.well-known/pki-validation/22F15C677C9B0281B9855E9FD632A800.txt 40 0 3095 /.well-known/pki-validation/A21E900309F4BC3619C79B4522820433.txt 8 0 616 /.well-known/pki-validation/1B79CBFE78503BE543CB27BD96B8C141.txt 1 0 64 /.well-known/pki-validation/758A2194D188CB702C171B0A8AC02145.txt 1 0 64 /.well-known/pki-validation/6BA3E48A0BF5825118F7FDEB4802F505.txt 1 0 64 /.well-known/pki-validation/F5701D052928881B8BF290598B16D249.txt 1 0 64 /.well-known/pki-validation/07E5CA1F1444D1503DA616ED7B729C8A.txt 1 0 64 /.well-known/pki-validation/D6B4DF9132D1B6435C44F1B09ED767C7.txt 1 0 64 /.well-known/pki-validation/912D9857F15D6083149A213264CE2578.txt 1 0 64 /.well-known/pki-validation/B33007DD6742FBC68023FC0DF7F728B7.txt 1 0 64 /.well-known/pki-validation/3FD51E325FA4F070F970354E8F37C093.txt 1 0 64 /.well-known/pki-validation/E0600288E2002C84D3AD863263799F27.txt 1 0 64 /.well-known/pki-validation/51856E7D6CF091C19C6F77FD8DF6301D.txt 1 0 64 /.well-known/pki-validation/BBD9A2797A32CE46D53E89B6B7FA00A4.txt 1 0 64 /.well-known/pki-validation/5CAB36348E0D746F88B60BF2CFB6C934.txt 1 0 64 /.well-known/pki-validation/4CCDD58899AA5ADA1B3398B6A1AA9692.txt 1 0 64 /.well-known/pki-validation/F377932CFE6939F7253209986772F57E.txt 1 0 64 /.well-known/pki-validation/5AB061405074844852EBAE481B66FCFB.txt 1 0 64 END_DOWNLOADS # OS ID - Hits BEGIN_OS ID - Hits - Pages 37 macosx13 114 14 androidnougat 233 232 androidlollipop 349 201 androidkitkat 14 13 macosx12 2 2 ios_ipad 4059 539 macosx7 2 1 ios_iphone 19057 3514 androidoreo 465 109 unix 78 13 Unknown 4616 4383 android10 1305 364 androidmarshmallow 36 11 win8.1 664 663 win8 227 225 macosx 48 35 androidpie 555 119 macosx11 8 8 win2003 1 0 win10 30212 25284 macosx10 25 25 winunknown 2 2 winnt 3 3 macosx6 2 2 android 704 181 linuxubuntu 186 14 bsdopenbsd 1 1 winxp 36 21 androidics 1 1 win7 1051 778 winlong 176 174 winphone 2 1 macosx15 8946 1602 macosx14 22 20 macosx8 1 1 macosx9 4 3 linux 2219 1208 END_OS # Browser ID - Hits - Pages BEGIN_BROWSER 682 chrome69.0.3196.129 2 2 chrome75.0.2016.89 2 2 chrome63.0.3988.34 2 2 chrome79.0.3795.25 2 2 chrome69.0.2812.163 2 2 chrome119.0.6045.105 16 2 chrome67.0.2911.36 2 2 msie6.0 2 2 chrome73.0.2056.148 2 2 chrome53.0.2785.116 6 6 chrome83.0.4103.61 14 6 chrome64.0.3086.185 2 2 chrome60.0.3618.12 2 2 chrome63.0.3829.74 2 2 chrome78.0.2944.20 2 2 chrome62.0.2257.149 2 2 chrome69.0.3283.154 2 2 chrome60.0.3179.80 2 2 chrome76.0.2673.2 2 2 chrome62.0.3009.117 2 2 safari17.1.1 1910 400 chrome69.0.3772.143 2 2 chrome79.0.2910.110 2 2 chrome73.0.3850.53 2 2 chrome117.0.0.0 3 3 chrome44.0.2403.155 1 1 chrome66.0.3107.121 2 2 chrome61.0.3873.139 2 2 chrome67.0.2004.119 2 2 chrome64.0.3854.5 2 2 safari14.1 1 1 firefox103.0 889 886 chrome78.0.2289.11 2 2 chrome87.0.4280.88 23 9 firefox68.0 1 1 chrome63.0.3239.26 1 0 Unknown 4145 3976 chrome77.0.2366.21 2 2 chrome77.0.2702.31 2 2 chrome61.0.3668.169 2 2 chrome62.0.3436.92 2 2 chrome60.0.3763.130 2 2 safari17.2 620 99 chrome100.0.4896.127 7 7 safari 513 215 chrome72.0.3650.189 2 2 chrome71.0.2230.95 2 2 chrome80.0.3987.149 1 1 chrome99.0.4844.74 1 1 chrome64.0.3084.134 2 2 firefox27.0 1 1 chrome45.0.2454.93 1 0 chrome62.0.2957.20 2 2 chrome28.0.1467.0 1 1 chrome76.0.3822.167 2 2 safari10.0 1 1 chrome60.0.3649.188 2 2 chrome69.0.2552.62 2 2 chrome75.0.2212.93 2 2 chrome74.0.3702.170 2 2 chrome49.0.2623.112 17 5 chrome37.0.2049.0 1 1 chrome78.0.2117.152 2 2 chrome57 4 4 safari12.0.2 9 9 chrome118.0.0.0 131 63 chrome71.0.3740.2 2 2 chrome76.0.2258.136 2 2 chrome81.0.4044.129 15 15 chrome64.0.2436.103 2 2 chrome62.0.3493.78 2 2 chrome76.0.3809.89 2 1 chrome70.0.2676.113 2 2 chrome60.0.2824.34 2 2 chrome62.0.2333.198 2 2 chrome65.0.2073.41 2 2 chrome77.0.2427.1 2 2 chrome78.0.2752.18 2 2 chrome60.0.3112.107 231 231 safari5.1 1 1 chrome74.0.3729.157 5288 5287 safari13.0.4 1 1 opera12.16 1 0 safari17.1.2 10042 2210 chrome77.0.2969.25 2 2 chrome65.0.2517.185 2 2 chrome87.0.4280.141 7 1 chrome78.0.3904.108 12 12 chrome71.0.3005.178 2 2 chrome63.0.2539.43 2 2 chrome53.0.2785.101 1 1 chrome77.0.3300.9 2 2 chrome75.0.2560.64 2 2 chrome52.0.2746.29 2 2 chrome76.0.3809.100 1 0 chrome67.0.3191.56 2 2 chrome74.0.2293.143 2 2 chrome75.0.2618.74 2 2 chrome67.0.2309.183 2 2 opera11.00 2 2 chrome61.0.2750.69 2 2 chrome70.0.2706.55 2 2 chrome62.0.2648.115 2 2 chrome113.0.0.0 11 11 chrome62.0.3140.185 2 2 firefox72.0 174 0 chrome62.0.2282.103 2 2 safari6.0.2 1 0 chrome79.0.3299.191 2 2 chrome117.0.5938.132 48 2 firefox79.0 3 3 chrome76.0.3271.41 2 2 chrome80.0.3987.162 2 2 chrome77.0.2599.146 2 2 msie5.5 1 1 chrome77.0.3068.150 2 2 chrome76.0.3230.33 2 2 chrome76.0.3219.58 2 2 chrome92.0.4515.157 78 13 mozilla 521 412 chrome79.0.2662.32 2 2 chrome72.0.2320.28 2 2 chrome72.0.3186.50 2 2 chrome71.0.2791.19 2 2 chrome70.0.2815.129 2 2 chrome62.0.2657.108 2 2 chrome105.0.0.0 72 72 opera55.0.2994.44 3 3 chrome118.0.5993.88 24 1 chrome61.0.2823.79 2 2 chrome78.0.3214.180 2 2 chrome65.0.2452.40 2 2 chrome70.0.3538.102 7 7 chrome76.0.2314.50 2 2 chrome75.0.3794.67 2 2 chrome66.0.3868.109 2 2 chrome76.0.2590.13 2 2 chrome74.0.2661.53 2 2 chrome103.0.5060.134 82 59 chrome62.0.2469.43 2 2 chrome78.0.2083.109 2 2 safari16.6 7894 1228 firefox40.0 1 0 chrome61.0.3177.148 2 2 chrome69.0.2577.172 2 2 chrome62.0.2741.179 2 2 chrome70.0.3463.61 2 2 chrome35.0.3319.102 1 1 chrome100.0.4758.11 2 2 chrome66.0.3680.162 2 2 chrome102.0.0.0 4 2 opera10.10 2 0 opera54.0.2952.71 3 3 chrome66.0.3359.181 5 0 chrome73.0.3411.53 2 2 chrome64.0.3654.196 2 2 chrome77.0.3546.104 2 2 chrome75.0.3358.83 2 2 chrome65.0.2930.103 2 2 chrome63.0.3886.57 2 2 chrome71.0.2047.173 2 2 firefox89.0 1 1 chrome76.0.2476.121 2 2 chrome108.0.5359.220 349 201 chrome67.0.3714.114 2 2 safari15.6 188 98 chrome71.0.2623.112 2 2 safari15.6.6 714 86 chrome70.0.2121.72 2 2 chrome73.0.2972.142 2 2 safari14.0.3 25 2 chrome67.0.3396.99 3 3 chrome27.0.1453.93 1 1 firefox75.0 1 1 chrome65.0.2667.170 2 2 chrome78.0.3827.2 2 2 chrome68.0.2239.7 2 2 chrome75.0.2928.12 2 2 chrome76.0.2181.117 2 2 chrome74.0.3533.129 2 2 safari9.1.2 1 1 chrome84.0.4147.105 7 7 chrome68.0.3440.84 9 8 chrome114.0.0.0 54 54 chrome74.0.2009.136 2 2 chrome60.0.3425.85 2 2 chrome120.0.0.0 1653 579 chrome109.0.0.0 611 335 firefox46.0 2 2 chrome73.0.3474.155 2 2 chrome77.0.3201.44 2 2 chrome68.0.2746.75 2 2 chrome71.0.3529.54 2 2 chrome73.0.3887.159 2 2 firefox23.0 2 2 chrome61.0.2158.117 2 2 chrome64.0.3382.68 2 2 chrome68.0.2771.176 2 2 firefox62.0 2 2 chrome74.0.3388.126 2 2 chrome79.0.2654.163 2 2 chrome61.0.3278.115 2 2 chrome71.0.2605.59 2 2 chrome71.0.2227.103 2 2 chrome75.0.3882.90 2 2 firefox111.0 5 5 opera11.52 1 1 chrome72.0.3626.121 1 1 chrome63.0.2878.63 2 2 chrome71.0.3680.98 2 2 chrome62.0.3902.188 2 2 chrome63.0.2398.92 2 2 chrome77.0.3565.60 2 2 chrome74.0.2043.133 2 2 chrome64.0.2995.163 2 2 chrome103.0.0.0 832 830 chrome53.0.2785.89 3 3 chrome68.0.2621.179 2 2 chrome78.0.2929.42 2 2 chrome76.0.3922.66 2 2 chrome66.0.3212.91 2 2 chrome72.0.3672.88 2 2 chrome65.0.2953.134 2 2 chrome66.0.2974.126 2 2 chrome73.0.2398.46 2 2 chrome83.0.4103.97 5 5 chrome65.0.2987.120 2 2 chrome119.0.6045.164 38 2 netscape5.0 13 4 chrome72.0.2828.120 2 2 chrome67.0.3164.149 2 2 chrome115.0.0.0 1022 270 chrome76.0.3566.110 2 2 chrome51.0.2704.79 1 1 safari16.5.2 67 11 chrome61.0.2345.34 2 2 chrome80.0.3987.132 2 2 firefox83.0 3 3 firefox74.0 1 1 chrome67.0.2250.34 2 2 chrome70.0.2963.137 2 2 opera11.01 5 5 chrome100.0.4896.75 1 0 chrome104.0.5112.101 72 3 chrome71.0.3131.63 2 2 chrome74.0.3729.131 1 1 chrome67.0.2752.113 2 2 chrome67.0.2327.42 2 2 chrome71.0.2024.42 2 2 chrome77.0.2846.17 2 2 chrome112.0.0.0 3 3 chrome44.0.2403.89 1 1 chrome76.0.2097.147 2 2 firefox73.0 1 1 firefox35.0 3 2 chrome67.0.3396.79 3 3 chrome73.0.2722.199 2 2 firefox25.0 1 1 opera105.0.0.0 149 22 chrome65.0.2550.117 2 2 chrome79.0.3035.171 2 2 chrome71.0.3542.0 21 7 chrome101.0.4951.67 1 1 chrome64.0.2704.103 2 2 chrome61.0.2242.134 2 2 chrome94.0.4606.81 1239 1003 chrome69.0.2078.151 2 2 chrome68.0.2906.107 2 2 chrome66.0.3767.1 2 2 msie5.0 1 1 firefox108.0 2 2 chrome91.0.4472.114 15 15 chrome72.0.3221.128 2 2 chrome74.0.3132.109 2 2 chrome63.0.2932.75 2 2 chrome60.0.3112.113 3 3 chrome104.0.0.0 28 5 chrome75.0.3876.25 2 2 safari16.5.1 67 44 chrome65.0.2726.111 2 2 opera12.14 2 2 chrome119.0.0.0 2489 757 chrome64.0.3714.19 2 2 chrome66.0.2285.40 2 2 chrome68.0.3279.148 2 2 chrome71.0.2894.61 2 2 chrome76.0.2219.153 2 2 chrome71.0.3967.19 2 2 firefox65.0 1 1 chrome102.0.5005.63 30 7 chrome76.0.3902.100 2 2 chrome88.0.4324.190 3 3 safari17.0.1 304 36 chrome71.0.3578.99 1 0 chrome70.0.2692.91 2 2 chrome72.0.3031.81 2 2 opera89.0.4447.51 8 8 chrome78.0.2628.85 2 2 chrome79.0.3749.55 2 2 chrome65.0.3160.127 2 2 safari13.1.1 1 1 chrome74.0.3769.49 2 2 chrome72.0.3072.36 2 2 chrome69.0.2385.189 2 2 chrome64.0.3033.157 2 2 chrome66.0.2216.194 2 2 safari16.2 840 143 firefox41.0 1 1 chrome64.0.2273.179 2 2 chrome71.0.3954.106 2 2 opera12.0 1 1 chrome63.0.2525.27 2 2 chrome31.0.1650.16 1 1 chrome61.0.2605.72 2 2 chrome95.0.4638.69 11 11 safari12.1.2 3551 350 chrome65.0.2857.93 2 2 safari5.0.3 2 2 chrome90.0.4400.8 4 4 safari16.4 2 1 safari13.1.2 103 12 chrome67.0.3579.170 2 2 chrome76.0.2077.157 2 2 chrome99.0.4844.84 2 2 chrome71.0.3658.156 2 2 safari15.4 47 14 chrome76.0.2710.82 2 2 chrome76.0.3574.177 2 2 chrome77.0.2710.72 2 2 chrome77.0.3865.120 8 1 chrome33.0.1750.517 1 1 chrome63.0.3871.51 2 2 firefox115.0 224 19 chrome70.0.2626.52 2 2 chrome108.0.0.0 78 38 chrome78.0.2891.190 2 2 chrome93.0.4577.82 1 1 chrome79.0.3054.55 2 2 chrome77.0.2078.136 2 2 chrome64.0.3093.37 2 2 firefox52.0.2 1 1 chrome72.0.2017.145 2 2 chrome71.0.3872.86 2 2 firefox11.0 13 0 chrome66.0.2246.176 2 2 chrome61.0.3620.127 2 2 chrome67.0.3801.93 2 2 chrome77.0.3625.147 2 2 chrome84.0.4147.135 30 30 chrome75.0.3375.89 2 2 chrome72.0.2400.141 2 2 chrome76.0.2560.176 2 2 chrome101.0.4951.54 50 4 chrome74.0.3902.185 2 2 firefox50.0 2 2 msie11.0 58 1 chrome41.0.2228.0 1 1 safari5.0.4 3 3 chrome67.0.2154.68 2 2 chrome103.0.5060.114 320 320 iphone 373 30 chrome65.0.2549.143 2 2 chrome66.0.2949.152 2 2 chrome62.0.3056.27 2 2 chrome74.0.3860.81 2 2 chrome74.0.3288.117 2 2 chrome74.0.2016.74 2 2 chrome76.0.3949.164 2 2 chrome40.0.2214.115 6 6 chrome110.0.5478.0 64 8 safari16.5 47 6 chrome64.0.3557.91 2 2 safari13.0.3 20 6 chrome96.0.4664.110 5274 5274 chrome73.0.3683.103 9 0 edge44 3 3 chrome66.0.2135.7 2 2 chrome65.0.3335.136 2 2 firefox114.0 23 23 chrome76.0.3141.79 2 2 chrome62.0.2478.80 2 2 chrome64.0.2672.151 2 2 chrome77.0.2573.130 2 2 safari15.5 197 21 opera5.02 1 1 chrome89.0.4389.114 23 9 chrome76.0.2833.74 2 2 chrome70.0.3538.110 3 2 chrome78.0.2942.155 2 2 chrome66.0.3485.2 2 2 chrome71.0.2634.135 2 2 chrome73.0.3074.99 2 2 chrome90.0.4427.0 7 7 chrome65.0.3348.162 2 2 chrome67.0.2388.165 2 2 chrome110.0.0.0 1 1 chrome67.0.2393.117 2 2 chrome75.0.2502.116 2 2 chrome67.0.3657.138 2 2 chrome64.0.2772.13 2 2 firefox40.1 1 1 opera11.51 2 2 chrome73.0.3017.46 2 2 chrome76.0.2177.55 2 2 chrome67.0.3208.174 2 2 chrome85.0.4183.83 1 1 safari9.1.1 1 1 chrome79.0.2530.111 2 2 chrome70.0.3347.16 2 2 chrome75.0.3222.29 2 2 chrome70.0.2600.125 2 2 chrome67.0.3837.48 2 2 chrome63.0.3735.81 2 2 chrome90.0.4430.72 64 64 chrome74.0.3686.169 2 2 safari5.0.2 2 2 chrome116.0.0.0 150 45 chrome65.0.3497.89 2 2 chrome68.0.3327.159 2 2 chrome61.0.3976.134 2 2 chrome68.0.3456.91 2 2 chrome70.0.3059.96 2 2 chrome103.0.5060.53 193 193 chrome68.0.2777.136 2 2 chrome71.0.3578.98 4 4 chrome68.0.3982.127 2 2 chrome62.0.2319.76 2 2 chrome75.0.3770.100 26 26 chrome73.0.2288.14 2 2 chrome83.0.4098.0 4 4 chrome63.0.2045.153 2 2 opera12.00 2 2 chrome102.0.5005.125 447 106 chrome71.0.3877.187 2 2 chrome73.0.2920.89 2 2 chrome63.0.3239.132 3 3 chrome66.0.3300.111 2 2 chrome76.0.2355.170 2 2 chrome60.0.2452.159 2 2 chrome78.0.3041.133 2 2 chrome70.0.2129.80 2 2 chrome63.0.2349.122 2 2 chrome71.0.2569.87 2 2 chrome77.0.3865.90 535 55 chrome63.0.3094.87 2 2 chrome35.0.1916.47 1 1 chrome119.0.6045.193 47 5 safari11.0.1 1 1 chrome36.0.1944.0 1 1 chrome76.0.2052.139 2 2 chrome71.0.2536.114 2 2 chrome74.0.2259.128 2 2 chrome69.0.2237.102 2 2 chrome76.0.2804.121 2 2 netscape 5 5 chrome79.0.2245.172 2 2 chrome64.0.3279.87 2 2 chrome70.0.3454.188 2 2 chrome63.0.2646.41 2 2 chrome65.0.3306.171 2 2 chrome65.0.3610.153 2 2 chrome36.0.1985.67 3 3 chrome71.0.2756.124 2 2 chrome75.0.2130.34 2 2 chrome69.0.3879.105 2 2 chrome77.0.2771.63 2 2 chrome76.0.3809.111 3 1 chrome74.0.2022.119 2 2 chrome74.0.3729.169 5316 5316 safari16.3 1400 146 chrome24.0.1295.0 1 1 chrome79.0.3214.171 2 2 chrome76.0.2993.126 2 2 chrome67.0.2131.88 2 2 firefox47.0 1 1 chrome70.0.3049.134 2 2 chrome78.0.3203.12 2 2 chrome80.0.3987.163 24 1 chrome64.0.3632.48 2 2 chrome36.0.1985.125 1 1 chrome60.0.2093.48 2 2 chrome73.0.2302.79 2 2 chrome60.0.2654.170 2 2 safari17.0 38 2 chrome116.0.3165.83 1 1 chrome103.0.5042.0 63 63 chrome61.0.2701.61 2 2 chrome74.0.3896.13 2 2 chrome70.0.2566.175 2 2 chrome72.0.3327.136 2 2 chrome65.0.2999.104 2 2 chrome67.0.2367.58 2 2 chrome78.0.2473.120 2 2 chrome71.0.3560.128 2 2 chrome63.0.3064.125 2 2 firefox120.0 1502 150 chrome78.0.3217.27 2 2 chrome75.0.3440.109 2 2 chrome90.0.4430.93 35 35 chrome78.0.2310.75 2 2 chrome77.0.3585.50 2 2 chrome52.0.2743.116 4 4 chrome61.0.2352.97 2 2 chrome74.0.3885.133 2 2 chrome97.0.4280.67 3 3 chrome61.0.3081.190 2 2 chrome66.0.3422.45 2 2 chrome74.0.3056.105 2 2 chrome71.0.2822.98 2 2 chrome60.0.2264.157 2 2 safari16.1 1612 227 chrome77.0.2047.174 2 2 chrome75.0.3783.110 2 2 firefox48.0 6 6 chrome62.0.3357.69 2 2 chrome63.0.2834.149 2 2 chrome71.0.3445.105 2 2 chrome97.0.4692.71 5448 5448 safari9.0 1 1 chrome65.0.2084.165 2 2 chrome75.0.3453.133 2 2 msie9.0 18 15 opera54.0.2952.64 6 6 chrome65.0.2236.52 2 2 chrome52.0.3585.98 1 1 chrome58.0.3029.110 15 2 chrome77.0.2035.139 2 2 chrome28.0.1468.0 1 1 chrome72.0.2197.85 2 2 chrome120.0.6099.43 72 8 chrome71.0.3515.176 2 2 chrome66.0.3203.94 2 2 chrome65.0.2550.52 2 2 chrome72.0.2297.56 2 2 chrome119.0.6045.163 91 10 chrome72.0.2950.62 2 2 chrome39.0.2171.95 24 24 chrome64.0.2200.135 2 2 chrome62.0.2588.177 2 2 chrome77.0.2997.140 2 2 chrome72.0.2579.132 2 2 safari17.3 26 3 chrome69.0.3587.111 2 2 chrome62.0.2456.112 2 2 chrome79.0.3025.23 2 2 chrome69.0.2111.76 2 2 chrome27.0.1500.55 1 1 chrome22.0.1216.0 1 0 firefox92.0 13 0 chrome77.0.2090.102 2 2 chrome66.0.2458.110 2 2 msie7.0 11 8 chrome111.0.0.0 18 1 chrome78.0.3772.52 2 2 firefox102.0 29 6 safari14.1.2 18 1 firefox116.0 50 1 chrome61.0.3351.43 2 2 chrome114.0.5735.289 16 1 firefox117.0 24 1 chrome76.0.3809.87 1 1 chrome64.0.3282.204 1 0 chrome68.0.2143.91 2 2 chrome68.0.2622.77 2 2 chrome70.0.3896.107 2 2 chrome74.0.3572.57 2 2 chrome60.0.3415.189 2 2 chrome76.0.2638.132 2 2 chrome56.0.2924.87 2 0 chrome72.0.3645.74 2 2 android 14 14 chrome61.0.2607.108 2 2 firefox21.0 3 3 chrome65.0.2793.182 2 2 firefox31.0 1 1 chrome103.0.5060.66 288 288 chrome90.0.4430.86 3 3 chrome73.0.2332.177 2 2 chrome79.0.3295.94 2 2 safari16.0 149 27 chrome62.0.3393.119 2 2 chrome19.0.1084.56 1 0 firefox51.0 2 2 chrome60.0.3618.11 2 2 chrome76.0.3414.58 2 2 safari14.1.1 2 2 chrome63.0.2179.101 2 2 chrome76.0.3109.111 2 2 chrome66.0.3359.117 1 1 safari17.1 245 67 safari11.1.2 1 1 chrome69.0.3741.120 2 2 chrome34.0.1847.116 7 7 chrome78.0.3108.114 2 2 chrome119.0.6045.150 34 2 firefox121.0 787 59 chrome90.0.4430.85 78 78 chrome53.0.2824.30 2 2 chrome78.0.3958.15 2 2 chrome72.0.2084.167 2 2 opera36.0.2130.75 1 0 firefox70.0 1 1 chrome76.0.2606.24 2 2 chrome69.0.2258.1 2 2 chrome24.0.1309.0 1 1 chrome72.0.3858.17 2 2 chrome66.0.3763.165 2 2 safari15.6.1 910 75 chrome64.0.2648.190 2 2 opera104.0.0.0 18 1 chrome79.0.2232.9 2 2 chrome67.0.3396.87 4 4 chrome101.0.4951.41 1 0 chrome68.0.2599.174 2 2 chrome75.0.2395.166 2 2 chrome77.0.2336.23 2 2 chrome64.0.3469.146 2 2 chrome63.0.3392.151 2 2 chrome63.0.2702.186 2 2 chrome77.0.3883.4 2 2 chrome62.0.2744.36 2 2 chrome75.0.2747.142 2 2 opera70.0.3728.95 1 1 lynx 1 1 chrome68.0.3550.11 2 2 chrome79.0.3731.188 2 2 chrome64.0.2487.165 2 2 chrome77.0.3013.139 2 2 firefox45.0 5 5 chrome59.0.3071.115 1 1 chrome60.0.3389.78 2 2 firefox19.0 1 1 chrome63.0.3942.38 2 2 chrome79.0.3945.130 54 54 chrome74.0.3549.105 2 2 chrome63.0.3429.153 2 2 chrome68.0.3626.163 2 2 chrome67.0.3983.185 2 2 chrome73.0.3635.89 2 2 chrome74.0.3016.136 2 2 chrome63.0.3894.171 2 2 msie8.0 5 5 chrome68.0.3073.41 2 2 chrome86.0.4240.198 2 2 chrome120.0.6099.71 20 2 chrome31.0.1623.0 1 1 chrome74.0.3306.59 2 2 chrome79.0.3945.79 49 3 chrome83.0.4103.7 1 1 chrome57.0.2987.108 1 1 chrome68.0.2163.181 2 2 chrome76.0.3809.110 1 0 chrome74.0.2727.116 2 2 chrome111.0.5563.116 6 2 chrome74.0.3706.10 2 2 chrome120.0.6099.28 25 2 chrome74.0.3148.123 2 2 chrome74.0.3680.31 2 2 chrome73.0.2767.20 2 2 chrome65.0.3219.22 2 2 chrome60.0.2284.117 2 2 chrome79.0.2892.107 2 2 chrome106.0.0.0 106 79 chrome79.0.2511.19 2 2 chrome65.0.2288.22 2 2 opera11.50 1 1 chrome68.0.3440.106 4 4 chrome120.0.6099.105 19 1 chrome96.0.4664.104 1 1 chrome76.0.3708.73 2 2 chrome79.0 4 4 chrome74.0.3017.7 2 2 msie10.0 1 1 chrome72.0.2661.91 2 2 chrome68.0.2335.188 2 2 chrome78.0.3136.167 2 2 chrome73.0.2765.142 2 2 chrome81.0.4044.138 5 5 chrome74.0.3831.96 2 2 chrome66.0.3136.107 2 2 chrome94.0.4606.61 6 3 chrome60.0.3419.90 2 2 END_BROWSER # Screen size - Hits BEGIN_SCREENSIZE 0 END_SCREENSIZE # Unknown referer OS - Last visit date BEGIN_UNKNOWNREFERER 40 search.marginalia.nu 20231212202714 SEMrushBot 20231210155343 XenForo/2.x_(https://www.thefootballforum.net) 20231220232948 python-requests/2.31.0 20231231022133 Mozilla/4.0_(compatible;) 20231210161637 Citoid_(Wikimedia_tool;_learn_more_at_https://www.mediawiki.org/wiki/Citoid) 20231218142629 ClaudeBot 20231222134905 Python/3.10_aiohttp/3.9.1 20231207100227 python-requests/2.26.0 20231219055101 Lynx/2.9.0dev.5_libwww-FM/2.14_SSL-MM/1.4.1_GNUTLS/3.6.13 20231215194933 AHC/2.1 20231218235925 python-requests/2.25.1 20231218163818 WhatsApp/2.23.20.0 20231224114151 XenForo/2.x_(https://www.nonleaguematters.co.uk/forums) 20231231125259 cortex/1.0 20231231103427 Mozilla/5.0_(compatible;_Dataprovider.com) 20231221102322 python-requests/2.27.1 20231212000720 Mozilla/5.0_Firefox/35.0 20231216225547 Mozilla/5.0_(compatible;_Y!J-WSC/1.0;__https://yahoo.jp/3BSZgF) 20231230212430 COMODO_DCV 20231227080708 Mozilla/5.0_(compatible;_CensysInspect/1.1;__https://about.censys.io/) 20231223184157 Chrome/66.0.3359.181 20231226100403 Mozilla/5.0_(compatible;_Example3/1.0;__https://www.example3.com/domain/kentishfootball.co.uk) 20231221072204 Sectigo_DCV 20231227013140 Photon/1.0 20231225104551 Mozilla/5.0_zgrab/0.x 20231214120608 python-requests/2.30.0 20231226215715 Mozilla/5.0_(compatible;__centuryb.o.t9[at]gmail.com) 20231227012232 python-requests/2.28.1 20231225192347 XenForo/2.x_(https://www.urban75.net/forums) 20231222092356 Not_A;Brand\ 20231228150908 Python/3.10_aiohttp/3.8.5 20231219235815 Mozilla 20231226161158 python-requests/2.28.2 20231219081010 Mozilla/5.0 20231217170419 Mozilla/5.0_(compatible;_Yeti/1.1;__https://naver.me/spd) 20231230222455 GuzzleHttp/7 20231228160502 Expanse,_a_Palo_Alto_Networks_company,_searches_across_the_global_IPv4_space_multiple_times_per_day_to_identify_customers'_presences_on_the_Internet._If_you_would_like_to_be_excluded_from_our_scans,_please_send_IP_addresses/domains_to:_scaninfo@paloaltonetworks.com 20231230053347 lua-resty-http/0.10_(Lua)_ngx_lua/10025 20231209160808 WhatsApp/2.23.23.79_i 20231204115411 END_UNKNOWNREFERER # Unknown referer Browser - Last visit date BEGIN_UNKNOWNREFERERBROWSER 27 XenForo/2.x_(https://www.urban75.net/forums) 20231222092356 python-requests/2.28.1 20231225192347 Not_A;Brand\ 20231228150908 Python/3.10_aiohttp/3.8.5 20231219235815 python-requests/2.28.2 20231219081010 GuzzleHttp/7 20231228160502 Expanse,_a_Palo_Alto_Networks_company,_searches_across_the_global_IPv4_space_multiple_times_per_day_to_identify_customers'_presences_on_the_Internet._If_you_would_like_to_be_excluded_from_our_scans,_please_send_IP_addresses/domains_to:_scaninfo@paloaltonetworks.com 20231230053347 WhatsApp/2.23.23.79_i 20231204115411 lua-resty-http/0.10_(Lua)_ngx_lua/10025 20231209160808 Sectigo_DCV 20231227013140 python-requests/2.30.0 20231226215715 Photon/1.0 20231225104551 WhatsApp/2.23.20.0 20231224114151 python-requests/2.25.1 20231218163818 AHC/2.1 20231218235925 XenForo/2.x_(https://www.nonleaguematters.co.uk/forums) 20231231125259 cortex/1.0 20231231103427 python-requests/2.27.1 20231212000720 COMODO_DCV 20231227080708 search.marginalia.nu 20231212202714 SEMrushBot 20231210155343 Citoid_(Wikimedia_tool;_learn_more_at_https://www.mediawiki.org/wiki/Citoid) 20231218142629 python-requests/2.31.0 20231231022133 XenForo/2.x_(https://www.thefootballforum.net) 20231220232948 ClaudeBot 20231222134905 Python/3.10_aiohttp/3.9.1 20231207100227 python-requests/2.26.0 20231219055101 END_UNKNOWNREFERERBROWSER # Origin - Pages - Hits BEGIN_ORIGIN 6 From0 34094 34741 From1 224 224 From2 78 96 From3 153 203 From4 5218 40162 From5 0 0 END_ORIGIN # Search engine referers ID - Pages - Hits BEGIN_SEREFERRALS 5 baidu 4 4 www_google_com 41 59 www_google_com_au 2 2 www_google_co_uk 30 30 www_google_ru 1 1 END_SEREFERRALS # External page referers - Pages - Hits # The 25 first Pages must be first (order not required for others) BEGIN_PAGEREFS 25 https://t.co/lZ9equTinW 75 75 https://t.co/TzlKZ9B1Zf 22 22 https://t.co/ur3siKqcho 10 10 http://m.facebook.com 10 10 https://l.facebook.com 5 5 http://www.shuct.net 5 5 https://t.co 4 4 https://t.co/tZKgzO8aY2 3 3 https://en.m.wikipedia.org 2 2 https://bellezza4u.ru 2 2 https://t.co/ArHbGa58fy 2 2 https://t.co/PgsGuV8IhU 2 2 https://de.wikipedia.org 1 1 http://wfe.smzt.shop 1 1 https://t.co/hefVyTvmY5 1 1 https://t.co/IiqEbg1O1H 1 1 https://en.wikipedia.org 1 1 https://t.co/J4jst6ZIVl 1 1 https://lm.facebook.com 1 1 https://t.co/boFovnGFQX 1 1 https://t.co/K7AIgSzdnH 1 1 https://www.wikizero.com/en/Erith 1 1 https://t.co/VNHg1ZbVBh 1 1 http://mail.kentishfootball.co.uk 0 42 http://mail.kentishfootball.co.uk/assets/css/site.css 0 8 END_PAGEREFS # Search keyphrases - Number of search # The 10 first number of search must be first (order not required for others) BEGIN_SEARCHWORDS 3 http+//kentishfootball.co.uk/news/551bc5e16406e 1 http+//kentishfootball.co.uk/news/stanpunj160418 1 http+//kentishfootball.co.uk/news/ramsgateunveildeanhillastheirnewmanager 1 END_SEARCHWORDS # Search keywords - Number of search # The 25 first number of search must be first (order not required for others) BEGIN_KEYWORDS 4 http 3 //kentishfootball.co.uk/news/ramsgateunveildeanhillastheirnewmanager 1 //kentishfootball.co.uk/news/551bc5e16406e 1 //kentishfootball.co.uk/news/stanpunj160418 1 END_KEYWORDS # Errors - Hits - Bandwidth BEGIN_ERRORS 5 400 16 159280 404 10275 8474730 301 4328 1193566 403 1 0 206 86 60627133 END_ERRORS # URL with 404 errors - Hits - Last URL referrer BEGIN_SIDER_404 3949 /admin/controller/extension/ 1 - /tmps/ 2 - /.well-known/pki-validation/iR7SzrsOUEP.php 3 - /wp-content/plugins/core/include.php 2 - /inc.php 1 - /mambo/images/stories/hessenthaler%20presents%20faversham%20town%20dover%20athletic%20shirt.jpg 2 - /adminer-4.6.1-mysql-en.php 1 - /ramsgate/whitstable041204.html 4 - /beckenham/erithtown191004.html 4 - /adminadmin/login.php 1 - /setting-pages.php 1 - /functionsn.php 1 - /wp_grupocoral/ 1 - /wines/56/domaine-langlois-chateau-2013-blanc 1 - /wp-content/plugins/xt/index.php 2 - /images/index.php 1 - /dede123dede123/admin.php 1 - /dede888dede888/login.php 1 - /wp-includes/assets/index.php 1 - /rootroot/index.php 1 - /wp_wrong_datlib.php 1 - /ramsgate/maidstone290105.html 4 - /xml.php 1 - /../ryman/bromley/cray090405.html 1 - /c999shell.php 1 - /dededede/login.php 1 - /wp-includes/Requests/Exception/HTTP/index.php 1 - /humans.txt 6 http://www.kentishfootball.co.uk/humans.txt /wp-includes/Text/about.php 9 http://www.kentishfootball.co.uk//wp-includes/Text/about.php /wp-includes/install.php 6 - /stag/.env 1 - /cray/crayvmaid100504.html 4 - /premier/dover/dartford151005.html 4 - /class-wp-filesystem-http.php 1 - /kentishfootball.co.uk 3 - /wp-includes/css/F0x.php 1 - /wp-content/themes/wso112233.php 2 - /ms-admin.php 2 - /fm.php 1 - /ms-delete-site.php 2 - /wp-content/plugins/upspy/con.php 1 - /coco/index.asp 1 - /gl_cogl_co/admin.asp 1 - /wp-head.php 5 - /ws.php7 3 - /getid3s.php 1 - /lf.php 1 - /s.php 3 - /htcohtco/login.php 1 - /xl2023x.php 2 - /public_html/class_api.php 1 - /bala.php 2 - /wp-includes/block-patterns/index.php 1 - /wines/228/chateau-cluzan-grand-vin-de-bordeaux-2010-150cl 1 - /style-css.php 1 - /playjc/ 1 - /.well-known/acme-challenge/wso112233.php 2 - /website/ 1 - /modules/mod_simplefileuploadv1.3/elements/Clean.php 1 - /Wp 2 - /mini.php 2 - /modules/modules/F0x.php 1 - /co123456co123456/admin.php 1 - /wp-admin/css/colors/xmrlpc.php 3 - /login.php 6 - /wines/68/joseph-perrier-la-cuvee-royale-brut-magnums 1 - /qnykwcoxoz.php 1 - /coadmincoadmin/login.php 1 - /wp-content/plugins/Cache/Cache.php 4 - /alf4.php 1 - /jp.php 2 - /wishlist-member/ 1 - /wp-includes/Requests/Proxy/index.php 1 - /wp-includes/css/dist/components/index.php 1 - /shop 2 - /classwithtostring.php 1 - /dededede/admin.asp 1 - /template-ajax.php 1 - /n76tweysz.php 1 - /ryman/bromley/fisher270704.html 4 - /1index.php 6 - /e-commerce.php 1 - /wp-admin/ajax-actions.php 7 - /maidstone/2ndaug05.html 4 - /r57shell.php 1 - /wp-admin/oyy8z.php 2 - /Simple_PHP_backdoor.php 1 - /random-ajax.php 1 - /cron-ajax.php 1 - /career 1 - /.well-known/pki-validation/cong.php 1 - /ws.php 5 - /co@htco@ht/admin.php 1 - /archieving.php 1 - /glgl/login.asp 1 - /guanli_coguanli_co/admin.php 1 - /wines/161/il-cascinone-rive-barbera-2012 2 - /qfunctions.php 2 - /raw.php 1 - /xfox.php 1 - /htcohtco/admin.asp 1 - /class-wp-theme-json-schema-meta.php 1 - /.git/HEAD 3 - /../../kentleague/cray/chatham081204.html 1 - /ivc/ 1 - /coadmincoadmin/login.asp 1 - /guanli@coguanli@co/login.php 1 - /b.php 1 - /lordswood/deal111005.html 3 - /indeex.php 1 - /co_glco_gl/admin.php 1 - /png-image.php 1 - /dede321dede321/index.asp 1 - /admin-header.php 2 - /indo.php 1 - /bk 6 - /locale.php 2 - /mailer1.php 1 - /4price.php 2 - /mambo/index.php-option=com_content&task=view&id=1675&Itemid=38 1 - /tonbridge/18thjune05.html 3 http://kentishfootball.co.uk/news/551a9718dcf5d /test/wp-admin/includes/ 1 - /anjas.php 2 - /wp-content/admin.php 1 www.google.com /xxx.php 1 - /engine.php 1 - /modules.php 1 - /houtaihoutai/index.asp 1 - /wp-content/plugins/content-management/ 1 - /wines/214/devils-corner-riesling-2013 2 - /common.php 1 - /index2.php 1 - /wp-content/cong.php 2 - /dede1dede1/admin.asp 1 - /large-header-stream.php 1 - /articlesubmit.blade.php 1 - /../../kentleague/maidstone/9thsept04.html 1 - /wp-content/uploads/shell20211028.php 2 - /tesla1.php 1 - /upfile.php 3 - /ryman/bromley/21stnov05.html 4 - /wp-includes/css/dist/editor/index.php 1 - /whitstable/whitvtham251003.html 5 - /mambo/templates/247portal-b-red/images/space.gif 1 - /wp-includes/Requests/Cookie/ 1 - /www 2 - /wp-ruucha.php7 2 - /class-wordpress-license.php 1 - /crack_self_restore.php 2 - /black.php 1 - /sladegreen/sladeverit100404.html 5 - /wp-content/plugins/xt/ 1 - //wp-includes/radio.php 1 - /78.php 1 - /wines/88/m-chapoutier-la-ciboise-blanc-2013 1 - /co@houtaico@houtai/login.asp 1 - /gaza.php 1 - /../ryman/bromley/7thapr05.html 1 - /idezduma.php 1 - /wines/167/miopasso-primitivo-2013 2 - /sevenoaks/thamesmead181204.html 5 - /wp-includes/js/swfupload/index.php 1 - /sittingbourne/sittvfish120404.html 6 - /houtaihoutai/login.asp 1 - /wp-inc.php 1 - /wines/257/chateau-du-glana-saint-julien-2011 1 - /locations/london-on/ 1 - /wines/255/chateau-de-blissa-2011 1 - //wp-includes/Text/about.php 5 - /alfa3.php 1 - /houtai_cohoutai_co/login.asp 1 - /st.php 2 http://www.kentishfootball.co.uk//st.php /es/traduccion-com-ar-2/ 1 - /co369co369/admin.asp 1 - /wp-admin/network/upfile.php 2 - /public_html/wp-sigunq.php 1 - /co123456789co123456789/login.asp 1 - /Alfashell.php 1 - /gl@cogl@co/admin.asp 1 - /lordswood/hythe060905.html 4 - /class-wp-post-stream.php 1 - /lordswood/lordvseve061203.html 3 - /.well-known/pki-validation/install_php1.php 1 - /wines/19/domaine-faiveley-echezaux-grand-cru-2008 1 - /wines/50/les-coteaux-tufiers-vouvray-2013 1 - /coven/ 1 - /tuxmail.php 1 - /wasc.php 1 - /xkamc.php 1 - /wp-admin/repeater.php 3 - /sito 2 - /sladegreen/sladevlord170104.html 6 - /ics/ 1 - /wp-admin/css/colors/ocean/index.php 1 - /codeimg.php 1 - /theme-install.php 1 - /wines/92/chateau-trillol-2008 1 - /62b439b835701.php 1 - /wp-content/plugins/envato-market/inc/ 1 - /rss/catalog/notifystock/ 1 - /wp-content/plugins/ango/sett.php 2 - /chatham/dartford270905.html 3 - /slider/ 1 - /wp-content/cache/busting/ 1 - /houdini1677900137.php 1 - /WordPress/wp-admin/includes/ 1 - /wines/70/laurent-miquel-prive-viognier-2012 1 - /templates/atomic/index.php 1 - /if.php 1 - /web.php 1 - /sfm.php 1 - /images/uploads/ 1 - /class-json-ajax-session.php 1 - /wp-content/uploads/leaflet-maps-marker-icons/ 1 - /bookmark-core.php 1 - /guanli_coguanli_co/login.asp 1 - /content-link.php 1 - /theme_support.php 1 - /../../kentleague/maidstone/7thjuly04.html 1 - /co@dedeco@dede/login.php 1 - /co_rootco_root/admin.php 1 - /co@glco@gl/admin.php 1 - /.well-known/pki-validation/colors/ 1 - /wp-the1me.php 2 - /xwirhnuz.php 2 - /class-wp-customize-themes-section-ajax.php 1 - /wines/200/turkey-flat-butchers-block-shiraz-grenache-mourvedre-2012 1 - /lordswood/lordswoodvvcd160803.html 6 - /juntandomemorias/ 1 - /beckenham/whitstable130805.html 4 - /co@adminco@admin/admin.asp 1 - /New 2 - /co147co147/login.asp 1 - /maidstone/18thaug05.html 4 - /predator.php 1 - /co_htco_ht/admin.php 1 - /tunbridgewells/thamesmead011204.html 4 - /tunbridgewells/7thnov04.html 4 - /../../kentleague/whitstable/5thsept05.html 1 - /gif.php 1 - /wp-content/plugins/backup-backup/includes/backup-heart.php 2 - /credits.php7 2 - /miin.php 1 - /500.php 1 - /kentleague/maidstone/24thfeb04.html 3 - /wp-includes/js/jcrop/ 1 - /dropdown.php7 2 - /class_api.php 1 - /assets/flags/4x3/ 1 - /site/wp-includes/wlwmanifest.xml 19 - /wp-includes/js/tinymce/themes/ 1 - /4VcBa.php 1 - /upload/ 2 - /theme-object.php 1 - /wp-content/index.php 5 - /main.php 2 - /wp-content/plugins/zaen/includes/ 2 - /gravesend/24thjune03.html 3 - /404webshell.php 1 - /wp-admin/css/colors/modern/lofter.php 1 - /user-new.php 2 - /houtaicohoutaico/admin.php 1 - /maintenance/ 1 - /co11co11/login.asp 1 - /wp-admin/css/colors/coffee/xmrlpc.php 3 - /img/xmrlpc.php 3 - /wines/60/turckheim-reserve-riesling-2012 2 - /othernews/conffixtures0506.html 5 - /tunbridgewells/deal090205.html 3 - /wp-includes/blocks/separator/index.php 1 - /cs/ 1 - /my1.php 3 - //wp-content/plugins/masterx/wpx.php 1 - /kentleague/cray/5thnov04.html 3 - /wp-content/plugins/ccx/index.php 1 - /media-admin.php 1 - /gravesend/9thmay04.html 3 - /wp-includes/SimplePie/Net/index.php 1 - /public_html/wp-login.php 1 - /gelay.php 1 - /script-loader-packages-blog.php 1 - /dede123dede123/login.asp 1 - /XxX.php 1 - /assets/admin/plugins/plupload/examples/upload.php 1 - /api/.env 3 - /Alfawso.php 1 - /intro/ 1 - /othernews/30thmay05.html 1 - /byps.php 1 - /.well-known/bala.php 2 - /dede1dede1/index.asp 1 - /wines/260/dominio-de-cair-anada-2010 2 - /nl/ 1 - /wines/165/mirabello-pinot-grigio-ros-2013 1 - /wines/143/vina-pomal-crianza-2011 2 - /lordswood/Hernebay200805.html 4 - /images/1/ 1 - /sittingbourne/sittvchat261203.html 6 - /mailer.php.phtml 1 - /.well-knownold/shell20211028.php 2 - /../../kentleague/sladegreen/19thsept05.html 1 - /NWremapping/wp-content/ 1 - /xtracoool.php 1 - /theme-wp.php 1 - /adminer-4.6.2-mysql-en.php 1 - //.well-known/acme-challenge/install.php 5 - /guanli_coguanli_co/index.asp 1 - /webadmin.php 1 - /wzasas2345.php 1 - /CLS.php.suspected 1 - /wines/105/tabali-reserva-viognier-2013 2 - /admin/account.php 1 - /gl@cogl@co/index.asp 1 - /co369co369/index.asp 1 - /hythe/7thnov04.html 3 - /payment.php 1 - /co_houtaico_houtai/admin.php 1 - /public/wp-includes/css/dist/editor/ 1 - //wp-content/up.php 1 - /adminer-4.5.0-mysql.php 1 - /wp-content/plugins/elementor/includes/settings/ 1 - /cgi-bin/counter_dayx/ 1 - /huiyuanhuiyuan/index.asp 1 - /wines/250/faurar-rosu-de-ceptura-2012 2 - /lordswood/whitstable120205.html 3 - /co11co11/admin.php 1 - /wines/67/joseph-perrier-la-cuvee-royale-brut-375cl-bottles 1 - /ob_get_flush.php 1 - /abs.php 1 - /public_html/index.php 1 - /oldindex.html 1 - /input.php 1 - /AK-74.php 1 - //wp-content/plugins/fix/up.php 5 - /log-in/ 1 - /wines/5/le-paradou-viognier-2012 2 - /site/wp-admin/includes/ 1 - /wines/173/miopasso-fiano-2012 1 - /co123456co123456/login.php 1 - /dede@admindede@admin/login.asp 1 - /siteheads.php 2 - /wines/94/casas-del-bosque-reserva-cabernet-sauvignon-2012 1 - /wp-admin.php 2 - /wp-content/uploads/2016/11/ 1 - /dist.widgets-compat.php 1 - /tunbridgewells/erithtown201104.html 5 - /templates/protostar/ 1 - /cohoutaicohoutai/login.asp 1 - /wp-comments-post.php 2 - /wp-theme.php 2 - /sevenoaks/hythe231004.html 5 - /wines/220/calusari-pinot-grigio-2013 1 - /langar.php 1 - /lordswood/lordsvbeckfavase200903.html 4 - /co@rootco@root/admin.asp 1 - /wp-content/uploads/2023/10/ 1 - /simple_cmd.php 1 - /xleetmailer.php 1 - /co@glco@gl/index.php 1 - /wp-includes/js/dist/index.php 1 - /co_houtaico_houtai/index.php 1 - /adminer-4.1.0.php 1 - /produkt/thermo-gloves/ 1 - /moon.php 3 - /wp-includes/ID3/ 2 - /sittingbourne/chatham151005.html 7 - /sevenoaks/hernebay161004.html 6 - /wines/46/les-hauts-du-village-rasteau-2009 1 - /2020 2 - /blog 2 - /fun.php 2 - /dede888dede888/admin.php 1 - /wp-content/plugins/css-ready-sel/ 1 - /co_htco_ht/index.php 1 - /styles.php 1 - /othernews/fav180705.html 1 - /downloader/ 1 - /nbcas56.php 1 - /wp-content/plugins/about.php 1 - /sh3ll.php 1 - /key.php 1 - /configs.php 1 - /libraries/joomla/jmails.php 1 - /wp-admin/maint/about.php 3 - /kentleague/hernebay/ashford230705.html 2 - /jp1dw.php 1 - /uploads/ 4 binance.com /coco/admin.asp 1 - /admin888admin888/index.php 1 - /doc.php 3 - /sevenoaks/beckenham131104.html 4 - /ms-upgrade-network.php 2 - /wp-dsa.php 1 - /edit-link-form.php 2 - /../premier/dover/tonbridge301004.html 1 - /wines/291/ch-de-pellehaut-10yo-armagnac-70cl 1 - /co147258369co147258369/admin.php 1 - /privt%20shell.php 1 - /disability-care/social-and-life-skills/social-and-life-skills-at-hand/ 1 - /lordswood/hythe200405.html 4 - /yhr.php 1 - /shadowx.php 1 - /administratoradministrator/admin.asp 1 - /.well-known/data/ 1 - /admin/editor/ 2 - /array_reduce.php 1 - /public_html/class_api_1.php 1 - /wp-content/uploads/2013/ 1 - /.well-known/pki-validation/upfile.php 1 - /network-stream.php 1 - /mambo/images/banners/GBWW.jpg 1 - /wp-includes/blocks/post-content/index.php 1 - /dede123dede123/login.php 1 - /libraries/joomla/ 1 - /cms/wp-admin/network/ 1 - /co888co888/login.php 1 - /gl_cogl_co/index.asp 1 - /dede@admindede@admin/login.php 1 - /dede/admindede/admin/login.asp 1 - /wp-content/plugins/plugins-setting/ 1 - /mani.php 1 - /wines/61/champagne-thienot-brut-nv 2 - /wp-admin/css/colors/sunrise/ 2 - /ryman/bromley/ashford151105.html 4 - /wines/263/fabiano-amarone-della-valpolicella-2009 1 - /sittingbourne/tonvsitt060304.html 6 - /wp-images.php 1 - /1.php 3 - /wp-includes/js/plupload/index.php 1 - /wines/41/les-cerisers-cotes-du-rhone-ros-2013 1 - /xmlrpc.php 334 - /above.php 2 - /site/images/ 1 - /lordswood/lordvramsfav181003.html 4 http://kentishfootball.co.uk/news/551a99e5155f5 /fierzashell.php 1 - /co789.123co789.123/admin.php 1 - /wp-includes/images/media/index.php 1 - /wp-admin/css/colors/light/ 2 - /wines/146/ramon-bilbao-ros-2013 2 - /link-template-cron.php 1 - /templates/beez5/error.php 1 - /wines/182/la-battistina-gavi-2013 2 - //wp-includes/js/tinymce/plugins/compat3x/css/index.php 5 - /loadme.php 1 - /co123.789co123.789/admin.php 1 - /en_bypass403.php 1 - /admincoadminco/admin.php 1 - /fr/ 1 - /wines/268/templars-hill-pinot-noir-2012 1 - /ex.php 1 - /images/megamenu/ 1 - /plugin.php 1 - /wp-admin/network/xmrlpc.php 3 - /Cookie-ajax.php 1 - /admin.php 5 - /functions.wp-page.php 1 - /cray/crayvtunb271203.html 3 - /acces.php 1 - /sladegreen/thamesmead261105.html 4 - /jobs 1 - /premium.php 1 - /l28.php 1 - /wines/234/san-felice-chianti-classico-magnum-2009 1 - /wines/174/fertuna-lodai-2008 1 - /co@htco@ht/index.php 1 - /wp-content/plugins/seoo/wsoyanz.php 3 - /wp-includes/certificates/ 2 - /wordpress/wp-includes/ 2 - /test.php 2 - /wp-includes/customize/index.php 1 - /co_888co_888/admin.asp 1 - /akab.php 1 - /wp-includes/fonts/index.php 1 - /module.audio-video.matrosk.php 1 - /2022 2 - /othernews/Tables201004.html 1 - /ak5.php 1 - /hernebay/ramsgate170804.html 4 http://kentishfootball.co.uk/news/551a99e5155f5 /wp-admin/js/ 2 - /co147258369co147258369/login.asp 1 - /twenty.php 1 - /google-in.php 1 - /co_glco_gl/index.php 1 - /wp-content/plugins/column/ 1 - /wines/20/saint-veran-2012-chanson 2 - /wp-content/plugins/core-plugin/ 1 - /wp-content/plugins/BrutalShell/ 2 - /wp-admin/images/index.php 2 - /erith&belvedere/e&bvfolk010104.html 2 http://kentishfootball.co.uk/news/551a97992f193 /sladegreen/sladevcray100204.html 2 http://kentishfootball.co.uk/news/551a9c9247459 //wp-content/plugins/index.php 1 - /cof.php 1 - /co_houtaico_houtai/login.php 1 - /co_dedeco_dede/index.asp 1 - /wp-includes/blocks/rss/index.php 1 - /option-link.php 1 - /xbwkq0hm.php 1 - /sittingbourne/sittverit181103.html 6 - /wp-includes/SimplePie/HTTP/ 1 - /wp-admin/css/colors/ectoplasm/index.php 1 - /mon/ 1 - /wp-admin/css/colors/midnight/ 2 - /mixins.php 1 - /admin/.env 3 - /premier/welling/13thmay05.html 4 - /wines/54/domaine-les-grands-presbyteres-2013-muscadet-sevre-maine-sur-lie 1 - /edudigital/wpadmin/network/ 1 - /dededede/admin.php 1 - /index9.php 1 - /wp-cache.php 1 - /byp.php 2 - /wp-content/plugins/widget-logic/%20%20 1 - /ioxi-rex4.php7 4 - /wines/78/domaine-de-pellehaut-chardonnay-fruit-2013 1 - /combined.php 1 - /core.class.php 1 - /css-admin.php 1 - /sevenoaks/maidstone190305.html 4 - /nshell.php 1 - /wines/190/collefrisio-pecorino-2012 2 - /wss.php 1 - /lufixn.php 2 - /guanli_coguanli_co/admin.asp 1 - /5.php 1 - /yl10gohp.php 2 - /wines/134/the-pavillion-shiraz-viognier-2013 1 - /c0derz_shell.php 1 - /affiliates/ 1 - /htcohtco/admin.php 1 - /darkshell.php 1 - /site-brandes.php 1 - /ht@coht@co/login.asp 1 - /ccx/index.php 4 - /trockenbau/ 1 - /hob.php 1 - //wp-content/plugins/Cache/Cache.php 1 - /wines/115/the-crossings-sauvignon-blanc-marlborough-2013 1 - /new_license.php%20 1 - /premier/dover/9thnov05.html 4 - /plugins-log.php-main 1 - /sittingbourne/14thoct05.html 5 - /dede/dededede/dede/admin.asp 1 - /vfvfv.jpg.php 1 - /wp-content/plugins/dzs-zoomsounds/ 1 - /mini.php5_.pdf 1 - /greenwich/2nddec04.html 4 - /wp-content/themes/cameleon/includes/fileuploader/upload_handler.php 1 - /wines/216/geoff-merrill-cilento-sangiovese-2010 1 - /wp-content/uploads/revslider/ 1 - /xxxxxminoksxxxx2021/xxxxxminoksxxxx2021.php 2 - /wp-mna.php 1 - /classsmtps.php 3 - /wines/11/chateau-de-la-nauve-st-emilion-2012 1 - /thamesmead/11thfeb05.html 3 http://kentishfootball.co.uk/news/551bc5ded1923 /wines/178/chianti-riserva-volpetto-2011 1 - /my-account/ 1 - /wines/83/maison-de-vigneron-pays-des-cotes-de-gascogne-sec-white-2013 1 - /abu.php 1 - /haxor.php 1 - /de/home/ 1 - /sittingbourne/chatham271205.html 7 - //wp-content/upload.php 1 - /error-log.php 1 - /server.php 1 - /othernews/16thjune04.html 1 - /.well-known/pki-validation/class_api.php 3 - /demo 2 - /ee.php 6 http://www.kentishfootball.co.uk//ee.php /sladegreen/beckenham121105.html 6 - /co_managerco_manager/index.asp 1 - /rootroot/index.asp 1 - /admin/plugins/plupload/examples/upload.php 1 - /wines/129/bellingham-grenache-blanc-viognier-2013 1 - /dededede/login.asp 1 - /wp-includes/ID3/wp-conflg.php 2 - /shx.php 2 - /wines/90/cotes-dauvergne-gamay-2013 2 - /erithtown/29thjan05.html 5 - /sladegreen/maidstone140804.html 5 - /sevenoaks/erithtown261004.html 4 - /class-sprofil.php 1 - /wp-includes/Text/Diff/Renderer/index.php 1 - /class-json-dependency-session.php 1 - /class-IXR-http.php 1 - /hythe/KSTFinalPreview160404.html 4 - /news.html 3 http://www.kentishfootball.co.uk/news.html /psychosfera/ 1 - /expect.php 1 - /mfi.php 2 - /dede@admindede@admin/admin.asp 1 - /ryman/bromley/fisheru18vbromu18070304.html 4 - /406.php 1 - /olux.php 1 - /wp-content/vuln.php 1 - /admin-functions.php 2 - /0we87sud.php 1 - /wines/166/latium-morini-soave-2013 2 - /wsoyanz1.php 1 - /megamenu-sale-off.php 1 - /olu.php 1 - /wpm.php 1 - /treame.php 1 - /htcohtco/login.asp 1 - /kil.php 1 - /othernews/garyjohnson040106.html 1 - /plumbing-professionals/ 1 - /conference/margate/fisher241005.html 5 - /wp-content/themes/clockstone/style.css 1 - /wp-admin/css/colors/blue/ 2 - /wines/97/emiliana-syrah-2012 1 - /templates/beez3/ 1 - /hello.php 1 - /dev.php 1 - /wp-includes/Text/Diff/Engine/ 1 - /beckenham/maidstone190205.html 3 - /wines/179/chianti-volpetto-2012 2 - /wp-admin/css/index.php 5 - /class-matchesmapregex-error-comment.php 1 - /wp-cc.php 2 - /wp-includes/Text/ 2 - /12.php 1 - /premier/dover/2ndjan06.html 4 - /sagafif.php 1 - /wp-content/plugins/theme-configurator/mini.php 1 - /cray/crayvtham291003.html 6 - /wp-admin/css/colors/cloud.php 1 - /post-template-ajax.php 1 - /class-wordpress-cloud.php 1 - /wp-content/plugins/seoo/alfa-ioxi.php 2 - /.well-known/pki-validation/about.php 1 - /trio-kece.php 1 - /wines/149/anna-de-codorniu-brut-nv 1 - /co_888co_888/admin.php 1 - /indexs.php 1 - /custom-header.php 2 - /home.php 2 - /wines/66/joseph-perrier-cuvee-royale-brut-ros-nv-375cl-bottle 1 - /.well-known/pki-validation/cloud2.php 1 - /../../kentleague/ramsgate/tonbridge020106.html 1 - /class-pop3.old.php 1 - /post-formats.php 1 - /wines/270/longbend-sauvignon-blanc-2013 1 - /sittingbourne/sittvfolk030404.html 3 http://kentishfootball.co.uk/news/551a97992f193 /user-edit.php 2 - /wp-includes/SimplePie/Content/Type/index.php 1 - /co123456789co123456789/admin.asp 1 - /tux.php 1 - /ms-options.php 2 - /.well-known/acme-challenge/ 2 - /wp-includes/css/dist/nux/ 1 - /kentleague/whitstable/5thsept05.html 3 - /sites.php 1 - /simple-shell.php 1 - /template-stream.php 1 - /wines/201/cranswick-estate-merlot-2012 2 - /classfuns.php 2 - /wp-content/themes/gaukingo/ 1 - /guanlicoguanlico/login.php 1 - /lib.php 1 - /kentleague/ramsgate/1stjan06.html 3 http://kentishfootball.co.uk/news/551a99e5203dd /tablepress_controllers.php 1 - /co258co258/admin.php 1 - /wp-init.php 1 - /uplaod.php 1 - /wines/59/turckheim-reserve-pinot-blanc-2012 1 - /coco/login.php 1 - /authorize/ 1 - /wines/195/chapel-down-english-ros-2013 2 - /gix.php 1 - /ht_coht_co/login.asp 1 - /vaga.php 1 - /wp-content/uploads/2023/05/ 1 - /accountaccount/login.asp 1 - /class-wp-customize-themes-section-meta.php 1 - /international/ 1 - /uuquduwu.php 1 - /wp-includes/blocks/embed/index.php 1 - /wines/141/raimat-castell-de-raimat-tempranillo-2010 1 - /wp-content/themes/lightspeed/framework/_scripts/valums_uploader/php.php 1 - /min.php 1 - /FoxWSOv2.php 1 - /lordswood/thamesmead300305.html 3 - /password-page/ 1 - /co999co999/admin.asp 1 - /kentleague/ramsgate/24thjune05.html 4 - /co@guanlico@guanli/admin.php 1 - /ryman/bromley/bromvtonb270104.html 5 - /lordswood/beckenham220105.html 3 - /co666co666/admin.asp 1 - /ladies-football/2 1 - /contacts.php 1 - /wines/145/la-vicalanda-rioja-reserva-2009 1 - /beckenham/sladegreen180904.html 3 http://kentishfootball.co.uk/news/551bc5e38b923 /sladegreen/lordswood111204.html 6 - /kentleague/sevenoaks/bromley020805.html 5 - /VCD/hythe261105.html 4 - /guanli_coguanli_co/index.php 1 - /naujienos/ 1 - /css/xmrlpc.php 3 - /.ftpconfig 2 - /wp-header.php 1 - /wines/6/chateau-argadens-bordeaux-superieur-2008 1 - /houtai@cohoutai@co/login.asp 1 - /cray/1stmay04A.html 3 - /load.php 1 - /wp-0.php 1 - /wp-admin/maint/maint/ 1 - /10.php 1 - /func.php 1 - /wp-add.php 2 - /wp-content/uploads/2022/ 2 - /sym.php 1 - /album_cat.php 1 - /wines/293/joseph-perrier-la-cuve-royale-blanc-de-blancs 1 - /admin888admin888/login.php 1 - /trust.php 2 - /ms-sites.php 2 - /offer-01/ 1 - /co_rootco_root/index.php 1 - /wp-includes/css/dist/block-directory/ 1 - /admin-bar.php 1 - /Psmith 1 - /simattacker.php 1 - /sevenoaks/erithtown060905.html 6 - /c.php 2 - /wp-includes/blocks/calendar/index.php 1 - /co123co123/index.asp 1 - /V5.php 1 - /cohoutaicohoutai/login.php 1 - /thamesmead/3rdjune05.html 4 - /managermanager/index.asp 1 - /admin@coadmin@co/login.asp 1 - /fatal.php 1 - /wp-mail.php 2 - /wp-includes/wlwmanifest.xml 7 - /managermanager/admin.php 1 - /.well-known/fierzashell.php 2 - /club_mysqli_admin_photo_club_selected.php 1 - /deal/dealvcrayfav181003.html 4 - /sladegreen/sladevgreen140204.html 6 - /dede@admindede@admin/index.php 1 - /glgl/index.php 1 - /co@adminco@admin/index.asp 1 - /wines/202/cranswick-estate-shiraz-2012 2 - /sts.php 1 - /accountaccount/index.php 1 - /wp-content/404JBQ/ 1 - //wp-admin/alfa.php 1 - /wp-admin/css/colors/modern/ 2 - /wp-aa.php 5 - /conference/margate/19thapr05.html 4 http://www.kentishfootball.co.uk/conference/margate/19thapr05.html /wp-includes/rest-api/about.php 9 http://www.kentishfootball.co.uk//wp-includes/rest-api/about.php /wp-admin/images/iR7SzrsOUEP.php 2 - /wines/183/bottega-vinai-pinot-grigio-2013 1 - /wp-includes/css/dist/nux/index.php 1 - /ab.php 1 - /VCD/tunbridgewells071204.html 5 - /wp-content/themes/alera/%C2%AE.php 2 - /ext.php 2 - /jam.php 1 - /kentleague/sladegreen/23rdoct05.html 3 - /co@dedeco@dede/index.php 1 - /index3.php 1 - /co11co11/admin.asp 1 - /plugin-install.php 2 - /mail.php 2 - /mambo/images/M_images/emailButton.png 1 - /wp-admin/install.php 5 http://www.kentishfootball.co.uk//wp-admin/install.php /dede888dede888/index.asp 1 - /wp-content/uploads/6caOMX9O/ 1 - /wp-close.php 1 - /calv.php 1 - /images.php 1 - /wp-content/themes/etxrodc/ 1 - /wp-includes/Text/Diff/Renderer/ 2 - /b0.php 2 - /site/wp-includes/empty.php 2 - /gf.php 2 - /ah.php 1 - /wp-content/themes/welfare-charity/ 1 - /.well-known/pki-validation/moon1.php 1 - /wp-content/uploads/curriculos/ 1 - /assets/uploads/content/Bromley_AGM_Award.jpg 1 http://kentishfootball.co.uk/news/bromley070615 /wp-includes/random_compat/about.php 2 - /co258co258/index.php 1 - /.well-known/pki-validation/file.php 1 - /bimowdoodk.php 1 - /cron.php 1 - /killbot.php 1 - /sqlnew.php 1 - /wines/112/montevista-sauvignon-blanc-ros-2013 1 - /license.php 2 - /img-nav-3.php 1 - /OLD 2 - /admin/controller/extension/wpm.php 2 - /issue/imagination-festival-at-the-morrin-centre/ 1 - /wines/252/domaine-de-la-vieille-julienne-cotes-du-rhone-2006 1 - /blog/ 2 - /.well-known/pkivalidation/ 1 - /wp-admin/dropdown.php 8 http://www.kentishfootball.co.uk//wp-admin/dropdown.php /wordpress/wp-admin/includes/wp-admin/js/ 2 - /pm_login/ 1 - //fonts.googleapis.com/css 2 - /shell.php 3 - /wp-includes/ID3/wp-includes/IXR/ 2 - /templates/atomic/error.php 1 - /marijuana.php 2 - /repeater.php7 2 - /wines/136/the-pavillion-shiraz-cabernet-2013 1 - /cray/KSTSF080304.html 4 - /PvT.php 1 - /Core-wp.php 1 - /pHpINJ.php 1 - /co999co999/index.asp 1 - /stephen@kentishfootball.co.uk 9 - /ryman/bromley/7thapr05.html 4 - /co666co666/index.asp 1 - /edit-comments.php 2 - /wp-includes/ 4 - /co11co11/login.php 1 - /wp-includes/images/install.php 1 - /glgl/admin.php 1 - /plug.php 1 - /thamesmead/12thjuly05.html 3 http://kentishfootball.co.uk/news/551bc5da40d4b /css/language/ 1 - /wp-includes/css/dist/edit-widgets/index.php 1 - /1945.php 1 - /press-this.php 2 - /lock360.php 3 - /lab.php 1 - /wp-includes/blocks/image/index.php 1 - /tnt.php 1 - /wines/52/philippe-girard-sancerre-silex-2013 1 - /style2.php 2 - /co123co123/admin.asp 1 - /assets/plupload/examples/upload.php 1 - /whitstable/19thaug05.html 4 - /wp-content/plugins/accountancy-old/ 1 - /kentleague/whitstable/4thjuly04.html 4 - /../../kentleague/cray/folkestone061104.html 1 - /well.php 1 - /query-grid-posts-meta.php 1 - /wines/256/chateau-cambon-la-pelouse-2009 1 - /telescope/requests 1 - /newflon/ 1 - /images/F0x.php 1 - /wp-content/dropdown.php 7 http://www.kentishfootball.co.uk//wp-content/dropdown.php /classapi.php 1 - /sladegreen/ramsgate260205.html 4 http://kentishfootball.co.uk/news/551a99e5155f5 /server-status 1 - /sett.php 1 - /wines/273/monteagrelo-bressia-malbec-2011 1 - /wp-includes/repeater.php 3 - /wsanon.php 1 - /class-wp-cache.php 1 - /hplfuns.php 2 - //wp-content/plugins/instabuilder2/cache/plugins/moon.php 1 - /copypaths.php 2 - /wboom.php 2 - /houtai@cohoutai@co/index.asp 1 - /deco/ 1 - /hernebay/20thjan05.html 3 - /autoload-private.php 1 - /archiver.php 1 - /.well-known/pkivalidation/bala.php 2 - /welcome/ 1 - /disclaimer/ 1 - /wp-includes/images/smilies/ 2 - /wp-info.php 3 - /wp-includes/js/tinymce/skins/lightgray/fonts/index.php 2 - /public_html/cong.php 1 - /images/6/ 1 - /byte_safe_strings-meta.php 1 - /admin/controller/extension/extension/ 4 binance.com /wp-content/plugins/upspy/index.php 1 - /lfixx.php 1 - /wp-includes/assets/ 1 - /wp-content/themes/ccx/index.php 2 - /wp-content/plugins/aryabot/ 2 - /jobs/ 1 - /wp-includes/blocks/preformatted/index.php 1 - /wines/269/templars-hill-pinot-gris-2013 2 - /%22 2 - /file-managertemp.php 1 - /wp-content/uploads/bala.php 2 - /theme-inshpvx.php 1 - /templates/beez/ 1 - /wso1.php 1 - /wp-content/plugins/fix/up.php 8 - /wp-defaul.php 1 - /wines/169/canapi-ros-2013 1 - /xleetshell.php 2 - /link-add.php 2 - /4pride.php 1 - /gallery/ 1 - //OLD/wp-admin/setup-config.php 2 www.google.com /wikiindex.php 1 - /othernews/19thjuly05.html 1 - /wp-content/uploads/2023/07/ 1 - /.wp-cli/index.php 1 - /beckenham/hythe020405.html 4 - /cakil/ 2 - /mambo/images/stories/birken%20road%20tunbridge%20wells%203%20feb%202009.jpg 1 - /wp-s.php 1 - /houtaicohoutaico/admin.asp 1 - /sub.php 1 - /wp-includes/css/about.php 1 - /rxr.php 1 - /wp-admin/css/colors/midnight/index.php 1 - /smarter/ 1 - /wines/215/frankin-tate-semillon-sauvignon-blanc-2012 1 - /mambo/images/banners/VSUKBANNER650.gif 1 - /components/ 2 - /co_managerco_manager/login.asp 1 - /recet.php 1 - /tinyupload.php 1 - /admin888admin888/admin.asp 1 - /cyborg_tmp.php 2 - /heysrv.php 1 - /tunbridgewells/4thfeb05.html 4 - /wp-includes/blocks/file/index.php 1 - /.vscode/sftp.json 6 - /cgi-bin/cgi-bin/about.php7 5 http://www.kentishfootball.co.uk//cgi-bin/cgi-bin/about.php7 /kentleague/tunbridgewells/littlehampton310805.html 2 http://www.kentishfootball.co.uk/kentleague/tunbridgewells/littlehampton310805.html /wines/26/macon-villages-vins-auvigue-2012 1 - /Admin/uploads/ 2 - /co_rootco_root/login.php 1 - /wp-content/uploads/2016/ 1 - /coadmincoadmin/admin.asp 1 - /sladegreen/hythe030905.html 6 - /wp-atom.php 2 - /wp-trackback.php 2 - /wp-includes/rest-api/ 2 - /ioxi-rex.php 1 - /wp-includes/Text/Diff/Engine/index.php 1 - /tunbridgewells/erithtown240105.html 3 - /5index.php 1 - /wp-title.php 1 - /TNT.php 2 - /wp-content/plugins/content-management/content.php 2 - /wp-content/themes/bala.php 2 - /../../kentleague/ramsgate/deres160705.html 1 - /sladegreen/sladevsport170404.html 3 - /othernews/Tables271004.html 1 - /class--error.php 1 - /ramsgate/ramsvbeck030404.html 4 - /houtaihoutai/login.php 1 - /sladegreen/lordswood021004.html 7 - /mambo/images/banners/BrowningsRemovals.jpg 1 - /sittingbourne/22ndsept05.html 5 - /assets/bootstrap/plugins/plupload/examples/upload.php 1 - /ryman/bromley/eghamvbrom060404.html 1 - /wp-content/plugins/vwcleanerplugin/ 1 - //uploads/xleet.php 1 - /ramsgate/ramsvtham060404.html 5 - /enjeidqspo.php 1 - /wp-admin/js/widgets/index.php 1 - /wp-content/themes/alera/alera/%23U00ae.php 2 - /media.php 2 - /misRutas.php 1 - /wines/98/adobe-reserva-gewurztraminer-2013 1 - /wp-content/uploads/2023/03/ 1 - /wp-content/plugins/TOPXOH/XleetSeller85.php 1 - /rss.php 2 - /co_dedeco_dede/login.php 1 - /gfflrdzdsh.php 1 - /wp-includes/blocks/query-pagination-numbers/index.php 1 - /wp-content/plugins/seoo/ 1 - /wp-inda.php 1 - /houtaihoutai/index.php 1 - /wines/237/chateau-haut-bernasse-monbazillac-2003-50cl-bottle 1 - /houtaicohoutaico/index.php 1 - /wp-includes/blocks/block/index.php 1 - /premier/welling/4thjan05.html 3 - /co123456789co123456789/index.php 1 - /wp-includes/sodium_compat/ 1 - /xt/ 1 - /ghost287.php 1 - //wp-content/plugins/Cache/dropdown.php 6 - /wp-includes/images/index.php 1 - /../ryman/bromley/1stmay05.html 1 - /wp-xxx.php 1 - /class-wp-post-link.php 1 - /ryman/bromley/17thjuly05.html 1 - /class-wp-rest-core.php 1 - /wp-includes/xl2023.php 2 - /wordpress/wp-admin/includes/ 1 - /co123456789co123456789/admin.php 1 - /wines/14/chateau-cardinal-villemaurine-2009-saint-emilion-grand-cru 1 - /system.php 1 - /wines/164/mirabello-pinot-grigio-2013 2 - /greenwich/ramsgate231104A.html 3 http://kentishfootball.co.uk/news/551a99e5155f5 /wp-admin/index.php 1 - /modules/mod_simplefileuploadv1.3/elements/%C2%AE.php7 5 - /class.widgets-tokens.php 1 - /wp-includes/css/index.php 1 - /ramsgate/31stmar05.html 5 - /courier-forbiden.php 1 - /.well-known/pki-validation/radio.php 1 - /ryman/bromley/16thjuly03.html 1 - /class-wp-image-editor-fd.php 1 - /wines/267/westwell-classic-ferment-2013 1 - /hythe/erith210804.html 4 - /WWW 2 - /../premier/dover/16thjan05A.html 1 - /events/main-stage/ 1 - /web/wp-includes/wlwmanifest.xml 18 - /66cloud.php 1 - /wp/wp-includes/ 1 - /kanghoax.php 1 - /components/com_b2jcontact/ 1 - /sladegreen/tunwells191004A.html 4 http://kentishfootball.co.uk/news/551bc5e7046df /wp-content/mu-plugins/ 4 - /co789.123co789.123/login.php 1 - /wp-admin/js/widgets/iR7SzrsOUEP.php 2 - /class-wp-page-icon.php 1 - /0byte.php 2 - /spl-autoload-compat-core.php 1 - /assets/uploads/content/Stuart_Zanone_breaks_Ashford_Uni.jpg 2 - /class-envato-market-api.php 1 - /site 2 - /srx.php 1 - /wp-admin/includes/wp-conflg.php 2 - /muahlhae.php 1 - /widgets.sys.php 1 - /libraries/legacy/ 1 - /PHPmailer.php 1 - /reg_backup.php 1 - /forumfilm/ 1 - /../ryman/bromley/cray130805.html 1 - /yytalhfs.php 1 - /class-IXR-update.php 1 - /.well-known/pki-validation/wp-hudbud.php 1 - /wp-content/plugins/ppus/%20%20%20%20 1 - /root.php 1 - /00.php 1 - /wines/84/j-m-despres-la-madone-fleurie-vieilles-vignes-2011 1 - /common/admin/Jobs2/Telerik.Web.UI.DialogHandler.aspx 2 - /fIgV0s.php 1 - /wp-admin/x.php 1 - /co_glco_gl/index.asp 1 - /sevenoaks/17thfeb05.html 4 - /a100-001-i1/ 1 - /assets/css/bootstrap-3.cs 1 - /wp-content/uploads/2021/12/ 1 - /wp-includes/Requests/ 2 - /alfapas.php 1 - /index7.php 1 - /wines/266/westwell-barrel-ferment-2013 2 - /lufix.php 2 - /lucky-charms/wp-admin/ 1 - /2018/wp-includes/wlwmanifest.xml 3 - /.tmb/ 1 - /public_html/license.php 1 - /b0x.php 1 - /index_.php 1 - /templates/beez/index.php 1 - /kentleague/whitstable/plaayacupfinal04.html 3 http://kentishfootball.co.uk/news/551a99e5203dd /blog/wp-admin/includes/ 1 - /.well-known/pki-validation/cloud.php 4 - /dirs.php 1 - /dede_admindede_admin/index.asp 1 - /wp-content/plugins/ubh/con.php 1 - /templates/beez3/error.php 1 - /LA.php 2 - /site-log.php 1 - /cong.php.suspected 1 - /wp-content/plugins/db/ 2 - /co@htco@ht/index.asp 1 - /assets/smartmenus/addons/bootstrap/jquery.smartmenus.bootstrap.cs 2 - /class-wp-customize-nav-emnu-location-control.php 1 - /spingleosaka_entry/ 1 - /lordswood/22ndaug04.html 3 - /ice.php 1 - /.css.php 1 - /adminer-4.6.2.php 1 - /wines/107/tabali-reserva-late-harvest-muscat-2011-375cl-bottle 1 - /wp-includes/theme-compat/ 1 - /wp-config-samples.php.suspected 1 - /admin-post.php 3 - /wines/175/baroncini-orveito-classico 2 - /wp-includes/ChbRoNP/ 1 - /class-wp-custom.php 1 - /black2llleaf.php 1 - /guanli_coguanli_co/login.php 1 - /co789.123co789.123/index.asp 1 - /wines/151/ramon-bilbao-monte-blanco-rueda-verdejo-2013 1 - /Backup 2 - /ayk.php 2 - /chatham/ChatvSitt010104a.html 4 - /wp-content/plugins/display-posts-shortcode/ 1 - /wines/249/quinta-do-portal-colheita-2012 1 - /wp-content/uploads/2023/06/ 1 - /Captions.php 1 - /gel4y.php 1 - /dede@admindede@admin/admin.php 1 - /erith&belvedere/folkestone301104.html 2 http://kentishfootball.co.uk/news/551a97992f193 /wp-admin/yrtbfd/sdvfsdbfd/ 1 - /e/admin/index.php 1 - /wp-content/plugins/ioptimization/ 1 - /ryman/bromley/13thjune04.html 1 - /edit-form-advanced.php 2 - /class-wp-block-template-ajax-response.php 1 - /geblokkeerd/ 1 - /wines/45/ortas-les-viguiers-ros-2013 2 - //ajax.googleapis.com/ajax/libs/jquery/1/jquery.js 6 - /jvc.php 1 - /Lux.php 1 - /co11co11/index.asp 1 - /wines/156/cartlidge-and-browne-sauvignon-blanc-2012 1 - /wp-includes/blocks/post-template/index.php 1 - /garbagecron_driver.php 1 - /wines/253/chateau-moulin-des-richards-2011 1 - /n.php 2 - /wp-content/plugins/background-image-cropper/ 1 - /../../conference/gravesend/26thjan05.html 1 - /assets/template_admin/lib/plupload/examples/upload.php 1 - /templates/protostar/index.php 1 - /folkestone/chatvfolk200304.html 4 - /lang_import.php 1 - /admin888admin888/admin.php 1 - /gl_cogl_co/index.php 1 - /wp-includes/blocks/pullquote/index.php 1 - /co888co888/login.asp 1 - /guanli@coguanli@co/admin.php 1 - /houtai@cohoutai@co/login.php 1 - /3.php 1 - /wp-includes/blocks/audio/index.php 1 - /iR7SzrsOUEP.php 2 - /blocks/table/int/tmpl/ 1 - /wines/192/septimo-obra-septima-malbec-2012 1 - /pl/ 1 - /fofo.php 1 - /7.php 1 - /text.php 3 - /co@houtaico@houtai/admin.asp 1 - /wines/65/antech-cremant-de-limoux-brut-cuvee-eugene-2011 1 - //wp-content/plugins/ 5 - /houtaihoutai/admin.asp 1 - /wines/23/chassagne-montrachet-rouge-vieilles-vignes-bernard-moreau-2010 1 - /message.php 1 - /mambo/images/stories/liam%20daish%20with%20fa%20trophy.jpg 1 - /shell20211022.php 1 - /j.php 1 - /wp-content/plugins/wp-daft/ 1 - /wp-admin/network/iR7SzrsOUEP.php 2 - /tonbridge/folkestone150205.html 2 http://kentishfootball.co.uk/news/551a97992f193 /_parse_propfind.php 1 - /wp-includes/ID3/index.php 1 - /ryman/bromley/bromvfolk230304.html 4 - /tool.php 1 - /wp-content/plugins/linkpreview/db.php 1 - /co.php 1 - /q5K7UjiMheOi/ 1 - /admin_coadmin_co/login.php 1 - /wp-content/plugins/td-composer/license.txt 2 - /images/ 4 binance.com /159.php 1 - /tunbridgewells/lordswoodu18050904.html 5 - /error_breess.php 1 - /wp-content/plugins/upspy/sllolx.php 1 - /wines/55/sancerre-2011-langlois-chateau 2 - /wp-content/uploads/index.php 1 - /error.php 1 - /link-parse-opml.php 2 - /co1co1/index.php 1 - /wp-content/themes/twentyfive/ 2 - /beence.php 2 - /adminer-4.6.2-en.php 1 - /wp-admin/css/colors/ocean/ 2 - /alf42.php 1 - /debug/default/view 1 - /sittingbourne/dartford240804.html 5 - /../../kentleague/cray/ashford061205.html 1 - /HNAbINnn.php 1 - /wines/126/franschhoek-cellar-the-old-museum-merlot-2013 1 - /htht/login.asp 1 - /wp-includes/Requests/about.php 2 - /gsl.php 1 - /1ytnzpekh.php 1 - /admin/assets/global/plugins/plupload/examples/upload.php 1 - /co_htco_ht/index.asp 1 - /order_form_a.php 1 - /images/front_galery/ 1 - /../../kentleague/ramsgate/24thjune05.html 1 - /gfuioifl.php 1 - /wines/184/conviviale-montepulciano-dabruzzo-2012 1 - /wp-content/uploads/2016/03/ 1 - /wp-content/themes/seotheme/ 1 - /houtaicohoutaico/index.asp 1 - /wp-config-sample.php 2 - /co@glco@gl/index.asp 1 - /templates/system/error.php 1 - /worksec.php 1 - /wines/120/franschhoek-cellar-baker-station-shiraz-2012 1 - /wp-content/plugins/ioxi/ 1 - /wp-diff.php 1 - /mambo/templates/247portal-b-red/images/right2.jpg 1 - /wp-2021.php 2 - /.well-known/acme-challenge/cloud.php 5 - /wp-content/plugins/rbggseh/ 1 - /wp-includes/blocks/social-link/index.php 1 - /defender.php 1 - /wp-incc.php 1 - /wp-content/plugins/core-stab/ 2 - /dede1dede1/index.php 1 - /version.php 2 - /bot.php 1 - /wp-admin/css/colors/coffee/ 2 - /sladegreen/greenwich131104.html 5 - /plugins-log.php 1 - /upel.php 1 - /bypass.php 2 - /sladegreen/15thsept04.html 6 - /wp-admin/user/install.php 1 - /cgi-bin/xmrlpc.php 3 - /wp-content/themes/signify/ 1 - /assets/up/ 1 - /cms/wpadmin/network/ 1 - /discount.php 2 - /../../kentleague/ramsgate/tonbridge290805.html 1 - /wines/206/geoff-merrill-mclaren-vale-shiraz-2009-jackos-blend 1 - /files/ 4 binance.com /deal/dealvcray011103.html 4 - /wp-cron.php 2 - /gl@cogl@co/index.php 1 - /co123456789co123456789/login.php 1 - /zcache.php 1 - /1337.php 1 - /robot.php 1 - /log.php 2 - /co369co369/index.php 1 - /huiyuanhuiyuan/login.asp 1 - /wp-content/themes/finley/ 1 - /wp-content/plugins/background-image-cropper/ups.php 2 - /docs/ 1 - /wp-pano.php 3 - /xlt.php 2 - /wp-content/uploads/2018/dir/ 1 - /class-https.php 1 - /uni.php 1 - /ini.php 2 - /wp-admin/includes/wp-conflg.php.suspected 2 - /IPv6-meta.php 1 - /.well-known/index.php 1 - /thumb.php 1 - /index.html 1 - /wp-activate.php 3 - /thamesmead/greenwich170804.html 3 http://kentishfootball.co.uk/news/551bc5dad6b34 /class-wp-page-zXJGhl.php 1 - /conference/margate/22nddec05.html 3 - /wines/265/westwell-special-cuvee-2010 1 - /cybershell.php 1 - /wp-content/plugins/apikey/ 2 - /../ryman/bromley/margate221105.html 1 - /ms-link.php 1 - /cjfuns.php 4 - /co@rootco@root/login.asp 1 - /wp-includes/blocks/spacer/index.php 1 - /contato.php 1 - /alfa.php 2 - /templates/system/ 1 - /wines/76/laurent-miquel-prive-syrah-2013 2 - /.well-known/acme-challenge/shell20211028.php 2 - /SITE 2 - /beckenham/tunwells101205.html 3 - /cache-compat.old.php 1 - /img/ 1 - /blockstmp.php 1 - /adminer-4.5.0.php 1 - //wp-admin/dropdown.php 6 - /wikindex.php 1 - /admin/uploads/images/ 2 - /xleet.php 2 - /skipper.php 1 - /mambo/index.php-option=com_content&task=view&id=6214&Itemid=42 1 - /maidstone/whitstable241004.html 3 - /wp-p.php7 3 - /wp-content/configDZM/ 1 - /wines/295/joseph-perrier-cuve-josphine-2004 1 - /de/wp-admin/ 1 - /security.txt 6 http://www.kentishfootball.co.uk/security.txt /wp-fdd.php 2 - /co_htco_ht/admin.asp 1 - /wp-content/plugins/ 9 http://www.kentishfootball.co.uk//wp-content/plugins/ /dede_admindede_admin/admin.php 1 - /wines/33/domaine-faiveley-mercurey-clos-rochette-2010 1 - /sevenoaks/hernebay201104.html 5 - /export.php 2 - /templates/atomic/%20%20%20%20 1 - /site-themes.php 1 - /sitemap_index.xml 2 - /bb.php 1 - /.tmb/install.php 1 - /wines/163/gpg-delle-venezie-garganega-pinot-grigio-2013 1 - /main 6 - /wp-content/uploads/wp/ 1 - /newup.php 1 - /ryman/bromley/fisherfacupreplay210904.html 4 - /co@glco@gl/admin.asp 1 - /wines/113/dr-loosen-riesling-2013 2 - /landing/ 1 - /wp-db.php 1 - /wp-content/uploads/estate_templates/plugin/ 1 - /wines/101/emiliana-sauvignon-blanc-2013 1 - /rootroot/admin.asp 1 - /co147co147/login.php 1 - /wines/188/ita-prosecco-spumante-brut-nv 2 - /dede1dede1/admin.php 1 - /wp-admin/network/theme-inshpvx.php 1 - /wp-content/uploads/et_temp/ 1 - /wp-find.php 1 - /cray/crayvsevenoaks200903.html 3 - /wp-content/style-css.php 2 - /wordpress 6 - /comfunctions.php 2 - /far.php 1 - /simple_php_backdoor_by_dk.php 1 - /api/ 1 - /wines/24/chablis-1er-cru-vosgros-2011-gilbert-picq 1 - /.well-known/pki-validation/2index.php 1 - /exit.php 1 - /wp-content/NewFolder/NewFolder/NewFolder/ 1 - /wp-content/languages/install.php 1 - /wines/168/canapi-grillo-2013 1 - /inicio/ 1 - /co@rootco@root/login.php 1 - /co789.123co789.123/admin.asp 1 - /wines/185/fazi-battaglia-verdicchio-2011 2 - /comment-editor.php 1 - /media-new.php 2 - /class-wp-real.php 1 - /blog.php 1 - /htcohtco/index.php 1 - /Mydb.php 1 - /888.php 1 - /wp-includes/blocks/freeform/index.php 1 - /menu.php 3 - /sh.php 2 - /%23U00ae.php 1 - /jindex.php 4 - /apple-touch-icon.png 108 - /wp-includes/Requests/Exception/Transport/index.php 1 - //wp-admin/images/module.php 1 - /co369co369/admin.php 1 - /nowp.php 2 - /gl@cogl@co/admin.php 1 - /7index.php 1 - /PHPMailer-core.php 1 - //css/install.php 5 - /1p.php 1 - /training/ 1 - /libraries/legacy/updates.php 1 - /revision.php 2 - /kentleague/greenwich/16thdec04.html 1 - //wp-admin/admin-ajax.php 5 - /VCD/deal101105.html 3 - /public_html/install_php1.php 1 - /wp-json/acf/v3/options/a 1 - /dededede/index.php 1 - /premier/dover/11thfeb05.html 4 - /adm.php 1 - /4pric.php 1 - /rootroot/login.php 1 - /Registry-stream.php 1 - /assets/plugins/plupload/examples/upload.php 1 - /wso2.8.php 1 - /sladegreen/thamesmead300805.html 4 - /Bulle.php 1 - /hernebay/greenwich140804.html 3 - /othernews/27thjune03.html 3 http://www.kentishfootball.co.uk/othernews/27thjune03.html /locations/texas/poolwerx-flower-mound/ 1 - /co@guanlico@guanli/index.php 1 - /user.php 1 - /wp-content/plugins/css-ready-sel/file.php 1 - /ehihsvgn.php 1 - /kentleague/sladegreen/19thsept05.html 3 - /libraries/phpmailer/ 1 - /wp-includes/js/mediaelement/ 1 - /wDR.php 1 - /wp-content/uploads/rmp-menu/ 1 - /sittingbourne/24thmar05.html 6 - /about-us/our-brands-bug-lady/ 1 - /Negat403.php 1 - /ms-files-private.php 1 - /it/ 1 - /.images.php 1 - /houtaicohoutaico/login.asp 1 - /task.php 1 - /wines/243/ramon-bilbao-gran-reserva-2006 2 - /3index.php 1 - /wp-2022.php 2 - /../../kentleague/maidstone/24thfeb04.html 1 - /wp-includes/images/crystal/index.php 1 - /bro.php 1 - /class-detect-spam.php 1 - /ryman/bromley/cray090405.html 4 - /et/ 1 - /.well-known/pki-validation/upload.php 1 - /ajax-requests.new.php 1 - /beckenham/3rdjune05.html 3 - /minik.php 2 - /e-preview.php 1 - /kentleague/hythe/folkestone300705.html 3 - /.well-known/acme-challenge/install.php 5 http://www.kentishfootball.co.uk//.well-known/acme-challenge/install.php /update.php 1 - /wp-content/themes/pridmag/db.php 1 - /ryman/bromley/4thjuly04.html 4 - /Hhhknt-an9awlbkhhh.php 1 - /class-wp-session-json.php 1 - /wines/79/domaine-de-pellehaut-harmonie-de-gascogne-ros-2013 1 - /cgi.php 1 - /dede888dede888/login.asp 1 - /accountaccount/admin.php 1 - /pinuseren.php 2 - /libraries/joomla/css.php 1 - /wp-content/upgrade-functions.php 2 - /system_log.php 2 - /co_glco_gl/admin.asp 1 - /wp-1.php 1 - /C.php 1 - /uploader.php 6 - /cray/crayvhern121103.html 3 - /dartford/erith231004.html 3 - /wines/194/chapel-down-bacchus-2013 1 - /images/common/ 1 - /assets/uploads/teams/cray_wanderers.jpg 1 - /fresh1.php 1 - /options-general.php 2 - /folkestone/tonbridge060805.html 3 http://kentishfootball.co.uk/news/551a99e5203dd /ryman-league/10 1 - /wines/197/chapel-down-brut-ros-nv 2 - /onclickfuns.php 2 - /phpzipincs.php 2 - /edit-posts.php 1 - /co@htco@ht/admin.asp 1 - /ryman/bromley/bromvdartksc071003.html 5 - /ajax-actions.php 3 - /shell4.php 1 - /wp-includes/Requests/library/ 1 - /link.php 2 - /swatch_bigmath.php 1 - /test 2 - /leaf.php 1 - /theme/assets/global/plugins/plupload/examples/upload.php 1 - /maidstone/maidvslade251003.html 5 - /sladegreen/beckvslad070204.html 6 - /signup/ 1 - /alfanew2.php7 3 - /ms-media.php 1 - /cray/crayvhythekstfinal170404.html 4 - /foxwsov2.php 1 - /wp-content/repeater.php 3 - /CHANGELOG.txt 2 - /class_api_1.php 1 - /circular.php 1 - /wines/204/campbells-rutherglen-topaque-half-bottle 1 - /co_888co_888/login.asp 1 - /dede/admindede/admin/index.asp 1 - /hythe/sevenoaks140804.html 4 - /whitstable/whitstablevdeal250803.html 5 - /wp-content/plugins/cache-wordpress/ 2 - /adminadmin/login.asp 1 - /link-manager.php 2 - /wp-admin/bala.php 2 - /1877.php 1 - /wp-config.php.bak 3 - /assets/uploads/content/John_Fowler_Whyteleafe_with_SCEF.jpg 1 - /m.php 4 - /email.php 1 - /wines/86/brouilly-2013-vieilles-vignes-domaine-dubost 1 - /newsleter.php 1 - /wines/154/borsao-garnacha-2013 1 - /ashford/19thmar04.html 3 http://kentishfootball.co.uk/news/551a99e5203dd /ubh/ 2 - /.well-known/pki-validation/inputs.php 1 - /class.php 1 - /LizKer.php 1 - /geek.php 1 - /wp-includes/SimplePie/XML/Declaration/index.php 1 - /wp-links-opml.php 2 - /GeoIP.dat.php 1 - /wines/152/campo-azafran-airen-sauvignon-blanc-2013 1 - /class-wp-rest-member.php 1 - /registration-alpha.php 1 - /co_888co_888/index.asp 1 - /wp-includes/wso112233.php 2 - /ads.txt 38 - /gl_cogl_co/admin.php 1 - /sittingbourne/chatham080205.html 6 - /wines/135/the-pavillion-chenin-blanc-viognier-2013 1 - /wobblogin/ 1 - /sevenoaks/whitstable190205.html 4 - /skippershell.php 1 - /waddmore4.php 1 - /an.php 1 - /73.php 1 - /wp-admin/maint/moon.php 5 http://www.kentishfootball.co.uk//wp-admin/maint/moon.php /wp-content/plugins/ubh/up.php 1 - /coadmincoadmin/index.asp 1 - /beckenham/tunwells120205.html 3 - /dede_admindede_admin/login.php 1 - /wordpress/ 12 - /sevenoaks/maidstone301004.html 5 - /guanli@coguanli@co/index.php 1 - /wines/271/longbend-pinot-noir-2010 2 - /wp-includes/Requests/Response/license.php 2 - /wp-includes/style-engine/ 1 - /wp-admin/user/cloud.php 3 - /2021 2 - /stfu.php 1 - /247@abu.php 1 - /dartford/22ndoct04.html 3 - /sys32.php 1 - /xt/index.php 2 - /co@dedeco@dede/index.asp 1 - /wp-content/36ros.php 2 - /wp-content/uploads/wp-content/uploads/ 1 - /2020/wp-includes/wlwmanifest.xml 14 - /co@houtaico@houtai/admin.php 1 - /sporting/sportvslade181003.html 4 - /othernews/FAVase2RPreview161105.html 4 - /wp-includes/blocks/post-excerpt/index.php 1 - /kentleague/ramsgate/tonbridge020106.html 3 http://kentishfootball.co.uk/news/551a99e5203dd /kentleague/deal/Sampson7.html 2 - /erithtown/vcd090405.html 5 - /wp-includes/blocks/site-title/index.php 1 - /cgi-bin/install.php 8 - /wp-includes/Requests/Response/ 1 - /wp-zett.php 2 - /fx.php 2 - /theme/assets/plugins/plupload/examples/upload.php 1 - /public_html/radio.php 1 - /wines/28/puligny-montrachet-2011-jean-louis-chavy 1 - /21889_errorlog.php 1 - /nowpf.php 2 - /hinfofuns.php 2 - /contents.php 1 - /cp.php 1 - /cong.php 4 - /adminfuns.php7 3 - /lordswood/dealvlord230304.html 4 - /xxl.php 5 - /bnet.php 1 - /wp-content/plugins/shell20211028.php 2 - /ramsgate/erith070205.html 4 - /new/ 1 - /options-head.php 2 - /cray/4thmar04.html 3 - /wp-blog.php 4 - /index.asp 1 - /xl.php 2 - /wines/208/geoff-merrill-reserve-chardonnay-2011 1 - /conference/gravesend/7thmar05.html 5 http://www.kentishfootball.co.uk/conference/gravesend/7thmar05.html /wp-includes/blocks/legacy-widget/index.php 1 - /tools.php 1 - /wp-pano 1 - /wines/87/maison-de-vigneron-pays-du-vaucluse-rouge-2013 1 - /sladegreen/vcd110904.html 3 http://kentishfootball.co.uk/news/551bc5e826825 /sevenoaks/11thfeb05.html 4 - /.well-known/pki-validation/Simple.php 1 - /ja/ 1 - /upgrade-functions.php 1 - /co11co11/index.php 1 - /beckenham/maidstone031205.html 3 - /htht/index.php 1 - /new 6 - /wp-content/uploads/2020/09/ 1 - /wines/187/domenico-de-bertiol-prosecco 1 - /92e4f6b2.php 2 - /co@houtaico@houtai/login.php 1 - /public_html/upfile_(2).php 1 - /wp-content/uploads/2023/01/ 1 - /snpc.g.php 1 - /suck.php 1 - /wp-includes/Requests/Cookie/index.php 1 - /tuco.php 1 - /so.php 1 - /footer.php 1 - /a.php 4 - /old-site 2 - /utchiha.php 1 - /wp-admin/css/vsfbd/ 1 - /bc 6 - /VCD/28thjan04.html 4 - /head.php 2 - /wp-content/uploads/membres/ 1 - /site/ 1 - /wp-content/uploads/2017/ 1 - /class-wp-post-info.php 1 - /co@rootco@root/index.php 1 - /.well-known/pki-validation/fun.php 1 - /24.php 1 - /wines/110/signos-de-origen-syrah-2010 1 - /class-wp-highlight.php 1 - /co147258369co147258369/index.php 1 - /options-reading.php 2 - /xleet-shell.php 2 - /wines/30/la-chablisienne-petit-chablis-2013 1 - /wp-includes/php-compat/ 1 - /Old 2 - //wp-includes/blocks/table/int/tmpl/index.php 1 - /huiyuanhuiyuan/admin.asp 1 - /assets/uploads/teams/bearsted.jpeg 1 - /wines/207/geoff-merrill-reserve-shiraz-2006 1 - /wines/51/sancerre-michel-girard-2013 1 - /az.php 1 - /wp-content/languages/wp-conflg.php.suspected 2 - /yu.php 1 - /co_dedeco_dede/index.php 1 - /wp-includes/blocks/nextpage/index.php 1 - /Dy48Y.php 1 - /ramsgate/ramsvlords270903.html 5 - /wp-content/plugins/wp-db-ajax-made/ 1 - /wp-admin/includes/themes.php 2 - /autoload_classmap.php 3 - /hvyxa4.php 1 - /gwzdihysne.php 1 - /wp-content/plugins/cekidot/ 2 - /wacking.php 1 - /wp-content/themes/twenty/twenty.php 7 http://www.kentishfootball.co.uk//wp-content/themes/twenty/twenty.php /database.php 1 - /class-IXR-data.php 1 - /wp-load.php 2 - /hehe.php 1 - /211003.php 1 - /class-wp-customize-filter-xml.php 1 - /public_html/about.php 1 - /co789.123co789.123/login.asp 1 - /2.php 2 - /info.php 4 - /co_888co_888/index.php 1 - /co123456co123456/login.asp 1 - /upload.php 3 - /wp-content/plugins/html404/cry.php.pjpeg 1 - /upgrade.php 2 - /wp-includes/blocks/list/index.php 1 - /pluginslog.php 1 - /public_html/wp-hudbud.php 1 - /w4k.php 1 - /library.php 1 - /templates/beez3/index.php 1 - /comdofuns.php 2 - /administrator/templates/isis/ 1 - /wso.php 3 - /conference/gravesend/17thjan05.html 3 http://kentishfootball.co.uk/news/551a99e5203dd /debug.php 1 - /wp-includes/Text/index.php 1 - /subirfoto.php 1 - /co666co666/index.php 1 - /sladegreen/hythe220105.html 6 - /test/wp-includes/wlwmanifest.xml 18 - /adminfuns.php 2 - /co999co999/index.php 1 - /en/ 2 - /cohoutaicohoutai/index.php 1 - /customize.php 2 - /wp-includes/fonts/css.php 2 - /local/.env 1 - /wp-content/uploads/2023/04/ 1 - /wp-includes/images/ 2 - /tuny.php 2 - /wp-admin/css/colors/ 2 - /wp-22.php 2 - /wp-milcav.php 1 - /co123co123/admin.php 1 - /wp-content/themes/alera/alera/ 1 - /maidstone/maidvlord271203.html 4 - /filefuns.php 2 - /wp-admin/css/colors/coffee/cloud.php 3 - /co_888co_888/login.php 1 - /Uploader.php 1 - /wines/140/raimat-abadia-blanc-de-blanc-2012 1 - /wp-includes/blocks/calendar/updates.php 2 - /notice.php 1 - /maidstone/tunbridgewells301105.html 3 - /livelo-accrualsPoints.php 1 - /wp-content/uploads/wso112233.php 2 - /greenwich/3rdsept04.html 3 - /wp-content/uploads/slideshow-gallery/ 1 - /alfa-rex2.php7 3 - /ryman/bromley/erithtown160705.html 4 - /mr.php 1 - /wp-includes/SimplePie/Cache/ 1 - /wines/49/sebastien-treuillet-pouilly-fume-2013 1 - /wp-sys.php 1 - /auttqmkhez.php 1 - /mailto:Stephen@kentishfootball.co.uk 1 - /cray/crayvrams081103.html 3 http://kentishfootball.co.uk/news/551a99e5155f5 /privacy.php 2 - /../../kentleague/sladegreen/14thjan04.html 1 - /wp-content/think.php 1 - /ramsgate/bengal140804.html 3 - /css/ 2 - /wp-content/about.php 3 - /class-wp-customizes-settings.php 1 - /thamesmead/15thaug05.html 3 http://kentishfootball.co.uk/news/551bc5e826825 /Cache-stream.php 1 - /allez.php 1 - /public_html/cloud2.php 1 - /wp-includes/js/tinymce/skins/lightgray/img/index.php 3 - /PHPSmtp.php 1 - /my-sites.php 2 - /thoms.php 2 - /wp-content/plugins/fix/ 1 - /zb_system/login.php 1 - /Init.php 1 - /mambo/index.php-option=com_content&task=view&id=1050&Itemid=40 1 - /wines/29/saint-aubin-1er-cru-vieilles-vignes-2011 1 - /co147258369co147258369/index.asp 1 - /wp-thesex.php 1 - /wp-l0gin.php 2 - /wp-content/uploads/2014/03/ 1 - /equipo/ 1 - /Test 2 - /lordswood/lordsvrams310304.html 5 - /sittingbourne/dartvsitt160304.html 5 - /4index.php 1 - /options-media.php 2 - /sladegreen/sevenoaks031205.html 4 - /App_Master/Telerik.Web.UI.DialogHandler.aspx 2 - /app/.env 2 - /images/profiles/ 1 - /co258co258/index.asp 1 - /wp-login.php 431 - //wp-admin/js/about.php 5 - /templates/atomic/ 1 - /admin-ajax.php 2 - /kentleague/sladegreen/14thjan04.html 3 - /maidstone/18thmay05.html 3 http://kentishfootball.co.uk/news/551a99e5155f5 /wp-content/themes/welfare-charity/www.php 2 - /xPDO.idx.php 1 - /ALFA_DATA/alfacgiapi/ 2 - /wines/37/chateau-fuisse-pouilly-fuisse-tete-de-cru-2011 1 - /development/.env 1 - /4.php 1 - /includes/cls_sms.php 1 http://kentishfootball.co.uk/includes/cls_sms.php /align-leftermrnt.php 1 - /htcohtco/index.asp 1 - /drmartens.html 5 - /5yde.php 1 - /maro.php 1 - /flame.php 1 - /chatham/chatvdart120404.html 3 - /options-backup.php 1 - /co666co666/admin.php 1 - /Mshell.php 1 - /options-permalink.php 2 - /contacts 1 - /co999co999/admin.php 1 - /bhx1.php 1 - /website-checker/ 1 - /zaco.php 1 - /XSam-XAdoo.php 1 - /bak.php 3 - /sladegreen/hernebay091004.html 5 - /badicudcpz.php 1 - /wp-content/xl2023.php 2 - /kentleague/ramsgate/bromley230705.html 4 - /Intitle.php 1 - /alfa-rex.php7 4 - /dededede/index.asp 1 - /theme-insqbzk.php 2 - /wp-includes/SimplePie/Parse/index.php 1 - /users.php 2 - /wp-aespa.php 1 - /rootroot/login.asp 1 - /worm0.PhP7 1 - /blog/2020/09/30/piam-expresses-profound-disappointment-at-myccs-decision/wp-content/ 1 - /firkon.php 1 - /class-admin.php 1 - /anon.php 1 - /ramsgate/20thdec04.html 5 - /fosil.php 1 - /wp-includes/js/tinymce/plugins/compat3x/css/index.php 11 http://www.kentishfootball.co.uk//wp-includes/js/tinymce/plugins/compat3x/css/index.php /beckenham/thamesmead171205.html 3 - /kuda.php 1 - /include.php 2 - /payout.php 1 - /indexx.php 1 - /folkestone/folkvash261203.html 3 - /wp-content/plugins/backup-backup/readme.txt 4 - /wines/160/araldica-barolo-2010 2 - /images/about.php 1 - /sitesetup.php 1 - /security-b.php 1 - /wines/259/poderi-colla-campo-romano-2011 2 - /co123co123/index.php 1 - /pdf/ 1 - /.well-known/pki-validation/class_api_1.php 1 - /wp-content/upgrade/ 4 - /sladegreen/thamesmead161004.html 5 - /.well-known/pki-validation/moon.php 1 - /wines/246/montresor-bardolino-2013 1 - /betdiyffse.php.suspected 1 - /wp-content/themes/twentytwentytwo/parts/about.php7 1 - /wp-content/plugins/column/miin.php 2 - /houtaicohoutaico/login.php 1 - /1975.php 1 - /wines/210/the-googly-chardonnay-2013 2 - /hmb215.php 1 - /wp-content/plugins/CropImage/ 1 - /wp-content/uploads/F0x.php 1 - /wp-content/plugins/core/ 1 - /cssmaro.php 1 - /sladegreen/bowey301sevenoaks250105.html 7 - /plugin-editor.php 2 - /wp-admin/wso112233.php 2 - /validation_result.php 1 - /0z.php 1 - /wp-admin/css/colors/blue/cloud.php 3 - /modules/mod_simplefileuploadv1.3/elements/udd.php 1 - /login.action 1 - /co1co1/index.asp 1 - /co_managerco_manager/admin.php 1 - /atomlib.php 2 - /products/boxbolt-type-c-icc-approved/ 1 - /wp/ 2 - /wines/102/signos-de-origen-carmenere-2010 1 - /2018 2 - /ht_coht_co/login.php 1 - /bitrix/admin/ 1 - /rootroot/admin.php 1 - /api/goods.php 3 - /2index.php 1 - /park/ 1 - /wines/245/patrizi-barolo-2010 1 - /wp-content/plugins/woo-maxicashgateway_woo2-82/ 1 - /ms-themes.php 2 - /wines/177/fertuna-dropello-2012 2 - /sladegreen/thamesmead050205.html 5 - /ramsgate/ramsgatevdeal071003.html 5 - //wp-admin/xleet.php 1 - /wp-content/plugins/three-column-screen-layout/db.php 1 - /credits.php 1 - /lordswood/tunwells191105.html 3 - /yyyy.php 1 - /beckenham/greenwich071204.html 3 - /js/ 1 - /0.php 1 - /houtai_cohoutai_co/index.php 1 - /wines/96/emiliana-cabernet-sauvignon-2013 1 - /wines/130/the-bernard-series-mmm-barrel-selection-2012 1 - /ndzljfas.php 1 - /co258co258/admin.asp 1 - /cohoutaicohoutai/index.asp 1 - /wp-includes/blocks/post-title/index.php 1 - /p-22.php 1 - /b374k.php 1 - //wp-admin/includes/about.php 1 - /wp-includes/Requests/Text/index.php 2 - /wp-includes/SimplePie/Content/Type/ 1 - /wp-content/plugins/html404/ 1 - /greenwich/greenvslade281003.html 4 - /pages/ambassadors/ 1 - /wp-includes/shell20211028.php 3 - /apple-touch-icon-120x120-precomposed.png 206 - /sevenoaks/ramsgate050205.html 3 http://kentishfootball.co.uk/news/551a99e5155f5 /npx.php 1 - /wp-admin/xmrlpc.php 3 - /co@adminco@admin/login.asp 1 - /wp-includes/blocks/ 2 - /edit.php 2 - /guanlicoguanlico/index.asp 1 - /wp-includes/images/wlw/index.php 1 - /class-wp-upgrade.php 1 - /yo.php 1 - /wp-includes/css/dist/list-reusable-blocks/index.php 1 - /htht/admin.php 1 - /managermanager/login.php 1 - /resume.php 1 - /kentleague/cray/folkestone061104.html 3 - /wines/123/percheron-old-vine-cinsault-2013 1 - /en/corisit/ 1 - /wp-includes/js/tinymce/ 1 - /epinyins.php 2 - /wp-config-sample123.php 1 - /register/ 1 - /wp-includes/css/dist/widgets/ 1 - //modules/mod_simplefileuploadv1.3/elements/udd.php 1 - /ch.php 1 - /wp-content/plugins/ccx/ 1 - //wp-content/install.php 5 - /wp-scr1pts.php 2 - /wp-content/upgrade/iR7SzrsOUEP.php 2 - /xx.php 1 - /wines/139/raimat-abadia-cabernet-sauvignon-tempranillo-2010 1 - /sam.php 1 - //wp-admin/css/colors/blue/CasperExV1.php 1 - /media-upload.php 2 - /cut.php 2 - /wp-admin/user/iR7SzrsOUEP.php 2 - /307.txt.php 1 - /wp-content/plugins/bala.php 2 - //wp-admin/includes/users.php 1 - /beckenham/sevenoaks260305.html 3 - /wp-content/plugins/Cache/ 1 - /wines/75/duc-de-morny-2013 1 - /wp-content/plugins/zedd/ 1 - /hexor.php 1 - /.well-known/pki-validation/shell.php 2 - /v2/_catalog 1 - /bundle.php 1 - /about.php 7 - /../../kentleague/ramsgate/15thjuly05.html 1 - /admin/tmp/ 2 - /othernews/30thsept03.html 1 - /teslaxx.php 1 - /sclass_api.php 1 - /erithtown/4thjune05.html 3 - /wp-content/plugins/seoplugins/ 1 - /fnio3g.php 1 - /bypass403.php 1 - /wines/196/chapel-down-brut-vintage-reserve 1 - /co123.789co123.789/admin.asp 1 - /default.php 1 - /wines/64/antech-cremant-de-limoux-emotion-ros-2012 1 - /.well-known/pkivalidation/wso112233.php 2 - /templates/beez_20/ 1 - /wp-content/plugins/TOPXOH/ 1 - /wp-logout.php 1 - /cms/ 1 - /othernews/fatrophy4thround.html 5 - /lordswood/sevenoaks071204.html 3 - /mc.php 1 - /css/sgd.php 2 - /dartford/dartvfolk240204.html 4 - /co123.789co123.789/index.asp 1 - /block-patterns-cron.php 1 - /public_html/bak.php 1 - /pomo.php 1 - /.well-known/security.txt 6 http://www.kentishfootball.co.uk/.well-known/security.txt /wp-includes/css/dist/edit-widgets/ 1 - /wp-includes/SimplePie/Decode/HTML/index.php 1 - /co_houtaico_houtai/login.asp 1 - /mod_ariimageslidersa.php 1 - /../../kentleague/sladegreen/23rdoct05.html 1 - /assets/script/plupload/examples/upload.php 1 - //wp-content/themes/twentytwenty/404.php 1 - /class-wp-widget-media-video-meta.php 1 - /managermanager/index.php 1 - /cohoutaicohoutai/admin.php 1 - /co_managerco_manager/login.php 1 - /wp-content/plugins/revslider/includes/external/page/index.php 3 - /neu/ 1 - /nd7.php 1 - /wines/283/sacred-organic-vodka-70cl 1 - /block-template-utils-ajax-response.php 1 - /zany.php 2 - /sittingbourne/ashford091104.html 4 - /enfile.php 2 - /public_html/xmrlpc.php 1 - /wp-blog-header.php 2 - /wp-includes/ID3 2 - /beckenham/hernebay231004.html 5 - /moderation.php 2 - /wp-includes/Requests/Transport/index.php 1 - /houtaihoutai/admin.php 1 - /disclaimer-and-login/ 1 - /go2/ 1 - /wp/wp-admin/includes/ 1 - /symlink.php 1 - /Simple.php 2 - /images/avatar/ 1 - /wp-includes/blocks/html/index.php 1 - /wp-23.php 1 - /w3llstore.php 2 - /wp-admin/includes/ 1 - /class-wp-page-href.php 1 - /exits.php 1 - /wines/22/la-pierrelee-chablis-2012 2 - /ht@coht@co/login.php 1 - /smm.php 2 - /wines/221/calusari-pinot-noir-2013 2 - /form-sear.php 1 - /accountaccount/admin.asp 1 - /co369co369/login.asp 1 - /othernews/favsittingbourne210705.html 1 - /mambo/images/stories/slatter%20and%20mccarthy%20in%20royal%20box.jpg 1 - /wp-content/updates.php 4 - /novo/ 1 - /lux.php 1 - /co@dedeco@dede/login.asp 1 - /wp-content/uploads/ 9 http://www.kentishfootball.co.uk//wp-content/uploads/ /gl@cogl@co/login.asp 1 - /web/ 1 - /wines/186/raboso-ros-borgo-del-col-alto-nv 1 - /templates/rhuk_milkyway/ 1 - /gettest.php 2 - /install.php 8 http://www.kentishfootball.co.uk//install.php /wsoyanz.php 3 - /capabilities-ajax.php 1 - /versions.php 2 - /wp-includes/SimplePie/ 2 - /ALFA_DATA/ 2 - /wp-content/plugins/easybusy/ 1 - /sladegreen/13thoct04.html 5 - /wp-includes/blocks/code/index.php 1 - /wp-admin/shapes.php 1 - /wp-content/plugins/mw-wp-form/css/admin-common.css 3 - /mt/ 2 - /chatham/dartford200905.html 3 - /beckenham/2ndjune05.html 3 - /foxwso.php 1 - /wp-content/languages/wp-conflg.php 2 - /wp-includes/blocks/site-tagline/index.php 1 - /wp-content/themes/wp-pridmag/ 2 - /wp-content/themes/mero-megazines/ws.php 2 - /sladegreen/dealvslade030404.html 6 - /../othernews/conffixtures0506.html 1 - /maidstone/23rdsept05.html 3 - /include/ 2 - /wp-crons.php 1 - /wp-includes/blocks/quote/index.php 1 - /wp-dmin/ 1 - /wines/137/de-wetshof-estate-bon-vallon-chardonnay-sur-lie-2013 1 - /dede1dede1/login.asp 1 - /wp-admin/maint/iR7SzrsOUEP.php 2 - /../../kentleague/hernebay/ashford230705.html 1 - /nfig.php 1 - /premier/welling/chatham071205.html 4 - /beckenham/whitstable301004.html 3 - /sladegreen/hernebay090405.html 5 - /csv.php 1 - /www.php 1 - /lordswood/15thaug04.html 3 - /css/cloud.php 3 - /co_houtaico_houtai/admin.asp 1 - /wp-includes/js/jcrop/index.php 1 - /premier/dover/19thoct05.html 4 - /ramsgate/ramsgatevhythe120803.html 6 - /wines/3/mont-rocher-viognier-2013 1 - /admin888admin888/login.asp 1 - /pomp.php 1 - /ak47shell.php 1 - //wp-content/plugins/install.php 5 - /tunbridgewells/tunvlordswood130803.html 6 - /wp-includes/js/jquery/index.php 1 - /wp-content/plugins/seo-title-tag/ 1 - /about 1 - /wordpress/wp-content/uploads/ 2 - /co9999co9999/admin.php 1 - /i.php 1 - /u.php 2 - /guanlicoguanlico/admin.asp 1 - /wp-admin/home.php 2 - /co_htco_ht/login.php 1 - /cray/crayvgree061203.html 4 - /wp-admin/js/widgets/xmrlpc.php 3 - /wines/262/fertuna-pactio-2011 1 - /.well-knownold/bala.php 2 - /adminer-4.0.0.php 1 - /russian.php 1 - /iaqxt7.php 1 - /../ryman/bromley/beck220703.html 2 - /kentleague/sladegreen/ashford270805.html 2 - /e.php 2 - /co147co147/admin.asp 1 - /folkestone/fisher291005.html 3 - /Xsam_Xadoo_00Bot.php 2 - /gbfparts/ 1 - /co@glco@gl/login.php 1 - /wp-admin/images/im/ 1 - /ryman/bromley/1stmay05.html 4 - /images/common/class_api.php 2 - /apagado_est.php 1 - /Session-stream.php 1 - /thamesmead/ramsgate190205.html 3 http://kentishfootball.co.uk/news/551a99e5155f5 /wp-content/themes/cameleonthemeforest/includes/fileuploader/upload_handler.php 1 - /bl.php 1 - /sladegreen/sladevrams200304.html 3 http://kentishfootball.co.uk/news/551a99e5155f5 /site-gate/ 1 - /wp_backup.php 1 - /public_html/termps.php 1 - /inje3ctor.php 1 - /mas.php 1 - /wp-includes/sitemaps/ 2 - /sladegreen/thamesmead120205.html 5 - /wines/109/nostros-reserva-pinot-noir-2013 1 - /test/wp-admin/network/ 1 - /hanna1337.php 1 - /wp-includes/blocks/group/index.php 1 - /wp-includes/Text/Diff/index.php 1 - /plupload/examples/upload.php 1 - //wp-content/plugins/royal-elementor-addons/readme.txt 2 www.google.com /wines/180/brunello-di-montalcino-2009-castello-romitorio 1 - /cangma.php 2 - /wp-admin/css/colors/light/admin.php 2 - /templates/beez5/ 1 - /leg.php 1 - /assets/lpmi/ 1 - /admin_coadmin_co/index.asp 1 - /edit-tag-menu.php 1 - /wp-content/uploads/2013/06/ 1 - /guanliguanli/index.asp 1 - /wines/285/anno-gin-70cl 2 - /kentleague/ramsgate/15thjuly05.html 3 - /wp-includes/customize/ 2 - //old/wp-admin/setup-config.php 2 www.google.com /ryman/bromley/beck220703.html 4 - /use.php 2 - /wiki-index.php 1 - /wines/218/geoff-merrill-reserve-cabernet-sauvignon-2007 1 - /staging/.env 1 - /wp-class.php 3 - /../../conference/gravesend/17thjan05.html 1 - /useruser/admin.php 1 - /module.php 1 - /JP104/ 1 - /options-writing.php 2 - /cyber.jpg.php 1 - /laagste-rente/ 1 - /landing-page/ 1 - /admin/_Style/AspCms_TemplateAdd.asp 3 http://www.kentishfootball.co.uk/admin/_Style/AspCms_TemplateAdd.asp /koheju.php 1 - /hax.php 1 - /lordswood/erithtown130805.html 5 - /wp-content/plugins/index.php 3 - /coco/login.asp 1 - /wp-includes/js/imgareaselect/index.php 1 - /index6.php 1 - /coglcogl/admin.php 1 - /greenwich/Greevlord130104.html 4 - /wines/288/beni-di-batasiolo-grappa-di-moscato-70cl 1 - /co147258369co147258369/admin.asp 1 - /gl_cogl_co/login.asp 1 - /ru.php 1 - //wp-content/shell20211028.php 1 - /wp-includes/Requests/Text/ 1 - /es/wp-content/themes/wp-pridmag/ 1 - /wines/205/geoff-merrill-shiraz-grenache-mourvedre-2010 1 - /co888co888/index.php 1 - /019876wysh.php 1 - /cms/wp-includes/wlwmanifest.xml 19 - /ai.txt 5 - /wines/16/chateau-meyney-2008-saint-estephe 1 - /Mhbgf.php 1 - /woh.php 2 - /sito/wp-includes/wlwmanifest.xml 6 - /erith&belvedere/26thoct04.html 3 - /four-pillars-estates-blue-springs/ 1 - /othernews/Tables281004.html 1 - /saudi.php 1 - /core/.env 2 - /wp-content/uploads/2021/09/ 1 - /php-backdoor.php 1 - /delpaths.php 2 - /jjodabvg.php 3 www.google.com /098.php 1 - /wines/2/chateau-pineraie-cahors-2010 1 - /6.php 1 - /sittingbourne/sittvchat281003.html 6 - /ty.php 1 - /cohtcoht/admin.php 1 - /class-pclzip-meta.php 1 - /404.php 3 - /guanliguanli/login.asp 1 - /managemanage/admin.php 1 - /kentleague/ramsgate/25thjan04.html 3 - /wp-content/plugins/xichang/x.php 1 - /wp-content/themes/shell20211028.php 2 - /wines/150/algareiro-albarino-2013 1 - /wp-content/plugins/html404/xccc.php 1 - /lufi.php 2 - /adminadmin/admin.php 1 - /headerw.php 1 - /simple-upload.php 1 - /wp-content/plugins/dapeasyinstaller/ 1 - /co_glco_gl/login.php 1 - /dede12dede12/admin.asp 1 - /403.php 2 - /sporting/sportvlord131203.html 4 - /images/headers/ 1 - /wp-admin/css/ 4 binance.com /admin_coadmin_co/admin.asp 1 - /wp-includes/Requests/Exception/ 1 - /wp-admin/images/install.php 7 http://www.kentishfootball.co.uk//wp-admin/images/install.php /random_bytes_cyclone.php 1 - /user-login/ 1 - /co1co1/login.php 1 - /wp-admin/xl2023.php 2 - /wp-admin/css/colors/blue/xmrlpc.php 3 - /default/ 1 - /co@htco@ht/login.php 1 - /e/sch/sch.html 2 http://www.kentishfootball.co.uk/e/sch/sch.html /wines/274/adobe-reserva-carmenere-2013 1 - /useruser/login.asp 1 - /glgl/index.asp 1 - /coadmincoadmin/admin.php 1 - /src.php 1 - /PHP_Shell.php 1 - /wp-admin/js/widgets/about.php7 3 - /coglcogl/login.asp 1 - /co1111co1111/index.asp 1 - /sittingbourne/dartford201104.html 6 - /co1111co1111/login.asp 1 - /wp-content/themes/signify/firkon.php 2 - /sittingbourne/6thjan05.html 5 - /erith&belvedere/dartford050205.html 4 - /en/wp-admin/ 1 - /wp-content/uploads/spip/tif/ 1 - /feed-atom-comments-core.php 1 - /wp-content/plugins/woocommerce-payments/readme.txt 2 - /term.php 2 - /corootcoroot/admin.php 1 - /wp-includes/blocks/post-terms/index.php 1 - /mambo/mambots/editors/tinymce/www.valsportuk.com/shop 4 - /labs/wp-admin/ 1 - /mmls.php 1 - /wp-includes/images/wlw/ 2 - /old 6 - /erithtown/erithvlords081103.html 4 - /administrator/templates/hathor/index.php 1 - /set.php 1 - /sys.php 1 - /edit-form.php 1 - /checkbex.php 2 - /as.php 1 - /wp-content/plugins/configler/ 1 - /cohtcoht/login.asp 1 - /glcoglco/index.php 1 - //www.google-analytics.com/analytics.js 5 - /othernews/30thjune03.html 1 - /admin/uploads/ 2 - /co@houtaico@houtai/index.php 1 - /oplsvgs.php 1 - /wines/63/joseph-perrier-la-cuvee-royale-ros-nv 1 - /shells.php 1 - /wp-fox.php 1 - /co8888co8888/index.php 1 - /wines/38/chablis-1er-cru-cote-de-lechet-2011 1 - /wp-content/themes/seotheme/mar.php 3 - //wp-admin/wso112233.php 1 - /admin@coadmin@co/login.php 1 - /ms-settings-private.php 1 - /wp-admin/admin-ajax.php 5 http://www.kentishfootball.co.uk//wp-admin/admin-ajax.php /Telerik.Web.UI.WebResource.axd 2 - /M1.php 2 - /assets/global/plugins/plupload/examples/upload.php 1 - /images/downloads/ 1 - /pys.php 1 - /co888co888/admin.php 1 - /hxol.php 1 - /sevenoaks/erith150105.html 4 - /wp-content/themes/alera/alpha.php 2 - /administratoradministrator/login.php 1 - /wp/wp-admin/ 1 - /login-page/ 1 - /ysetnahn.php 1 - /wines/111/signos-de-origen-chardonnay-marsanne-viognier-and-roussanne-2012 1 - /wines/281/terre-di-montelusa-primitivo-2013 1 - /dede321dede321/index.php 1 - /admin1admin1/login.php 1 - /admin-heade.php 2 - /admin1admin1/index.php 1 - /erithtown/10thsept04.html 3 - /power.php 2 - /exp.php 1 - /zacosmall.php 1 - /wp-content/plugins/cakil/ 2 - /conference/gravesend/26thjan05.html 3 - /co123.789co123.789/index.php 1 - /wp-hudbud.php 2 - /properties_system.php 1 - /727459_9b46b1wso2.5-1.php 1 - /hernebay/tunwells220105.html 3 - /sladegreen/deal020405.html 5 - /fobbtqrl.php 1 - /ryman/bromley/25thsept03.html 4 - /othernews/SL%20Review%20140805.html 4 - /adminadmin/index.php 1 - /form.php 1 - /images/gallery/ 1 - /cawpf.php 2 - /wp-file.php 1 - /co8888co8888/login.php 1 - /dede123dede123/index.asp 1 - /mycommand.php 2 - /sladegreen/vcd190205.html 3 http://kentishfootball.co.uk/news/551bc5e826825 /kk.php 1 - /sporting/sportvtun081103.html 3 http://kentishfootball.co.uk/news/551bc5e7046df /sittingbourne/erithandbelvedere080105.html 6 - /adminer-4.2.0.php 1 - /repeater.php 5 - /wp-admin/meta/ 2 - /feedback.php 1 - /filter.php 2 - /Telerik.Web.UI.DialogHandler.aspx 2 - /db.php 2 - /templates/beez_20/error.php 1 - /public/assets/global/plugins/plupload/examples/upload.php 1 - /wp-includes/SimplePie/wp-login.php 2 - /kentleague/maidstone/23thjan04.html 4 - /guanli@coguanli@co/login.asp 1 - /hces/ 1 - /adminer-4.4.0.php 1 - /mad.php 1 - /wp-content/plugins/include.php 1 - /wp-content/themes/ccx/ 1 - /core/code.php 1 - /1690632242.php 1 - /random_bytes_dev.php 1 - /wp-admin/user/xmrlpc.php 3 - /v.php 1 - /membermember/admin.asp 1 - /dup-installer/main.installer.php 1 - /6index.php 1 - //wp-admin/shell20211028.php 1 - /.well-known/pki-validation/ssl.php 2 - /sittingbourne/sittvtonb221103.html 6 - /wines/278/mas-fleurey-cotes-de-provence-ros-2013 1 - /small.php 4 - /../../ryman/bromley/ashford151005.html 1 - /alfav4.1-tesla.php 1 - /min-1.php 1 - /searchengine.php 1 - /HsdcZTs.php 1 - /folkestone/folkvfishlgecup111103.html 3 - /VCD/vcdvwhitstable120803.html 4 - /gecko-new.php 1 - /wp-includes/blocks/social-links/index.php 1 - /snd21.php 1 - /wines/219/geoff-merrill-henley-shiraz-2004 1 - /tunbridgewells/tunverith111003.html 4 - /wp-content/plugins/Uwogh-Segs/ 2 - /wp-includes/blocks/query/index.php 1 - /wp-includes/blocks/paragraph/index.php 1 - /.well-known/pki-validation/wp-blog.php 1 - /revo.php 1 - /wp-type.php 1 - /d/txt/test.txt 1 http://www.kentishfootball.co.uk/d/txt/test.txt /b1a3k.php 1 - /wp-shield-icon-managed.php 1 - /wp-content/plugins/classic-editor/ 1 - /Navir.php 1 - /wp-includes/random_compat/ 1 - /admin@coadmin@co/index.asp 1 - /spawn.php 1 - /novosite/pt/ 1 - /glgl/admin.asp 1 - /wp2/wp-includes/wlwmanifest.xml 6 - /classwpplugins.php 1 - /administrator/templates/bluestork/ 1 - /lordswood/lordvbeng130304.html 4 - //cgi-bin/install.php 5 - /image-edit-ajax.php 1 - /LV.php 2 - /wp-includes/js/mediaelement/renderers/index.php 1 - /coadmincoadmin/index.php 1 - /wp-admin/network/ 2 - /searchy.php 1 - /63wtyeshj.php 1 - /wp-admin/maint/ 2 - /ashford/28thapr04.html 3 http://kentishfootball.co.uk/news/551a97992f193 /wp-includes/css/dist/format-library/index.php 1 - /wp-content/plugins/elementor/ 2 - /zeal.php 2 - /wp-includes/about.php 1 - /css.minifier.php 1 - /blog/wp-includes/ 2 - /cray/hbayvcray270304.html 4 - /edit-tags.php 2 - /R00T.php 1 - /wp-2019.php 3 - /sittingbourne/dartford020106.html 5 - /coming-soon/ 1 - /index1.php 2 - /hoerwerkstatt/ 1 - /config.php 1 - /wp-content/xleet.php 2 - /wp-includes/js/tinymce/skins/lightgray/img/ 1 - /co12co12/admin.php 1 - /et/teenused/ 1 - /confcom.php 1 - /assets/php/ 1 - /ramsgate/greenwich020405.html 4 - /WP 2 - /bitwise.php 1 - /DC.php 1 - /aoumbsppwm.php 1 - /wines/144/vina-pomal-reserva-rioja-2009 1 - /wines/127/boschendal-the-rose-garden-ros-2014 1 - /Vu2m3oitwaf.php 1 - /yuuki.php 1 - /sellex.php 2 - /good.php 2 - /chtmlfuns.php 2 - /beckenham/greenwich090205.html 3 - /co147258369co147258369/login.php 1 - /maidstone/21stjan05.html 4 - /dede123dede123/admin.asp 1 - /co1co1/admin.asp 1 - /cd.php 2 - /domains/ 1 - /wp-content/uploads/2015/03/ 1 - /ryman.html 5 - /wp-content/themes/famous/megaframe/megapanel/inc/functions.php 1 - /wp-includes/images/crystal/ 2 - /wines/118/crossroads-merlot-2012 1 - /wp-raze.php 1 - /othernews/15thaug03.html 1 - /wines/276/villa-wolf-riesling-dry-2013 2 - /data/captcha/captcha_bg1.gif 1 http://kentishfootball.co.uk/data/captcha/captcha_bg1.gif /wp-content/plugins/akismet/ 1 - /theme-model.php 1 - /premier/welling/dartford091104.html 4 - /xl2023.php 2 - /wp-includes/blocks/search/index.php 1 - /oemtgzud.php 1 - /ioxi.php7 2 - /folkestone/ashford240704.html 2 - /../ryman/bromley/21stnov05.html 1 - /ramsgate/10thfeb05.html 5 - /qinfofuns.php 2 - /plugins.php 3 - /wines/153/campo-azafran-tempranillo-syrah-2013 1 - /masss.php 2 - /mailer3.php 1 - /Site 2 - /ecf854c.php 2 - /admincoadminco/login.php 1 - /../../kentleague/sladegreen/ashford270805.html 1 - /el/wp-content/plugins/seoplugins/ 1 - /alfi.php 1 - /sladegreen/deal061104.html 5 - /assets/lib/plupload/examples/upload.php 1 - /wp-content/plugins/seoo/wsoyanz1.php 3 - /wines/279/amuata-absoluto-torrontes-2013 2 - /co147co147/index.asp 1 - /ix.php.PhP 1 - /11.php 1 - /vintagebringa-tervezo/configure/246/ 1 - /wp-includes/css/modules.php 1 - /sladegreen/whitstable210804A.html 3 http://kentishfootball.co.uk/news/551a9bb014974 /wp-admin/js/about.php7 5 http://www.kentishfootball.co.uk//wp-admin/js/about.php7 /co12co12/login.asp 1 - /wp-includes/IXR/index.php 1 - /wp-content/plugins/ioptimization/IOptimize.php 2 - /cgi-bin/cgi-bin/about.php 5 http://www.kentishfootball.co.uk//cgi-bin/cgi-bin/about.php /wines/131/bellingham-ancient-earth-pinotage 1 - /adminer-4.2.5.php 2 - /identification/ 1 - /wines/91/puy-de-dome-pinot-noir-2012 1 - /sclass.api.php 1 - /wp-admin/network/index.php 1 - /cropper.php 1 - /am.php 1 - /sitemap.xml.gz 2 - /wp-admin/images/screenshots/ 1 - /folkestone/folkve&B120404.html 3 - /fw.php 3 - /wines/125/percheron-chenin-blanc-viognier-2013 1 - /old-index.php 1 - /modules/modules/modules.php 1 - /ms-edit.php 2 - /tersembunyi.php 1 - /.well-known/shell20211028.php 2 - /.well-known/class.api.php 3 - /wp-content/plugins/html404/wso25.php 1 - /madmailer.php 1 - /ramsgate/3rdfeb05.html 4 - /cache.php 1 - /co@dedeco@dede/admin.php 1 - /wp-content/plugins/cyberseo/ 1 - /MyShell.php 1 - /wp.php 2 - /premier/dover/12jan04.html 3 - /wines/57/domaine-langlois-chateau-2012-rouge 1 - /wp-includes/images/include.php 4 www.google.com /ht_coht_co/admin.asp 1 - /wp-admin/xleet-shell.php 2 - /wp-mce-help.php 1 - /coco/index.php 1 - /bpa.php 1 - /wp-content/plugins/css-ready/ 1 - /pki.php 1 - /co258co258/login.php 1 - /wp-includes/css/dist/block-directory/index.php 1 - /whitstable/30thnov05.html 3 - /hernebay/hernvlords111003.html 4 - /wp-includes/blocks/cover/index.php 1 - /tab_licitacoes-old.php 1 - /screenshot_1.php 2 - /wines/40/rasteau-cotes-du-rhone-villages-tradition-2012 1 - /en-nz/ 1 - /dede321dede321/admin.php 1 - /wp-content/plugins/sid/ 1 - /guanlicoguanlico/index.php 1 - /cray/klpdcupfinalpreview050504A.html 4 - /wines/116/the-crossings-pinot-gris-2013 2 - /VCD/19thaug04.html 4 - /kentleague/VCD/31stjan04.html 3 - /mah.php 2 - /co@rootco@root/admin.php 1 - /nik/ 1 - /js.php 1 - /sittingbourne/dartford240905.html 5 - /cjong.php.suspected 1 - /simple_backdoor.php 1 - /fpebr.php 1 - /wp-includes/certificates/index.php 1 - /kentleague/maidstone/5thnov04.html 4 - /store/ 1 - /simple.php 7 - /wines/35/domaine-faiveley-rully-les-villeranges-2011 1 - /wp-content/plugins/Tevolution/ 1 - /wp/bridge/ 1 - /module-ie8-stristr.php 1 - /update-ajax.php 1 - /cgi-bin/iR7SzrsOUEP.php 2 - /ashford/ashfvfolk270104.html 3 - /beckenham/deal050205.html 3 - /401.php 1 - /membermember/admin.php 1 - /folkestone/fisher071105.html 3 - /administratoradministrator/index.php 1 - /glgl/login.php 1 - /libraries/vendor/ 1 - /class-wp-metadata-lazyloader-ajax.php 1 - /admin1admin1/index.asp 1 - /wp-content/11.php 2 - /class-wp-customize-background-image-control.php 1 - /co123456789co123456789/index.asp 1 - /co@guanlico@guanli/admin.asp 1 - /wp-includes/js/tinymce/langs/ 1 - /wines/289/maxime-trijol-xo-cognac-grand-champagne-70cl 1 - /wp-content/themes/seotheme/db.php 3 - /backup 6 - /rediraction.php 1 - /p0wny-shell.php 1 - /dede321dede321/admin.asp 1 - /dede/dededede/dede/index.php 1 - /wp-includes/css/css.php 2 - /othernews/SLFIX0506.html 1 - /huiyuanhuiyuan/admin.php 1 - /wp-content/uploads/wpforms/ 1 - /wp-content/plugins/core-plugin/include.php 4 www.google.com /custom-css.php 1 - /modules/cartabandonmentpro/views/js/fileman/index.html 1 - /wp-admin/network/wp-footer.php 1 - /co1co1/admin.php 1 - /class-snoopye_wso.php.bk 1 - /class-wp-uploads.php 1 - /wp-includes/blocks/gallery/index.php 1 - /mambo/images/banners/NextHoliday.gif 4 - /web/wp-content/themes/seotheme/ 1 - /cray/20thapr04A.html 4 - /aboutg7.php 2 - /co8888co8888/login.asp 1 - /wines/247/latium-morini-campo-dei-ciliegi-valpolicella-ripasso-2011 1 - /wines/31/macon-rouge-terres-secretes-2012 1 - /co8888co8888/index.asp 1 - /36ros.php 1 - /wp-includes/SimplePie/HTTP/index.php 1 - /o5filRO2SH9.php 2 - /tgh.php 1 - /wines/155/cartlidge-and-browne-pinot-noir-2012 1 - /app.php 1 - /public_html/fun.php 1 - /class.akismet.api.php 1 - /ms-add-pro-photo.php 1 - /adminer-4.3.0.php 1 - /class-IXR-dateprod.php 1 - /dede888dede888/admin.asp 1 - /class-wp-query-wp.php 1 - /cray/crayresvwhitreskicfinal290404.html 3 - /whitstable/whitstablevlordswood130903.html 5 - /wp-content/themes/pglhewx/ 1 - /wp-includes/blocks/archives/index.php 1 - /wines/69/bollinger-nv 2 - /class-wp-block-type-stream.php 1 - /houtai_cohoutai_co/login.php 1 - /guanlicoguanlico/admin.php 1 - /assets/components/ms2form/vendor/plupload/examples/upload.php 1 - /wines/44/ortas-les-viguiers-2012-rouge 2 - /public_html/shell.php 1 - /9837wes.php7 2 - /lufx.php 1 - /wp-conflg.php 3 - /evil.php 1 - /images/image/ 1 - /admin@coadmin@co/admin.asp 1 - /wp-content/uploads/2019/06/ 1 - /templates/rhuk_milkyway/index.php 1 - /c99.php 1 - /co@rootco@root/index.asp 1 - /wp-includes/sodium_compat/src/Core/Curve25519/Ge/wp_blog.php 2 - /co999co999/login.asp 1 - /../../othernews/SL%20Review%20140805.html 1 - /co666co666/login.asp 1 - /admin1admin1/login.asp 1 - /.well-known/acme-challenge/license.php 2 - /sahoifnq.php 1 - /folkestone/folkvchat211003.html 4 - /beckenham/KSTSF030305.html 6 - /greenwich/whitstable141204.html 3 - /cgi-bin/test/ 1 - /deal/FAV3rewview121204.html 5 - /../premier/dover/folkestone280305.html 1 - /wp-2018.php 2 - /coglcogl/login.php 1 - /images/iR7SzrsOUEP.php 2 - /wp-content/themes/wp-login.php 1 - /wp-content/plugins/three-column-screen-layout/ 1 - /wp-includes/wp-includes/ 2 - /premier/welling/23jan04.html 3 - /assets/img/team/ 1 - /wp-includes/blocks/latest-comments/index.php 1 - /wp-content/uploads/2019/03/ 1 - /folkestone/folkvdart130304.html 4 - /lock3.php 1 - /ovatools.php 2 - /index.php/Admin/public/Login.html 1 - /useruser/login.php 1 - /wp_blog.php 1 - /sites/default/files/ 4 binance.com /hu/ 1 - /alfanew.php 4 - /wp-content/plugins/classic-editor/wp-login.php 2 - /ht@coht@co/admin.asp 1 - /premier/dover/folkestone280305.html 4 http://kentishfootball.co.uk/news/551a97992f193 /member-login/ 1 - /libraries/joomla/jmail.php 1 - /lordswood/erith050205.html 3 - /thamesmead/10thjune05.html 3 http://kentishfootball.co.uk/news/551bc5e826825 /dede321dede321/login.php 1 - /glcoglco/index.asp 1 - /wines/232/canard-duchene-brut-nv-magnums 1 - /bookmark-private.php 1 - /screen_04.php 1 - /.well-known/install.php 1 - /class-wp-media-list-data.php 1 - /wines/74/laurent-miquel-syrah-grenache-2013 1 - /tmp/vuln.php 1 - /dede/admindede/admin/admin.asp 1 - /whitstable/16thjune05.html 4 - /vendor/phpunit/phpunit/src/Util/PHP/eval-stdin.php 2 - /moddofuns.php 2 - /cohtcoht/login.php 1 - /wines/114/the-crossings-marlborough-pinot-noir-2013 1 - /admincoadminco/admin.asp 1 - /warm.PhP7 2 - /sittingbourne/erith&belvedere111204.html 5 - /sincap.php 1 - /wines/71/laurent-miquel-cinsault-syrah-ros-2013 1 - /termps.php 2 - /cache-wordpress/ 2 - /ryman/bromley/bromvashfordfac160903.html 3 - /Composer.php 1 - /mambo/ 1 http://www.kentishfootball.co.uk/mambo/ /wines/290/maxime-trijol-vsop-cognac-grand-champagne-70cl 1 - /coglcogl/admin.asp 1 - /2TaJ2.php 1 - /wines/138/raimat-albarino-2012 2 - /adminer-4.6.0.php 1 - /othernews/Tables.html 1 - /useruser/admin.asp 1 - /wp-ldd.php 2 - /wp-content/uploads/user_uploads/ 1 - /8index.php 1 - /wines/238/chateau-dorignac-pineau-des-charentes 1 - /array_diff_uassoc.php 1 - /beckenham/21stnov04.html 4 - /.ftp.php 1 - /sittingbourne/chatham260305.html 5 - /public_html/iR7SzrsOUEP.php 1 - /lordswood/sevenoaks030905.html 3 - /co_rootco_root/admin.asp 1 - /administrator/index.php 1 - /wp-content/plugins/widget-logic/mini.php 1 - /.well-known/acme-challenge/bala.php 2 - /erith&belvedere/21stjune05.html 3 - /ovshell.php 1 - /wp-includes/js/dist/vendor/index.php 1 - /wp-content/plugins/ango/ 1 - /houtai@cohoutai@co/index.php 1 - /wp-includes/cRyzDAH/ 1 - /4dgark.php 1 - /.well-known/pki-validation/wp-login.php 1 - /co_houtaico_houtai/index.asp 1 - /post-new.php 2 - /ninja.php 1 - /kentleague/whitstable/1stdec05.html 3 - /phpmailer.lang-joomla.php 1 - /wp-config.php~ 3 - /connexion/ 1 - /content.php 6 - /cohtcoht/admin.asp 1 - /wp-includes/block-supports/ 1 - /by.php 1 - /class-wp-pages.php 1 - /othernews/Tables171004.html 1 - /meta-private.php 1 - /oyy8z.php 1 - /public_html/upload.php 1 - /HiKQb.php 1 - /membernew.php 1 - /tehnicheskie-raboty/ 1 - /foxwsov1.php 1 - /pluginfotos.php 1 - /wp-conflg.php. 1 - /wines/203/cranswick-sarus-shiraz-2010 1 - //wp-content/plugins/apikey/mar.php 1 - /dropdown.php 9 http://www.kentishfootball.co.uk//dropdown.php /wp-content/uploads/2014/ 1 - /class-wp-http-response-private.php 1 - //wp-admin/js/about.php7 5 - /DeathShop.php 1 - /co789.123co789.123/index.php 1 - /zkmtq.php 2 - /wp-one.php 1 - //wp-content/dropdown.php 5 - /2019 2 - /Providers/HtmlEditorProviders/Telerik/Telerik.Web.UI.DialogHandler.aspx 2 - /class.api.php 3 - /wp-include/inputs.php 1 - /wp-content/plugins/instabuilder2/cache/ 1 - /.well-known/pki-validation/upfile_(2).php 1 - /ramiro-404.php 1 - /goods.php 1 - /adminer-4.3.0-mysql-en.php 1 - /z.php 1 - /inputs.php 15 www.google.com /dede@admindede@admin/index.asp 1 - /wordpress/wp-includes/wlwmanifest.xml 19 - /class-wp-widget-tags.php 1 - /steven-salpeter/ 1 - /wp-content/plugins/envato-market/inc/class-envato-market-api.php 2 - /sgd.php 2 - /content-post.php 1 - /doiconvs.php 2 - /auto.php 1 - /ht@coht@co/index.asp 1 - /.well-known/ai.txt 5 - /images/thefa/spacer.gif 1 - /class-wp-widget-categories-meta.php 1 - /othernews/crayvalley120305.html 1 - /wines/275/villa-wolf-pinot-gris-2013 2 - /wp-admin/maint/index.php 1 - /8.php 1 - /directory/wp-admin/includes/ 1 - /sladegreen/erith050305.html 5 - /wordpress.php 1 - /OE1c3.php 1 - /lordswood/deal161004.html 3 - /priv8.php 1 - /co9999co9999/admin.asp 1 - /wp-includes/blocks/missing/index.php 1 - /wp-content/uploads/piotnet-addons-for-elementor/ 1 - /wp-admin/js/about.php 9 http://www.kentishfootball.co.uk//wp-admin/js/about.php /shell20211028.php 2 - /tunbridgewells/tunvseven240404A.html 4 - /2021/wp-includes/wlwmanifest.xml 12 - /BACKUP 2 - /connects.php 2 - /wp-signup.php 3 - /alf.php 3 - /tonbridge/tonbvfolk131203.html 2 http://kentishfootball.co.uk/news/551a97992f193 /about.php7 3 - /wines/244/ramon-bilbao-limited-edition-2011 1 - /wines/193/chapel-down-flint-dry-2013 1 - /hythe/beckenham110904.html 3 - /zz.php 1 - /wp-admin/includes/xleet-shell.php 2 - /lordswood/vcd260305.html 4 - /apple-touch-icon-120x120.png 206 - /co1co1/login.asp 1 - /Wordpress 2 - /wp-includes/blocks/shortcode/index.php 1 - /wp-content/auto_seo.php 1 - /wp-content/plugins/wp-hps/sh/ 2 - /mambo/images/M_images/arrow.png 2 - /style.php 20 www.google.com /folkestone/dartford180105.html 3 - /sladegreen/sladevhyth130304.html 5 - /doe-de-check/ 1 - /.well-known/acme-challenge/atomlib.php 2 - /landing/solution/ 1 - /wp-includes/js/crop/index.php 1 - /co_rootco_root/login.asp 1 - /wire/modules/Jquery/JqueryUI/touch.js 1 - //debug/default/view 1 - /administrator/templates/isis/error.php 1 - /ecp/Current/exporttool/microsoft.exchange.ediscovery.exporttool.application 1 - /mambo/templates/247portal-b-red/images/rtop.jpg 1 - /google.php 1 - /test/wp-admin/maint/ 1 - /wp-content/uploads/2018/ 1 - /347_fle_img_pic.php 1 - /tonbridge/16thfeb04.html 2 http://kentishfootball.co.uk/news/551a956ca8ac9 /mambo/index2.php 27 http://www.kentishfootball.co.uk/mambo/index2.php /wp-content/plugins/wp-freeform/ 2 - /cray/30thapr04.html 3 - /wp-content/plugins/Cache/dropdown.php 5 http://www.kentishfootball.co.uk//wp-content/plugins/Cache/dropdown.php /wp-good.php 2 - /1243-345.php 1 - /wp-includes/block-patterns/ 1 - /de/ 1 - /wp-includes/TfDlQjb/ 1 - /aci.php 1 - /VCD/1staug05.html 3 - /administratoradministrator/admin.php 1 - /wines/81/maison-de-vigneron-pays-des-cotes-de-gascogne-ros-2013 1 - /wp-includes/Requests/index.php 1 - /wp-includes/js/mediaelement/index.php 1 - /vuln.php 1 - /wines/47/chateau-pesquie-ventoux-2012 2 - /wp-conflg.php.suspected 1 - /wines/225/chateau-du-coing-de-st-fiacre-muscadet-sevre-et-maine-sur-lie-2010-375cl-bottle 1 - /wines/34/domaine-faiveley-corton-clos-des-cortons-faiveley-grand-cru-2008 1 - /sitelog.php 1 - /wines/148/vetiver-rioja-blanco-2012 1 - /wp-content/install.php 5 http://www.kentishfootball.co.uk//wp-content/install.php /wp-content/uploads/2014/06/ 1 - /media-site.php 1 - /assets/img/ 1 - /inbox.php 1 - /Enclosure-ajax.php 1 - /lp_kyutei/ 1 - /houtai@cohoutai@co/admin.asp 1 - /gtoext.php 1 - /bbypass.php 1 - /wines/254/chateau-bel-air-2009 1 - /wp-includes/css/dist/ 2 - /VCD/27thfeb04.html 3 http://kentishfootball.co.uk/news/551bc5e38b923 /ms.php 2 www.google.com /admin/ 4 - /wp-content/ 6 - /wp-includes/rest-api/endpoints/ 1 - /corootcoroot/admin.asp 1 - /conference/margate/12thjuly04.html 3 - /s/7313e2131323e2537313e2331323/_/ 1 - /co1111co1111/login.php 1 - /ht_coht_co/index.asp 1 - /co12co12/login.php 1 - /field.php 1 - /../premier/welling/13thmay05.html 2 - /wp-content/plugins/wp-pregoes/ 1 - /jon.php 1 - /hernebay/hernvslad061203.html 4 - /sidwso.php 1 - /later.php 1 - /../../kentleague/ramsgate/1stjan06.html 1 - /indoxploit.php 1 - /assets/assets/ 1 - /makeasmtp.php 2 - /wines/251/faurar-alb-de-ceptura-2013 2 - /hacked.php 1 - /othernews/20thaug03.html 1 - /wp-content/wso112233.php 2 - /tunbridgewells/18thnov04.html 3 http://kentishfootball.co.uk/news/551bc5da40d4b /thamesmead/sladegreen080105.html 4 - /elementor-statement.php 1 - /dede12dede12/admin.php 1 - /empty.php 1 - /coco/admin.php 1 - /wp-includes/blocks/post-date/index.php 1 - /.well-known/pkivalidation/shell20211028.php 2 - /wines/119/franschhoek-cellar-la-cotte-mill-chenin-blanc-2014 1 - /V3.php 1 - /wp-content/plugins/seoplugins/db.php 1 - /admin888admin888/index.asp 1 - /IndoXploit.php 1 - /reune.php 2 - /alfanibos.php 1 - /alfa-ioxi.php 1 - /kentleague/ramsgate/ashfordu18vramsgateu18.html 2 - /wp-content/uploads/2021/ 2 - /wines/39/montagny-1er-cru-2012-vignerons-de-buxy 1 - /ta/timesheet-professional/ 1 - /wp-scripts.php 2 - /administrator/ 2 - /libraries/phpmailer/updates.php 1 - /wines/284/sacred-gin-70cl 2 - /load-styles.php 2 - /.well-known/pki-validation/wp-sigunq.php 1 - /wp-includes/bala.php 2 - /es/ 1 - /alfarex.php 2 - /huiyuanhuiyuan/login.php 1 - /../../kentleague/VCD/31stjan04.html 1 - /upx.php 1 - /wpcontent/plugins/nampvqu/ 1 - /wines/248/nocturno-colheita-nocturna-2013 1 - /wp-includes/blocks/columns/index.php 1 - /ryman/bromley/15thnov05.html 4 - /houtai_cohoutai_co/index.asp 1 - /wines/106/tabali-reserva-sauvignon-blanc-2013 1 - /config.json 1 - /lordswood/maidstone271205.html 3 - /co1111co1111/index.php 1 - /wp-content/themes/sketch/ 2 - /wp-includes/blocks/text-columns/index.php 1 - /wines/224/sancerre-2012-michel-girard-et-fils-375cl-bottle 1 - /geju.php 2 - /uploadTest.php 1 - /kentleague/maidstone/7thjuly04.html 3 - /wp-admin/includes/cloud.php 1 - /wp-content/themes 1 - /wines/189/conviviale-primitivo-2012 2 - /mambo/mambots/ 5 - /IOptimize.php 1 - /co12co12/admin.asp 1 - /it/wp-admin/ 1 - /wp-content/plugins/press/ 1 - /wines/264/ferghettina-franciacorta-brut 1 - /wp-includes/js/tinymce/skins/wordpress/images/ 1 - /assets/ventanas_director/ 1 - /fox1.php 1 - /slot-deposit-pulsa/ 1 - /flickr.class.php 1 - /f0x.php 1 - //wp-admin/install.php 5 - /heada.php 2 - /co123co123/login.asp 1 - /.well-known/pki-validation/license.php 1 - /wp-admin/images/cloud.php 3 - /reader.php 1 - /guanliguanli/login.php 1 - /components/com_b2jcontact/izoc.php 1 - /cohoutaicohoutai/admin.asp 1 - /managemanage/admin.asp 1 - /unzip.php 1 - /guanliguanli/index.php 1 - /_all_dbs 1 - /public_html/wp-blog.php 1 - /feeds.php 1 - /kentleague/deal/Sampson9A.html 3 http://www.kentishfootball.co.uk/kentleague/deal/Sampson9A.html /wp-includes/blocks/tag-cloud/index.php 1 - /wp-includes/wp-class-us/ 1 - /adminer-4.6.1-mysql.php 1 - /beckenham/vcd220305.html 4 - //uploads/wp-blog.php 1 - /img/cloud.php 3 - /wp-includes/PHPMailer/index.php 1 - /css/index.php 1 - /public_html/moon.php 1 - /includes.php 1 - //backup/wp-admin/setup-config.php 1 www.google.com /ye.php 1 - /o_o.php 1 - /mambo/templates/247portal-b-red/images/left2.jpg 1 - /amaxx.php 1 - /maintenance-2/ 1 - /alfashell.php 1 - /tttt.php 1 - /class-json-ajax-response.php 1 - /.well-knownold/ 1 - /alexus.php 1 - /en.php 1 - /folkestone/folkevsitt230903.html 5 - /wpm/start/image/ 1 - /wp-includes/js/jquery/ui/index.php 1 - /erith&belvedere/8thsept04.html 5 - /wp-2020.php 2 - /pt/ 1 - /autoload-ajax.php 1 - /slideshow-gallery.php.bak 1 - /sendgrid/.env 3 - /wp-content/patior/ 5 http://www.kentishfootball.co.uk//wp-content/patior/ /sladegreen/tunwells150105.html 5 - /co147co147/index.php 1 - /sladegreen/8thaug05.html 5 - /sladegreen/sladevseven090304.html 6 - /erithtown/hernebay131204.html 4 - /sittingbourne/sittvdart141003.html 5 - /cray/kentleaguecupfinalreport080504A.html 4 - /wp-sigunq.php 2 - /sittingbourne/fisher160804.html 6 - /othernews/15thmay04.html 1 - /htht/index.asp 1 - /premier/dover/tonbridge301004.html 4 - /.well-known/pki-validation/admin.php 1 - /maidstone/31stmay05.html 4 - /backup.php 1 - /admin@coadmin@co/admin.php 1 - /wp-includes/blocks/query-pagination-next/index.php 1 - //wp-admin/images/install.php 5 - /wp-content/themes/pridmag/ 2 - /help.php 1 - /sladegreen/30thdec05.html 5 - /3so.php 1 - /admin@coadmin@co/index.php 1 - /puki.php 1 - /edit-form-comment.php 2 - //wp-content/uploads/ 5 - /01%20copy.php 1 - /tunbridgewells/maidstone181204.html 5 - /wpadmin/ 1 - /class-wp-network-wp.php 1 - /wines/93/casas-del-bosque-sauvignon-blanc-2014 1 - /wp-includes/widgets/ 2 - /wp-includes/blocks/query-pagination-previous/index.php 1 - /Marvins.php%20 1 - /sladegreen/sladevbeck011103.html 6 - /wso-latest.php 1 - /xxxxxminoksxxxx2021/ 1 - //wp-admin/users.php 1 - /dede/dededede/dede/login.asp 1 - /ryman/bromley/cray130805.html 4 - /wp-content/plugins/upspy/ 1 - /wp-content/plugins/wp-daft/miin.php 2 - /.well-known/acme-challenge/xmrlpc.php 3 - /wp-includes/js/index.php 1 - /wp-content/uploads/import/ 1 - /co9999co9999/index.php 1 - /rss/order/new/ 1 - /gray.php 1 - /moduless.php 4 - /auto_seo.php 1 - /assets/includes/ 1 - /ae.php 1 - /admin/login.php 1 - /wp-content/themes/zakra/ 2 - /Ninja.php 1 - /wp-content/plugins/akismet/views/ 1 - /images/banner/ 1 - /co_dedeco_dede/admin.php 1 - /wp-includes/sodium_compat/namespaced/Core/Curve25519/Ge/index.php 1 - /blog/robots.txt 1 - /co123.789co123.789/login.php 1 - /wp-admin/ 2 - /wp-includes/images/smilies/index.php 1 - /kentleague/erithtown/erithvlords081103.html 1 - /fisher/fishvfolk201203.html 3 - /wines/159/burlesque-zinfandel-2012 2 - /setup-config.php 2 - /wp-content/plugins/wp-db-ajax-made/wp-ajax.php 1 - /wp-content/plugins/install.php 5 http://www.kentishfootball.co.uk//wp-content/plugins/install.php /guanlicoguanlico/login.asp 1 - /wp-includes/js/tinymce/utils/ 1 - /wp-content/uploads/options-writing.php 2 - /othernews/Foresters.html 1 - /gdftps.php 2 - /sittingbourne/28thaug03.html 6 - /ir/uploads/ 1 - /ayogjayd.php 1 - /wp-includes/js/plupload/ 2 - /wp-settings.php 2 - /wp-content/plugins/hellopress/wp_filemanager.php 1 - /wp-admin/about.php 1 www.google.com /Chitoge.php 1 - /ks_inc/common.js 1 http://www.kentishfootball.co.uk/ks_inc/common.js /wordpress/wp-admin/includes 2 - /wp-content/uploads/2023/12/ 1 - /php.php 1 - /dede/login.php 1 - /bulk.php 1 - /inc20k1.php 1 - /nova-objava.php 1 - /erith&belvedere/chatham300804.html 5 - /ryman/bromley/margate200905.html 5 - /wp-content/languages/index.php 1 - /co9999co9999/login.php 1 - /script-loader-react-refresh-entry.min-ajax-response.php 1 - /class-wp-plugins.php 1 - /wines/158/burlesque-white-zinfandel-ros-2013 1 - /wp-includes/home.php 2 - /guanliguanli/admin.asp 1 - /managemanage/login.php 1 - /txx.php 1 - /tshop.php 1 - /dede/dededede/dede/admin.php 1 - /DesktopModules/TelerikWebUI/RadEditorProvider/Telerik.Web.UI.DialogHandler.aspx 2 - /up.php 3 - /beckenham/vcd050305.html 4 - /mambo/images/M_images/pdf_button.png 4 - /public_html/inputs.php 1 - /wp-content/uploads/ao_ccss/ 2 - /wp-content/plugins/html404/index.html 1 - /glass.php 1 - /kontol.php 1 - /wines/223/argosy-sauvignon-blanc-2011-375cl-bottle 1 - /dede/admindede/admin/index.php 1 - /thamesmead/9thsept04.html 3 http://kentishfootball.co.uk/news/551a9c9247459 /type.php 1 - /wines/282/sacred-london-dry-vodka-70cl 2 - /script-loader-react-refresh-runtime-ajax.php 1 - /splash-page/ 1 - /lordswood/lordvdeal191103.html 4 - /wines/280/pallio-di-san-floriano-verdicchio-classico-superiore-2012 1 - //admin/controller/extension/wpm.php 1 - /wines/21/chablis-2012-gilbert-picq-ses-fils 1 - /images/cloud.php 3 - /ryman/bromley/chelmsford200805.html 1 - /jiema.php 2 - /ms-load-private.php 1 - /Registry-handler.php 1 - /cray/crayvtunw310304.html 4 - /sad.php 2 - /plugins-log.php-sold 1 - /contract.php 1 - /sonic.php 1 - /mambo/images/stories/BadgersFlood.jpg 2 - /co@adminco@admin/admin.php 1 - /wines/4/le-paradou-grenache-2012 2 - /db-update.php 1 - /custom-background.php 2 - /co12co12/index.asp 1 - /managermanager/login.asp 1 - /tunbridgewells/sladegreen041005.html 4 - /wpvitamins.php 1 - /wp-includes/js/tinymce/langs/index.php 1 - /acp.php 1 - /deal/lordswood150305.html 5 - /wp-search.php 1 - /cdknvxsw.php 1 - /nav-menus.php 2 - /poster.php 1 - /wines/133/the-pepper-pot-2013 1 - /beckenham/thamesmead260405.html 4 - /managemanage/index.php 1 - /wines/85/morgon-la-ballofiere-2012-jean-paul-dubost 1 - /contact\" 2 http://kentishfootball.co.uk/ /assets/acordeonPhp/ 1 - /wp-admin/css/colors/blue/index.php 1 - /wp-includes/js/dist/vendor/ 1 - /wp-includes/css/dist/reusable-blocks/index.php 1 - /shellx.php 1 - /wp-content/plugins/backup-backup/admin/css/bmi-plugin.min.css 4 - /co888co888/admin.asp 1 - /admin_styles.php 1 - /dede12dede12/index.asp 1 - /9index.php 1 - /wp-content/plugins/prenota/ 2 - /wp-content/plugins/linkpreview/ 2 - /v9.php 1 - /blog/wp-admin/network/ 1 - /images/install.php 1 - /co@guanlico@guanli/index.asp 1 - /co_managerco_manager/index.php 1 - /11index.php 1 - /akismet.php 1 - /wp-dmin/user/ 1 - /lordswood/erith131104.html 3 - /modules/mod_simplefileuploadv1.3/elements/%C2%AE.php 2 - /owl.php 1 - /wp-includes/js/wp-emoji-release.min.js 2 www.google.com /data-db.php 1 - /file.php 2 - /wp-admin/includes/class-wp-media-list-data.php 2 - /co1111co1111/admin.asp 1 - /wines/213/philip-shaws-the-idiot-shiraz-2011 1 - /product/14-carat-white-gold-18-inches/ 1 - /w3d.php 1 - /fi/ 1 - /bac 2 - /corootcoroot/login.php 1 - /adminadmin/index.asp 1 - /wp-admin/js/index.php 1 - /corootcoroot/index.php 1 - /admin/privilege.php 1 - /thamesmead/cray070804.html 3 http://kentishfootball.co.uk/news/551a9c9247459 /tonbridge/3rdmar04.html 3 http://kentishfootball.co.uk/news/551a9718dcf5d /ajaxfileupload.php 1 - /managermanager/admin.asp 1 - //wp-content/themes/twenty/twenty.php 5 - /wp-includes/Requests/Utility/ 1 - /ioxi-aneh.php 2 - /site/wp-includes/ 2 - /blog/wp-includes/wlwmanifest.xml 19 - /wp-admin/cloud.php 3 - /.well-known/pki-validation/index.php 2 - /administrator/templates/isis/index.php 1 - //wp-content/plugins/dzs-zoomsounds/1877.php 1 - /wp-content/languages/ 4 - /wines/258/campbells-bobbie-burns-durif-2010 1 - /dede12dede12/login.asp 1 - /wp-includes/js/ 2 - /careers 1 - /pro/ 1 - /kii.php 1 - /txets.php 2 - /defense.php 1 - /dskhboktxl.php 1 - /co8888co8888/admin.php 1 - /ubh.php 1 - /co@htco@ht/login.asp 1 - /1693569115.php 1 - /kentleague/cray/ashford061205.html 3 - /wp-content/uploads/xl2023.php 2 - /administratoradministrator/login.asp 1 - /upl.php 1 - /cpanel.php 1 - /wines/62/joseph-perrier-la-cuvee-royale-brut-nv 1 - /kentleague/maidstone/9thsept04.html 4 - /m 10 - /co_glco_gl/login.asp 1 - /accountaccount/index.asp 1 - /alfanew.php7 3 - /bg_info.php 1 - /admin_coadmin_co/login.asp 1 - /wines/117/rua-pinot-noir-2012 1 - /max.php 1 - /about/ 1 - /uploads__.php 1 - /el/ 1 - /../othernews/FAVase2RPreview161105.html 1 - //cgi-bin/cgi-bin/about.php 5 - /administrator/templates/bluestork/index.php 1 - /alfa-rex.php 3 - /options-privacy.php 1 - /wp-content/plugins/xichang/ 1 - /user-info.php 1 - /wp-content/uploads/2020/ 1 - /wp-content/themes/alera/ 2 - /admin1admin1/admin.php 1 - /templates/ja_purity/index.php 1 - /wp-content/plugins/seoplugins/mar.php 1 - /wp-content/plugins/djykfvd/ 1 - /9.php 1 - /under-construction/ 1 - /wpx.php 1 - /wp-content/uploads/2018/11/ 1 - /csv1.php 1 - /wp-includes/blocks/heading/index.php 1 - /postnews.php 2 - /css/install.php 6 - /wp-admin/shell20211028.php 2 - /wp-content/plugins/WordPressCore/ 1 - //www.google.com/recaptcha/api.js 2 - /memberfuns.php 2 - /admin_coadmin_co/admin.php 1 - /cgi-bin/index.php 1 - /wp-content/endurance-page-cache/ 1 - /uwer.php 1 - /nice.php 2 - /NEW 2 - /modules/mod_simplefileuploadv1.3/elements/ 2 - /wp-admin/images/ 2 - /co888co888/index.asp 1 - /admincoadminco/index.asp 1 - /gl_cogl_co/login.php 1 - /wp-includes/blocks/query-pagination/index.php 1 - /wp-trc.php 1 - /infaccess/ 1 - /india/ 1 - /kentleague/ramsgate/tonbridge290805.html 3 http://kentishfootball.co.uk/news/551a99e5203dd /av.php 1 - /wp-content/bala.php 2 - /wp-includes/dropdown.php 2 - /beckenham/deal030905.html 3 - /membermember/index.asp 1 - /wp-content/plugins/wp-diambar/includes/ 2 - /wines/108/nostros-reserva-sauvignon-blanc-2013 1 - /wp-content/shell20211028.php 3 - /othernews/7thjuly03.html 1 - /wp-includes/PHPMailer/ 2 - /membermember/login.asp 1 - /widgets.php 2 - /wp-content/uploads/2023/02/ 1 - /wines/181/nuovo-quadro-la-battistina-gavi-di-gavi-2013 1 - /oldsite 2 - /wp-includes/blocks/buttons/index.php 1 - /deal/13thmar05.html 4 - /Auth-cron.php 1 - /rtbfp60p.php 1 - //wp-admin/maint/moon.php 5 - /class-wp-post-text-query.php 1 - /assets/css/site.cs 2 - /wp-includes/blocks/button/index.php 1 - /adminadmin/admin.asp 1 - /wp-admin/includes/iR7SzrsOUEP.php 2 - /wp-content/plugins/owfsmac/ 2 - /include/calendar/calendar-cn.js 1 http://www.kentishfootball.co.uk/include/calendar/calendar-cn.js /menu-header.php 2 - /templates/ja_purity/ 1 - /site-login/ 1 - /wp-includes/Text/Diff/ 2 - /wp-admin/js/widgets/about.php 1 - /themes.php 3 - /guanli@coguanli@co/admin.asp 1 - /who.php 1 - /core.php 1 - /co123456co123456/admin.asp 1 - /.vscode/ftp-sync.json 2 - /h4xor.php 1 - /wp-includes/blocks/video/index.php 1 - /.aws/credentials 2 - /wp-ok.php 2 - /ms-users.php 2 - /premier/dover/16thjan05A.html 5 - /contacto.php 1 - /class-wp-ajax.php 1 - /programa_apoyo_editoriales.php 1 - //wp-includes/rest-api/about.php 5 - /mall.php 2 - /yanz.php 3 - /administrator/templates/hathor/ 1 - /wrapper.php 1 - /wp-includes/js/tinymce/plugins/compat3x/css/ 1 - /FoxWSOv1.php 1 - /WordPress 2 - /wp-embed-template-ie.min.php 1 - /co147co147/admin.php 1 - /cray/crayvsporting160803.html 2 - /wines/104/tabali-reserva-especial-pinot-noir-2012 1 - /co@glco@gl/login.asp 1 - /cray/vcdvcray240404.html 5 - /cloud.php 4 - /wp-includes/js/tinymce/plugins/charmap/index.php 1 - /thamesmead/18thnov04.html 4 - /htaccess.php 1 - /images/slider/ 1 - /Shop 2 - /glcoglco/login.php 1 - /huiyuanhuiyuan/index.php 1 - /tonbridge/7thsept04.html 2 http://kentishfootball.co.uk/news/551a97992f193 /wp-content/uploads/2023/11/ 1 - /wines/222/argosy-pinot-noir-2009-375cl-bottle 1 - /co_htco_ht/login.asp 1 - /cohtcoht/index.asp 1 - /mscr.php 1 - /b374k-2.8.source.php 1 - /gravesend/12thmay04.html 3 - /public_html/file.php 1 - /wp-content/plugins/wso112233.php 2 - /wp-content/plugins/revslider/includes/external/page/ 1 - /wp-includes/css/dist/edit-post/index.php 1 - /admin-footer.php 2 - /ryman/bromley/margate221105.html 4 - /wp-content/plugins/limit/ 2 - /RG7F89afA.php 1 - //sites/default/files/HolaDR7_70778.php 1 - /results/drmartenspremier03-04.html 1 - /wp-includes/blocks/media-text/index.php 1 - /time-options.php 1 - /tunbridgewells/27thmar05.html 3 - /IDNAEncoder-wp.php 1 - /wp-includes/Requests/Proxy/ 1 - /profile.php 2 - /wp-includes/html-api/ 1 - /thamesmead/thamesmeadvramsgate160803.html 3 http://kentishfootball.co.uk/news/551a99e5155f5 /coglcogl/index.asp 1 - /nuovosito/ 1 - /updates.php 3 - /wp-includes/blocks/query-title/index.php 1 - /../kentleague/cray/23rdmar05.html 2 - /media-widgets-min.php 1 - /wines/95/emiliana-reserva-riesling-2012 2 - /wp/wp-includes/wlwmanifest.xml 19 - /htht/admin.asp 1 - /tmp/ 2 - /SFNN.php 1 - /useruser/index.asp 1 - /wp-content/uploads/2021/03/ 1 - /../../kentleague/ramsgate/25thjan04.html 1 - /wp-content/plugins/hellopress/ 1 - /wp-content/themes/thuoc-nam/ 2 - /post-new.php_.html 1 - /wp-admin/includes/xmrlpc.php 3 - /guanli@coguanli@co/index.asp 1 - /exit.PHP 1 - /mambo/templates/247portal-b-red/images/ltop.jpg 1 - /showhide.php 1 - /wp-content/plugins/stats/ 1 - /dede888dede888/index.php 1 - /wp-content/inputs.php 1 - /ryman/bromley/folkestone290805.html 3 http://kentishfootball.co.uk/news/551a97992f193 /wp-includes/pomo/ 2 - /WORDPRESS 2 - /tempfuns.php 2 - /templates/beez_20/index.php 1 - /administrator/components/ 2 - /co369co369/login.php 1 - /wp-page-update.php 1 - /wp-includes/block-supports/index.php 1 - /gl@cogl@co/login.php 1 - /glcoglco/admin.asp 1 - /twins.php 1 - /pdo.inc.php 1 - /get_declared_interfaces.php 1 - /dartford/18thsept05.html 3 - /plugins/plupload/examples/upload.php 1 - /admin/upload/ 2 - /co123.789co123.789/login.asp 1 - /wp-content/languages/plugins/install.php 1 - /apple-touch-icon-152x152-precomposed.png 117 - /list-table-cron.php 1 - /wp-content/plugins/ppus/up.php 1 - /wp-content/themes/index.php 1 - /co123456co123456/index.php 1 - /wp-includes/blocks/more/index.php 1 - /up/.well-known/ 2 - /503.php 1 - /el/home-version-1/ 1 - /index5.php 1 - /%C2%AE.php7 1 - /admin_coadmin_co/index.php 1 - /d22.php 1 - /schallfuns.php 2 - /public/plugins/plupload/examples/upload.php 1 - /images/icons/ 1 - /images/content/revslider/ 1 - /con.php 1 - /wpsml-sys.php 1 - /dec.php 1 - /wp-content/themes/ybmfola/ 1 - /ovavcvmkt.php 1 - /wp1/wp-includes/wlwmanifest.xml 18 - /wp-includes/sodium_compat/lib/ 1 - /ovagwbylk.php 1 - /wp-includes/images/media/ 2 - /apply/index.asp 3 http://www.kentishfootball.co.uk/apply/index.asp /fdgs.php 1 - /wp-include/auto_seo.php 1 - /co@houtaico@houtai/index.asp 1 - /wines/25/domaine-bernard-moreau-et-filschassagne-montrachet-2012 1 - /wp-content/plugins/houzez-theme-functionality/extensions/ 1 - /hythe/hythevslade081103.html 5 - /tunbridgewells/tunvslade130903.html 6 - /load-scripts.php 2 - /mari.php 1 - /3x.php 2 - /abouts.php 1 - /dede1dede1/login.php 1 - /2019/wp-includes/wlwmanifest.xml 17 - /sym403.php 1 - /Category-ajax.php 1 - /composer.php 1 http://kentishfootball.co.uk/composer.php /hxxs.php 1 - /co@adminco@admin/index.php 1 - /.well-known/pki-validation/install.php 1 - //_profiler/phpinfo 1 - /service.php 1 - /.well-known/pki-validation/termps.php 1 - /contact.php 1 - /xz.php 1 - /membermember/login.php 1 - /admin/index.php 1 - /dede/dededede/dede/login.php 1 - /co123co123/login.php 1 - /../ryman.html 1 - /newsite/ 1 - /css.php 1 - /.well-known/acme-challenge/iR7SzrsOUEP.php 2 - /ramsgate/24thjune05.html 6 - /css/dg/ 1 - /cray/crayvhyth260404.html 4 - /wp-includes/blocks/latest-posts/index.php 1 - /infra/wpadmin/includes/ 1 - /wp-logien.php 1 - /wp-includes/Requests/Text/admin.php 3 - /reg_form.php 1 - /wp-content/plugins/theme-configurator/ 1 - /nav-menu-template-path.php 1 - /wp-diambar/includes/ 2 - //wp-includes/js/tinymce/skins/lightgray/fonts/index.php 1 - /heavenly-minded-mom/ 1 - /2Vu80QG.php 1 - /wp-includes/css/dist/list-reusable-blocks/ 1 - /xmlrpcs.php7 2 - /sladegreen/maidstone200805.html 5 - /wines/294/joseph-perrier-la-cuve-royal-demi-sec 1 - /othernews/selsey17thjuly03.html 1 - /x.php 2 - /dartford/tingley030504.html 4 http://kentishfootball.co.uk/news/551a97b2058ae /swm.php 1 - /87.php 2 - /welcome-page/ 1 - /wines/272/triuno-cabernet-sauvignon-2012 2 - /kentleague/sladegreen/26thjune03.html 4 http://kentishfootball.co.uk/news/551a979a5d630 /admincoadminco/login.asp 1 - /wp-admin/includes/js/ 1 - /wp-content/wp.php 1 - /.well-known/pki-validation/xmrlpc.php 4 - /123.php 3 - /CasperExV1.php 1 - /images/xmrlpc.php 3 - /vendor/phpunit/phpunit/src/Util/PHP/ 2 - /index4.php 1 - /wp-includes/fonts/ 2 - /wp-incleude.php 1 - /wines/73/laurent-miquel-chardonnay-viognier-2013 1 - /wines/286/anno-sloe-gin-70cl 2 - /wp 6 - /aver.php 2 - /cmd.php 1 - /xmrlpc.php 6 - /wp-mails.php 1 - /wp-includes/SimplePie/Cache/index.php 1 - /dede321dede321/login.asp 1 - /membermember/index.php 1 - /website/wp-includes/wlwmanifest.xml 6 - /wp-includes/IXR/ 2 - /public_html/Simple.php 1 - /wines/99/montevista-chardonnay-2013 2 - /wp-includes/blocks/index.php 1 - /wp-content/themes/gaukingo/db.php 1 - /wp-includes/index.php 1 - /admin1admin1/admin.asp 1 - /options.php 2 - /Alfa.php 1 - /wp-content/uploads/2018/03/ 1 - /moded.php 2 - /.git/config 1 - /wp-content/plugins/css-ready/file.php 1 - /hoaysdit.php 1 - /wp-content/plugins/WordPressCore/include.php 3 - /public_html/admin.php 1 - /public/admin/assets/plugins/plupload/examples/upload.php 1 - /wines/100/emiliana-merlot-2013 2 - /thems.php 2 - /8a6fff0.php 1 - /wp-includes/sodium_compat/src/Core/Curve25519/Ge/ 1 - //wp-includes/install.php 5 - /simple.php5 1 - /wp-content/upgrade/index.php 1 - /wp-admin/includes/index.php 1 - //wp-includes/sodium_compat/src/Core/Curve25519/Ge/wp_blog.php 1 - /storage/ 1 - /sure.php 1 - /css/assets/ 1 - /ym.php 1 - /ht_coht_co/index.php 1 - /wp-content/plugins/ht-mega-for-elementor/assets/css/htbbootstrap.css 1 - /wp-content/uploads/simple-file-list/ 2 - /ftp_nb_fget.php 1 - /folkestone/5thmay05.html 2 - /co@dedeco@dede/admin.asp 1 - /bookmark-wp.php 1 - /job 1 - /sladegreen/beckenham041204.html 5 - /alfa1.php 1 - /wp-content/plugins/essential-addons-for-elementor-lite/readme.txt 1 www.google.com /co8888co8888/admin.asp 1 - /unieke-locatie-aan-de-maas/ 1 - /class-wp-xml.php 1 - /%C2%AE.php 3 - /wp-admin/setup-config.php 4 - /lordswood/beckvlord270304.html 3 - /sitio 2 - /wp-confiig.php 1 - /wp-content/uploads/2010/ 1 - /post.php 2 - /sevenoaks/dealtown250904.html 5 - //admin/controller/extension/extension/Not_Found.php 1 - /kentleague/lordswood/erith&belvedere031205.html 3 - /MARJUNA.php 1 - /index8.php 1 - /libraries/vendor/updates.php 1 - /pm.php 1 - /fm1.php 3 - /wines/261/dominio-de-cair-cuvee-2011 2 - /wp-includes/blocks/table/index.php 1 - /public/assets/plugins/plupload/examples/upload.php 1 - /wp-admin/js/widgets/cloud.php 1 - /.well-known/pki-validation/404.php 2 - /wp-content/plugins/home/ 2 - /wp-includes/Requests/Auth/index.php 1 - /wines/171/miopasso-nero-davola-2012 1 - /signupmember/ 1 - /__wp_imecs1/ 1 - /wp-includes/js/tinymce/skins/wordpress/images/index.php 4 - /class-wp-type-registroy.php 1 - /wp-editor.php 2 - /wp-includes/language/ 1 - /include/taglib/help/mytag.txt 2 http://www.kentishfootball.co.uk/include/taglib/help/mytag.txt /images/items/ 1 - /wp-includes/rest-api/fields/ 1 - /aullgxft.php 1 - /wp-consar.php 3 - /templates/beez5/index.php 1 - /wines/121/franschhoek-cellar-the-churchyard-cabernet-sauvignon-2012 1 - /tunbridgewells/ramsgate301004.html 3 http://kentishfootball.co.uk/news/551a99e5155f5 /wp-content/uploads/booking_calendar/ 1 - /htht/login.php 1 - /cmd13.php 1 - /wp_mna.php 1 - /.htacess.php 2 - /.wp-cli/cache/index.php 1 - //cgi-bin/cgi-bin/about.php7 5 - /rDkvTUar0XIX/ 1 - /wp-includes/js/thickbox/index.php 1 - /wp-old 2 - /wp-cron1.php 1 - //wp-content/patior/ 5 - /wp-content/plugins/royal-elementor-addons/assets/js/modal-popups.min.js 1 - /wp-includes/js/tinymce/index.php 1 - /mambo/images/stories/ashfordtownkit2.jpg 3 - /uploads.php 1 - /wp-entry-sec.php 1 - /results/drmatenseast03-04.html 1 - /wp-admin/js/widgets/ 2 - /source.php 1 - /../../ryman/bromley/ashford151105.html 1 - /whitstable/9thjune04.html 4 - /daes.php 1 - /wp-includes/Requests/Utility/index.php 1 - /wp-includes/blocks/categories/index.php 1 - /robots.php 1 - /wp-includes/sitemaps/providers/ 2 - /query-small-posts-wp.php 1 - /wp-content/home.php 2 - /wp-content/ALFA_DATA/alfacgiapi/ 2 - /plugins-log.php-28%20DA 1 - /resources/ 1 - /ramsgate/27thjan05.html 4 - /cgi-bin/cloud.php 3 - /wp-includes/SimplePie/plugins.php 2 - //wp-content/plugins/linkpreview/wp-blog.php 1 - /wp-content/plugins/backup-backup/includes/kro.php 2 - /social-links-shared-background-color-cron.php 1 - /wp-includes/SimplePie/index.php 1 - /xt.php 2 - /wp-content/plugins/vwcleanerplugin/bump.php 1 - /houtai_cohoutai_co/admin.asp 1 - /wp-content/plugins/press/wp-class.php 2 - /Marvins.php 1 - /kentleague/cray/23rdmar05.html 4 - /dede123dede123/index.php 1 - /Cache.php 1 - /cray/greenwichvcray060903.html 4 - /wines/77/domaine-de-pellehaut-harmonie-de-gascogne-blanc-2014 1 - /class-wp-widget-tag-cloud-private.php 1 - /wp-includes/themes.php 2 - /thumbs.php 1 - /login.asp 1 - /images/vuln.php 1 - /wp-includes/blocks/loginout/index.php 1 - /.DS_Store 1 - /image-edit-core.php 1 - /ups.php 1 - /curated-albums/ 1 - /beckenham/whitstable290105.html 3 - /w.php 1 - /assets/uploads/content/Alan_Julian_Hugo_Langton_and_Rob.jpg 1 - /.well-known/inc/ 1 - /class-wp-customize-date-time-control-core.php 1 - /wp-includes/blocks/page-list/index.php 1 - /wp-admin/css/colors/modern/index.php 1 - /SHOP 2 - /ht@coht@co/index.php 1 - /fox.php 3 - /gh.php 2 - /network.php 3 - /fpo-chiangrai/web2/wp-content/themes/seotheme/ 1 - /wp-includes/js/codemirror/ 2 - /BDKR28.php 1 - /down.php 2 - /dede_admindede_admin/admin.asp 1 - /wp-plain.php 1 www.google.com /template.php 1 - /wp-content/uploads/elementor/css/class_api.php 1 - /wp-content/themes/mero-megazines/ 1 - /co_dedeco_dede/login.asp 1 - /../othernews/fatrophy4thround.html 1 - /../../kentleague/maidstone/5thnov04.html 1 - /mambo/index.php-option=com_content&task=view&id=3288&Itemid=38 1 - /wp-content/uploads/%20%20%20%20 1 - /logg-inn-eller-registrering/ 1 - /account-sign-in/ 1 - /options-discussion.php 2 - /tunbridgewells/7thoct05.html 4 - /wp-includes/js/codemirror/index.php 1 - /co_managerco_manager/admin.asp 1 - /accountaccount/login.php 1 - /co@guanlico@guanli/login.php 1 - /cgi-bin/ 2 - /wp-admin/user/ 2 - /wp-content/plugins/ubh/ 2 - //wp-includes/wp-class.php 1 - /lv/ 1 - /fxp.php 1 - /co12co12/index.php 1 - /dev/.env 1 - /new.php 2 - /mailto:stephen@kentishfootball.co.uk 1 - /Www 2 - /wp-admin/css/colors/ectoplasm/ 2 - /wp-content/uploads/2018/12/ 1 - /assets/uploads/content/Gary_Lockyer_Glebe_Elmstead_30_O.jpg 1 - /erithtown/1stdec05.html 4 - /lyscide403.php 1 - /wp-includes/css/dist/editor/ 1 - /sevenoaks/sladegreen221105.html 7 - /dede/admindede/admin/admin.php 1 - /radio.php 7 www.google.com /0x.php 1 - /kentleague/cray/chatham081204.html 3 - /godsend.php 2 - /foxx.php 1 - /sladegreen/sladevwhitstable111003.html 4 - /idx/details/listing/a012/5665920/ 1 - /wp-content/plugins/upspy/up.php 1 - /sevenoaks/tunwells170804.html 6 - /tunbridgewells/maidstone211205.html 3 - /public_html/about2.php 1 - /ioxi2.php 1 - /shop/wp-includes/wlwmanifest.xml 17 - /data.php 1 - /wp-inst.php 1 - /manutencao/ 1 - /lfix.php 1 - /mar.php 3 - /wp-content/uploads/2023/ 2 - /ssl.php 1 - /header-large-dark.php 1 - /templates/protostar/error.php 1 - /commenth.php 1 - /sladegreen/greenwich130805.html 4 - /ccx/ 1 - /folkestone/tonbridge151105.html 3 http://kentishfootball.co.uk/news/551a99e5203dd /xinfo.php 1 - /wines/80/domaine-de-pellehaut-harmonie-de-gascogne-rouge-2014 1 - /public_html/install.php 1 - /mambo/images/M_images/printButton.png 3 - /../../kentleague/whitstable/1stdec05.html 1 - /adminer-4.3.1.php 1 - /ashford/folkestone110805.html 2 http://kentishfootball.co.uk/news/551a97992f193 /403ws.php 1 - /images/news/ 1 - /tunbridgewells/hythe090305.html 5 - /01.php 1 - /poupon/ 1 - /co9999co9999/login.asp 1 - /TEST 2 - /social/ 1 - /co9999co9999/index.asp 1 - /admin.asp 1 - /feed/ 12 - /wso2.7.php 1 - /beckenham/whitres040904.html 3 - /../premier/dover/dartford151005.html 1 - /apple-touch-icon-precomposed.png 108 - /wp-admin/images/xmrlpc.php 3 - /lu.php 1 - /wp-admin/includes/install.php 1 - /kaunieape.php 1 - /45.php 1 - /tiny.php 1 - /wines/43/ortas-les-viguiers-2013-blanc 2 - /public_html/moon1.php 1 - /DesktopModules/Admin/RadEditorProvider/DialogHandler.aspx 2 - /en/powered-by-enerkey/ 1 - /tunbridgewells/whitstable140804A.html 3 - /wp-content/plugins/wpeazvp/ 2 - /BLOG 2 - /mambo/index.php-option=com_content&task=view&id=5965&Itemid=38 1 - /test/wpadmin/ 1 - /co_dedeco_dede/admin.asp 1 - /co@adminco@admin/login.php 1 - /lock.php 1 - /wp-pluging.php 1 - /wp-includes/blocks/verse/index.php 1 - /ZszSXRlE.php 1 - /todo.php 1 - /bcgvss.php 1 - /administrator/templates/hathor/error.php 1 - /xxxxxminoksxxxx2021.php 2 - /locations/anaheim-west/ 1 - /-block.php 1 - /wp-includes/Requests/Transport/ 1 - /ht@coht@co/admin.php 1 - /my_alfa.php 1 - /wp-content/themes/rishi/ 2 - /pop.php 1 - /lol.php 1 - /wp-content/plugins/random/ 2 - /wp-admin/css/colors/index.php 2 - /wp-y4y54.php 1 - /xhr6.php 1 - /shv3n0m.php 1 - /houtai@cohoutai@co/admin.php 1 - /gifshell.php 1 - /admin/images/slider/ 2 - /admin/assets/plugins/plupload/examples/upload.php 1 - /wp-includes/js/crop/ 1 - /tonbridge/ashford170905.html 3 - /houtai_cohoutai_co/admin.php 1 - /wp-includes/ID3/license.txt 11 - /wines/292/saliza-amaretto-veneziano-70cl 1 - /images/images/ 1 - /phpinfo.php 3 - /xtftastpsi.php 1 - /blog/fw.php 2 - /administrator/templates/bluestork/error.php 1 - /dartford/28thapr04.html 4 - /wp-content/themes/ 2 - /addcrop.php 1 - /wp-site.php 2 - /public_html/cloud.php 1 - /m4r1ju4n4.php 1 - /edit-tag-form.php 2 - /webshell.php 1 - /folkestone/folkvtonb160304.html 5 - /lyda.php 1 - /lordswood/sevenoaks291005.html 4 - /init.php 1 - //wordpress/wp-admin/setup-config.php 2 www.google.com /wines/170/canapi-nero-davola-2012 1 - /wp-content/plugins/ubh/index.php 1 - /sundax.Php 1 - /admin-filters.php 1 - /wines/122/percheron-grenache-gris-ros-2013 1 - /sftp-config.json 4 - /admincoadminco/index.php 1 - /_.php 2 - /wp-admin/css/colors/coffee/index.php 4 - /administratoradministrator/index.asp 1 - /dxshell.php 1 - /premier/dover/10thdec05.html 4 - /wines/212/philip-shaws-the-architect-chardonnay-2012 1 - /Blog 2 - /apache.php 1 - /co123456co123456/index.asp 1 - /wp-admin/network/cloud.php 3 - /wines/10/chateau-rivensan-2011 1 - /lordswood/hernebay160205.html 4 - /dist/images/mask/guide/cn/step1.jpg 2 - /dede/dededede/dede/index.asp 1 - /the-wealthy-spirit/ 1 - /cekidot/ 2 - /wordpress32.php 1 - /.well-known/wso112233.php 2 - /corootcoroot/index.asp 1 - /wines/7/chateau-perron-lalande-de-pomerol-2010 1 - /othernews/Tables261004.html 1 - /mambo/images/stories/paul%20doswell%20lashes%20out%20at%20anthony%20storey.jpg 1 - /wp-includes/Requests/Response/index.php 1 - /ehnddglsoa.php 1 - /wp-includes/ID3/wp-conflg.php.suspected 2 - /RxR.php 1 - /maidstone/maidvwhit170204.html 3 - /wp/wp-admin/network/ 1 - /chosen.php 2 - /glcoglco/admin.php 1 - /wines/287/anno-elderflower-vodka-70cl 1 - /VintageWeb/home/inicio/ 1 - /kentleague/ramsgate/deres160705.html 3 - /codeboy1877x.php 1 - /modules/modules/ 1 - /aclass.api.php 1 - /authorize.php 1 - /wp-includes/blocks/table/int/tmpl/ 1 - /othernews/crayvalley290105.html 1 - /wp-admin/user/index.php 1 - /dede12dede12/login.php 1 - /modules/ 2 - /wines/72/laurent-miquel-cabernet-syrah-2013 1 - /wp-includes/css/dist/components/ 1 - /.well-known/pki-validation/x.php 2 - /cache-compat.php 5 - /Tjdr7r.php 1 - /co_rootco_root/index.asp 1 - /ryman/bromley/ashford151005.html 4 - /ashford/ashvsitt240204.html 4 - /premier/dover/22jan04.html 4 - /mc4wp-debug-log.php 1 - /wp-admin/maint/maint/ajax-actions.php 3 - /Copyright-meta.php 1 - /wp-readindex.php 1 - /dede12dede12/index.php 1 - /wp-includes/css/dist/widgets/index.php 1 - /add-membre.php 1 - /co666co666/login.php 1 - /co999co999/login.php 1 - /date.php7 1 - /motorji/ 1 - /.well-known/acme-challenge/class_api.php 5 - /wines/53/chateau-du-coing-de-st-fiace-muscadet-sur-lie-2011 1 - /wines/124/franschhoek-statue-de-femme-sauvingon-blanc-2014 1 - /px9nis.php 1 - /cray/crayvdeal200304.html 4 - //wp-content/plugins/ccx/index.php 1 - /ebs.php7 3 - /bak 2 - /.env 37 - /wp-includes/blocks/post-featured-image/index.php 1 - /images/dir/ 1 - /en/home/ 1 - /w3.php 1 - /corootcoroot/login.asp 1 - /thamesmead/thamvslad210204.html 5 - /adminer-4.6.1.php 1 - /wp-includes/Requests/Exception/index.php 1 - /rdv-holi.php 1 - /assets/jquery/ 1 - /co1111co1111/admin.php 1 - /wp-content/themes/twenty/ 1 - //wp-admin/setup-config.php 3 - /async-upload.php 2 - /mambo/index.php 1630 - /co258co258/login.asp 1 - /cohtcoht/index.php 1 - /VCD/22ndsept05.html 4 - /../../ryman/bromley/15thnov05.html 1 - /wines/82/domaine-de-la-pellehaut-ampelomeryx-2012 1 - /public_html/upfile.php 1 - /xindex.php 1 - /class-wp-block-styles-registry-private.php 1 - /co@guanlico@guanli/login.asp 1 - /Public/ 1 - /wines/103/emiliana-carmenere-2012 1 - /wines/147/ramon-bilbao-crianza-2011 2 - /glcoglco/login.asp 1 - /wp-includes/css/ 2 - /folkestone/tonbridge070904.html 4 http://kentishfootball.co.uk/news/551a99e5203dd /pi.php 1 - /ex0shell.php 1 - /wso112233.php 3 - /wp-content/themes/nuance/functions/jwpanel/scripts/valums_uploader/php.php 1 - /managemanage/index.asp 1 - /ht_coht_co/admin.php 1 - /dede_admindede_admin/login.asp 1 - /othernews/humantablefootballA.html 1 - /.well-known/pki-validation/about2.php 1 - /wines/58/turckheim-reserve-gewurztraminer-2012 1 - /wp-includes/css/dist/customize-widgets/index.php 1 - /Uploading.php 1 - /r57.php 1 - /lordswood/lordsvcray251003.html 4 - /gecko.php 2 - /upload/image/ 2 - /kentleague/maidstone/maidvfolk171203.html 3 - /lordswood/lordsvgreen280204.html 5 - /class-snoopye_wso.php 1 - /useruser/index.php 1 - /guanliguanli/admin.php 1 - /managemanage/login.asp 1 - /apple-touch-icon-152x152.png 117 - /erith&belvedere/fisher190205.html 4 - /blkbefqor.php 1 - /coglcogl/index.php 1 - /media/wp-includes/wlwmanifest.xml 3 - /shankar.php 1 - /userfuns.php 2 - /1script.php 1 - /roofing/ 1 - /class-wp-smtp-bar.php 1 - /wines/32/macon-blanc-terres-secretes-2011 1 - /F0x.php 1 - /wp-includes/blocks/site-logo/index.php 1 - /wines/277/michel-girard-sancerre-ros-2013 1 - /templates/system/index.php 1 - /dede/admindede/admin/login.php 1 - /sitemap.txt 11 - /platform/.env 1 - /ok.php 4 - /public/assets/plupload/examples/upload.php 1 - /dede_admindede_admin/index.php 1 - /alpha.php 2 - /wp-includes/blocks/column/index.php 1 - /../premier/dover/22jan04.html 1 - /ryman/bromley/21stapr05.html 2 - /wp-content/plugins/instabuilder2/cache/plugins/ 1 - /nl/hp/ 1 - /images/matr_imgs/ 1 - /pushy.php 1 - END_SIDER_404 # Host - Pages - Hits - Bandwidth - Last visit date - [Start date of last visit] - [Last page of last visit] # [Start date of last visit] and [Last page of last visit] are saved only if session is not finished # The 25 first Hits must be first (order not required for others) BEGIN_VISITOR 2895 54.212.73.189 9538 9538 169926506 20231231073202 18.237.172.242 8398 8399 102760794 20231224182251 193.183.0.162 3734 3734 17905011 20231212202714 54.191.236.97 1593 1593 30167695 20231230040634 34.221.88.169 1077 1077 20293466 20231229140911 163.5.108.50 885 888 15480902 20231214182336 47.76.35.19 814 814 5933477 20231210195433 18.232.69.15 336 404 10354632 20231229121552 44.192.58.20 331 395 9854986 20231215153233 54.242.13.45 327 395 9797576 20231202191118 34.219.181.98 286 286 4861418 20231230032744 86.145.244.49 268 286 2068285 20231231231625 77.101.180.229 256 467 43409218 20231231133429 128.199.129.239 221 221 0 20231227145008 77.102.97.62 205 1870 403651934 20231231221920 54.201.139.0 192 192 3361065 20231229145503 82.26.170.34 170 227 1827985 20231231155520 64.62.202.84 170 170 813467 20231219121613 86.180.230.243 160 176 1275247 20231211210734 77.98.124.213 129 176 1527351 20231231214922 90.220.61.219 125 614 103484743 20231231225607 37.187.73.138 122 122 12095009 20231226235336 90.208.188.226 111 197 233330863 20231231190836 86.173.242.51 108 135 727149 20231231182902 64.62.202.81 103 103 474645 20231218081017 84.71.95.150 5 28 5169699 20231218102550 43.128.102.74 2 2 7440 20231214231813 172.174.172.69 1 1 3620 20231221080324 193.188.21.49 84 84 707808 20231230041935 78.133.163.190 1 1 12131 20231225204848 216.213.28.162 0 1 921 178.168.114.40 8 8 71475 20231226060742 40.94.100.72 0 1 568 36.110.131.128 0 1 10161 142.111.239.205 2 2 7986 20231211123349 2.126.245.179 30 38 310178 20231228145014 146.90.143.247 3 36 9975949 20231216123514 202.239.4.107 0 1 8613 82.34.34.133 1 18 5031635 20231209232633 103.36.8.146 1 1 12131 20231208163712 77.107.130.198 1 12 73004 20231213102226 192.42.116.13 1 1 3720 20231215063347 196.19.249.139 1 1 2947 20231217010732 85.255.234.142 2 26 9954438 20231212072019 185.220.101.30 6 6 82195 20231201234102 31.94.66.103 1 1 3820 20231205090647 86.147.219.119 44 74 426346 20231231152148 85.255.234.51 1 24 5158035 20231203082921 51.198.124.131 2 23 408216 20231205164042 90.214.168.116 39 87 5707247 20231230234658 3.15.6.235 1 1 3243 20231217215637 18.236.230.40 0 1 4831838 82.31.115.24 1 18 5034002 20231225124453 109.158.166.31 4 15 294208 20231203210433 81.135.60.39 1 19 5031616 20231227195354 185.5.250.24 3 3 25979 20231230135719 78.105.107.182 7 24 5060750 20231209082926 81.87.12.68 6 75 15358291 20231217234327 82.152.172.138 9 101 20469906 20231211115543 81.101.216.217 2 25 5114621 20231226164328 2.126.244.69 30 72 920351 20231231214704 35.210.151.25 1 1 3708 20231203041801 111.20.31.245 4 4 14571 20231231024636 193.118.51.130 1 1 3666 20231204052324 86.136.163.185 4 20 4944979 20231225215716 64.253.44.148 2 2 18610 20231211135251 199.45.155.32 1 1 3608 20231221213256 156.246.11.140 0 1 10418 193.70.55.169 1 1 3887 20231212111942 104.167.0.16 0 1 165214 193.160.246.72 1 4 47551 20231220090816 104.143.227.231 0 1 165214 82.132.219.182 2 7 4982346 20231230173252 14.137.135.243 0 1 11096 154.12.102.132 0 1 165214 139.180.211.63 1 6 138569 20231202180243 82.132.245.116 1 1 3785 20231204125824 51.183.185.58 2 21 215321 20231230141648 138.229.104.24 0 1 654 157.230.241.242 0 4 136315 194.207.4.186 2 29 10241902 20231208075912 78.162.149.154 2 11 105593 20231212034951 123.125.244.69 4 4 14571 20231231025020 2.221.110.125 16 172 50098927 20231230195621 202.239.4.58 1 1 4200 20231212012955 217.179.38.49 1 4 25370 20231204080924 2.126.152.173 1 20 5076168 20231229221233 188.241.83.178 1 18 5031513 20231208141421 62.49.62.221 2 25 5189416 20231208192752 104.28.30.105 1 12 76792 20231227065253 104.28.86.117 5 13 91715 20231230210251 31.94.38.141 1 1 7389 20231226112930 31.126.108.18 70 140 11004501 20231217074128 66.102.7.196 0 1 244872 172.226.114.29 1 8 154458 20231202141950 202.239.5.11 0 1 7736 82.132.217.132 1 3 24821 20231201092448 54.70.74.232 0 1 244872 81.129.189.234 17 17 140437 20231224212841 188.124.230.43 2 2 12208 20231206075223 169.255.115.99 3 3 10569 20231213162335 103.60.214.18 1 1 12131 20231206143546 86.157.8.21 1 24 5073844 20231231140307 94.247.172.129 1 1 3713 20231213040434 120.21.139.154 2 25 5110872 20231225092003 202.239.5.70 0 1 6415 188.247.108.149 2 2 12208 20231222184924 104.143.227.34 0 1 165214 82.132.227.170 1 11 182560 20231220022144 52.56.62.195 0 3 53260 188.74.210.28 0 1 14993 148.252.140.128 2 25 5132312 20231225191037 8.222.191.204 1 1 3191 20231220151738 139.180.136.117 0 7 5057492 101.44.250.217 0 1 12838 90.250.136.241 3 22 5084174 20231231095038 31.94.5.155 1 20 5077288 20231216071603 31.13.127.6 0 1 22295 46.23.98.14 2 2 21905 20231206093546 93.124.103.232 9 9 79447 20231221134523 148.252.133.110 4 9 210401 20231218111646 31.94.67.83 1 1 3260 20231204125757 185.220.101.8 2 2 12208 20231222225857 81.158.111.251 5 24 19755235 20231226133348 92.40.169.156 3 49 10175161 20231214101135 45.154.138.227 1 1 70 20231203113206 34.139.153.133 0 1 6665 192.42.116.180 1 1 0 20231223062608 112.64.213.32 4 4 14571 20231231024846 3.16.90.84 1 1 7076 20231213025249 213.123.220.29 10 58 10302659 20231226223733 198.235.24.115 1 1 14473 20231212101058 159.223.79.131 0 4 118716 82.132.226.164 2 2 7586 20231202085440 86.170.119.49 1 13 254169 20231208120229 64.137.112.184 0 1 165214 86.179.74.51 1 18 5031064 20231201131727 202.239.5.217 1 1 3765 20231205112753 31.94.5.119 2 10 128717 20231209110533 82.132.225.2 4 4 31971 20231212142127 114.111.32.211 1 1 4373 20231230222455 104.28.89.58 3 6 12822 20231228135250 31.94.60.57 1 3 5378 20231229152842 31.94.56.212 0 4 111035 124.220.24.137 3 3 11007 20231223012334 13.41.55.255 2 25 5166334 20231204202947 86.14.80.196 2 25 5184132 20231206052406 52.203.81.215 1 1 2975 20231222091124 35.231.204.230 0 1 10279 85.190.14.34 1 1 14670 20231202054656 81.108.180.6 1 24 5082000 20231214182540 34.74.232.228 0 1 244872 82.132.228.48 2 24 5098967 20231217125353 18.117.222.220 1 1 3488 20231220184510 5.161.225.231 1 1 8336 20231222033421 94.1.240.33 1 13 144943 20231230063257 109.170.219.52 0 1 244872 151.229.181.120 12 68 5785734 20231227131505 112.91.123.209 1 1 13893 20231221094436 90.200.202.19 16 180 35975841 20231227104742 31.94.26.135 1 18 5031513 20231208150506 72.37.216.68 1 1 12131 20231226195732 81.104.104.253 13 72 10271282 20231226093041 172.224.227.30 1 17 5029760 20231209124919 52.56.62.219 1 7 172622 20231228101444 2.216.189.123 1 18 5030726 20231204075744 206.189.146.223 0 4 4834114 31.94.67.140 2 2 18840 20231212120501 192.0.113.20 0 1 204600 149.241.226.221 11 172 36076881 20231213185704 31.94.26.6 1 1 3769 20231214185712 18.232.51.88 1 1 2690 20231221021003 5.42.65.19 4 4 43810 20231228210413 3.134.89.59 58 58 285115 20231208230651 104.167.0.140 0 1 100391 86.14.137.87 77 117 886310 20231231091615 8.222.186.200 1 1 2522 20231227172113 52.114.77.26 0 1 244872 178.32.88.96 1 1 3650 20231214112614 36.68.223.206 1 1 3578 20231228025904 34.215.171.2 11 11 319194 20231227184321 104.28.40.114 1 24 5158108 20231205120755 115.74.156.35 1 1 12131 20231215234820 86.9.114.178 65 921 189721035 20231231232817 20.108.254.77 1 24 5107180 20231228184525 92.40.168.243 1 15 115340 20231220203250 82.132.218.176 4 27 5154294 20231217202825 18.217.234.73 1 1 3210 20231216220439 66.249.84.66 0 1 244872 187.191.19.204 10 16 83840 20231228172457 5.188.62.21 4 4 14717 20231227092748 165.225.17.188 3 7 122805 20231218100014 195.171.115.10 2 25 5184507 20231208115126 86.169.224.124 5 49 5636582 20231226222701 114.111.32.84 0 1 10888 208.80.154.75 2 2 7114 20231218142629 31.94.5.13 2 2 7532 20231208104300 69.58.64.34 0 1 20214 86.151.185.177 4 16 328187 20231217225117 185.201.140.180 0 1 165214 185.95.199.103 2 2 24262 20231206131029 36.110.131.30 0 1 27646 165.225.17.8 3 7 65853 20231213130542 81.104.200.140 10 62 15177699 20231209174634 149.20.243.10 0 1 6415 94.6.95.80 2 25 5085996 20231231085404 207.154.240.61 1 1 3583 20231227183646 148.252.132.249 1 12 9872032 20231220160845 209.97.136.240 5 5 19927 20231208195414 114.111.32.93 0 1 568 66.84.88.147 1 1 10784 20231215061747 91.209.212.39 3 11 138532 20231204192419 23.236.204.19 0 1 568 86.182.22.101 2 25 5093105 20231213133914 162.247.73.192 10 10 119953 20231201234052 138.199.21.199 2 25 5083683 20231230181348 18.117.234.128 2 2 7586 20231217014747 104.28.86.86 1 1 3616 20231217185231 63.35.24.181 21 44 5267092 20231204114425 85.208.98.17 1 1 3368 20231210155343 24.235.12.20 0 1 20214 148.252.133.241 1 1 15253 20231219174511 86.60.55.66 1 4 11680 20231216072320 31.94.24.230 1 18 5068129 20231217012103 3.8.152.231 1 1 14608 20231205113634 146.75.168.39 0 10 4879765 69.58.12.53 2 2 6660 20231214152919 36.110.131.104 0 2 17441 94.1.243.237 51 79 761169 20231226195319 94.2.13.195 1 18 5030718 20231229024806 134.209.111.9 1 5 138283 20231208215713 3.238.225.105 10 50 255923 20231223203756 31.94.64.11 5 11 169381 20231208142503 38.152.65.20 0 1 568 104.28.89.22 21 25 4950773 20231229110323 77.76.78.66 3 26 5192827 20231207144213 175.203.138.160 3 3 24339 20231206174543 82.4.39.122 1 18 5030033 20231204230420 51.7.195.74 1 2 248557 20231212113419 54.202.131.245 2 2 23460 20231224172307 172.225.189.94 1 18 5036089 20231212113100 81.106.107.151 3 11 169374 20231226195318 52.71.112.69 1 5 107243 20231229020326 114.111.32.178 1 1 4450 20231230163910 84.33.213.25 0 1 100391 120.21.199.31 3 25 142575 20231216065723 143.198.87.146 0 5 46615 116.162.14.93 4 4 14571 20231231024817 92.40.216.59 2 2 14818 20231213161044 51.183.2.9 2 25 5130664 20231212112655 18.224.62.159 1 1 11204 20231214180433 195.245.162.114 2 25 5085996 20231231095557 82.132.227.234 1 1 3635 20231224201609 80.1.222.140 1 18 5031513 20231208145221 154.47.97.120 0 4 111035 51.182.164.201 4 49 10228983 20231221162636 104.28.30.145 1 18 5036059 20231213225018 80.4.56.1 4 29 9904163 20231214152237 104.232.227.248 0 1 12838 85.250.66.56 3 3 9482 20231210212738 92.40.169.155 1 20 4957849 20231214135246 92.40.218.226 1 2 4835523 20231212124158 66.85.72.98 1 1 0 20231231190033 180.253.81.70 2 2 6325 20231205081526 64.137.91.205 0 1 165214 82.132.235.151 2 12 171063 20231230192036 82.132.184.248 1 1 3726 20231212104435 51.241.65.207 36 76 497598 20231231084958 47.89.245.8 1 1 13663 20231202191829 151.192.55.26 0 1 100391 165.120.90.227 1 15 330551 20231209090606 107.178.236.8 1 1 3532 20231211001247 128.199.225.236 0 2 2051 183.136.225.44 1 1 13893 20231221153708 82.132.213.24 2 8 23345 20231215215825 86.128.19.64 4 8 164786 20231206175550 220.181.157.2 0 1 75586 154.12.103.110 0 1 32135 158.230.100.102 0 2 0 5.180.19.178 2 2 13046 20231223120928 31.94.14.208 4 24 14812809 20231204184334 207.148.125.99 1 8 27778 20231208205418 64.137.112.126 0 1 165214 149.20.244.172 0 1 13806 92.255.81.133 1 1 4526 20231214112607 103.160.201.28 1 1 12131 20231204153207 172.226.183.13 1 18 5031513 20231208203431 78.86.164.115 1 1 3635 20231226165346 137.184.186.161 1 3 116420 20231204112307 45.77.43.237 1 4 52662 20231208034522 86.17.92.179 2 24 5079213 20231214115956 86.133.190.35 2 13 198096 20231204181402 86.186.108.162 10 161 30894297 20231224225453 35.179.90.37 2 20 5152453 20231206183332 59.82.21.81 0 1 30620 8.222.207.173 1 1 4592 20231212144127 8.218.80.185 1 1 2947 20231208210103 213.219.247.144 72 72 608811 20231230055904 79.77.200.125 7 50 10262023 20231204124339 123.6.49.47 0 4 3429 85.255.233.98 4 7 65078 20231221084047 51.190.48.168 8 31 5240641 20231209125216 31.94.36.62 1 3 109725 20231203193835 92.19.98.149 1 24 5081872 20231212211017 104.167.0.67 0 1 100391 45.139.0.28 1 1 3887 20231212111941 82.132.231.26 2 2 7646 20231205175400 92.9.28.80 4 27 5124229 20231201160708 31.94.38.33 1 1 5019 20231210140235 63.149.19.231 29 162 44872706 20231219171612 217.115.34.254 1 1 7778 20231204125145 104.28.40.142 3 44 10113790 20231231133248 65.154.226.167 1 1 3578 20231225111643 54.236.99.111 1 1 4891 20231221145024 82.132.236.234 1 20 5062334 20231204124945 110.93.150.125 1 1 4266 20231229170717 50.18.94.33 1 8 29018 20231222061517 195.138.65.34 3 3 24339 20231216181854 213.219.247.125 60 60 507318 20231230044021 165.232.175.83 0 2 7910 92.9.26.209 1 24 5107237 20231226182044 139.180.214.148 0 5 4921413 34.23.195.244 0 1 32718 85.255.233.157 2 25 5235279 20231207071122 104.28.86.113 3 4 11787 20231208074234 110.93.150.200 0 1 921 64.137.91.102 0 1 28267 54.70.53.60 1 24 5117836 20231211091127 87.115.243.213 21 67 35004435 20231217085318 18.210.113.192 0 3 52354 103.102.228.241 5 5 31817 20231220234909 36.110.131.64 0 2 328072 34.138.108.36 0 2 19746 95.152.63.118 2 2 27547 20231205103154 213.244.248.49 0 1 10999 86.128.38.34 0 1 244872 149.28.144.67 0 3 30783 31.166.43.229 2 9 4903076 20231208200452 90.221.16.165 1 20 5062334 20231218222431 185.253.42.252 2 2 12208 20231211163501 36.110.131.0 0 1 52085 82.132.226.98 1 1 3663 20231222065737 128.199.220.109 0 6 4945367 51.89.222.91 1 1 3707 20231213164801 82.132.227.77 2 4 38288 20231214073434 86.169.154.200 56 265 75794329 20231218171221 188.74.183.206 0 1 155435 81.110.56.89 5 29 319428 20231209144529 193.160.246.32 2 4 113334 20231204094543 5.42.65.94 2 2 21905 20231213165118 195.123.228.18 5 5 38063 20231220134220 86.134.5.41 25 32 236939 20231210142511 1.179.147.5 1 1 12131 20231206030252 129.153.21.144 0 5 132571 40.94.100.28 0 12 5059470 143.198.87.216 0 4 4857075 128.199.220.124 1 6 22343 20231208161519 176.106.34.47 2 2 12208 20231206212256 36.110.131.118 0 1 244872 185.253.42.214 2 2 12208 20231203195607 128.199.220.97 0 4 24786 31.94.56.25 0 4 1783 144.217.74.133 1 1 11738 20231215093100 154.13.10.142 0 1 165214 84.68.181.46 14 65 10411728 20231213200427 212.139.175.127 35 49 326344 20231220112412 40.94.28.23 0 2 112532 174.136.57.129 2 2 12208 20231216012757 5.161.216.157 1 1 4662 20231231133311 92.40.168.12 6 10 14628817 20231215222725 92.40.168.14 1 9 5017026 20231214152148 92.118.61.195 1 1 3669 20231223095113 185.221.32.184 5 5 37385 20231227165715 3.89.117.73 1 1 3666 20231204012608 34.204.167.240 1 1 2939 20231221081359 46.69.71.232 2 19 5036357 20231208224652 199.45.154.18 1 1 3438 20231223184157 193.178.169.153 2 2 12208 20231213065058 31.94.19.179 1 18 5031513 20231208204415 8.222.155.52 1 1 4329 20231212152948 82.132.225.118 1 1 10853 20231222090418 78.144.79.74 4 38 10073406 20231209083851 208.91.66.245 2 2 0 20231201205604 66.220.149.19 0 1 244872 149.28.151.231 1 7 4896968 20231203132314 31.94.6.107 2 2 7069 20231217215945 185.69.144.86 2 2 14808 20231213115914 92.40.214.1 0 8 44411 192.42.116.202 1 1 12131 20231225153318 92.207.253.226 2 2 13046 20231216114457 198.105.103.18 0 1 165214 92.40.181.135 1 6 5081348 20231204233629 146.70.111.146 4 4 26023 20231210102541 20.198.219.95 2 2 27924 20231215021240 64.137.112.219 0 1 165214 64.137.91.63 0 1 28267 131.153.240.10 13 13 47919 20231221045722 173.252.111.118 0 1 244872 78.32.12.146 1 24 5082007 20231215124735 82.11.252.183 1 18 5031513 20231208151245 172.224.227.29 1 24 5107341 20231221221138 173.252.95.10 0 1 23014 78.144.100.1 2 2 12208 20231215213910 92.40.170.155 1 1 3635 20231227232303 222.138.76.6 2 2 12208 20231227192249 8.218.87.55 3 3 11453 20231208210101 31.94.26.62 1 18 5034747 20231223130347 85.214.154.176 3 3 0 20231220054140 104.236.70.59 1 1 3608 20231222002954 35.231.33.166 0 1 244872 104.28.89.23 24 51 5165658 20231231172748 82.132.232.167 3 4 29097 20231211080418 31.94.14.139 2 6 123087 20231210122728 110.93.150.161 0 1 921 139.180.140.122 0 4 40055 31.94.67.210 2 2 7352 20231213213235 143.198.215.53 0 2 33072 31.94.24.169 1 1 3766 20231207151142 103.121.39.158 2 2 12208 20231216000649 31.94.7.93 1 8 12057 20231214160205 139.180.189.18 0 2 28710 78.86.128.255 1 5 94572 20231230010806 143.198.201.39 0 1 4831838 172.226.183.6 2 25 5129104 20231230084440 31.94.12.18 3 27 5147669 20231223173121 8.222.179.80 2 2 12208 20231218052801 178.157.102.16 0 1 32135 185.220.101.9 18 18 316295 20231201234133 2.31.44.75 1 24 5134954 20231218233918 139.180.189.119 0 1 1286 220.64.102.4 1 1 3246 20231203184922 185.192.69.141 2 2 3720 20231215091301 52.203.125.106 1 1 2939 20231222062141 220.64.102.2 1 1 4146 20231203184927 5.35.33.3 4 4 34113 20231228054034 34.73.225.172 1 24 5112671 20231217102351 85.255.235.166 1 3 46862 20231223162901 84.33.21.135 0 1 165222 77.99.180.49 81 323 56388507 20231231185546 86.136.236.92 1 18 5031513 20231208203617 86.188.87.207 6 29 5300378 20231231193331 36.110.131.24 0 1 22295 31.94.38.61 1 1 3663 20231222204943 3.236.143.25 1 1 3010 20231220162458 195.89.130.173 3 3 22694 20231209185038 202.239.4.137 0 1 6415 104.28.30.150 0 4 16360 152.228.243.166 1 1 4489 20231225070823 199.45.154.50 1 1 3708 20231203070442 149.102.232.109 2 2 12202 20231208204341 148.252.141.28 8 54 10330540 20231219072025 106.51.78.106 1 1 3711 20231207100227 31.94.64.141 4 7 40217 20231202123704 31.94.26.218 2 9 46272 20231225235015 87.249.132.171 3 3 25843 20231211220602 82.6.18.182 50 139 5784328 20231231102221 213.1.30.176 5 47 14846854 20231213174445 45.32.117.179 0 3 4843269 185.190.42.200 3 3 27665 20231223001410 2.221.110.231 1 5 119472 20231205060835 107.150.59.122 4 4 25233 20231226230659 95.211.210.103 1 1 12131 20231211162431 51.89.22.139 1 1 0 20231214070133 64.137.112.28 0 1 32135 192.109.205.8 2 2 3673 20231230083454 91.232.110.73 3 3 24339 20231222052552 31.94.67.95 1 2 14434 20231220104829 94.6.118.0 1 20 5076330 20231230082444 82.132.217.128 2 2 7713 20231207105506 45.76.149.216 0 4 12700 46.148.206.226 9 9 72999 20231223223415 92.40.171.154 1 4 25136 20231223161857 92.40.218.190 3 12 5071446 20231224075504 159.224.217.252 12 12 73248 20231230195657 31.94.37.14 2 2 7356 20231201182726 86.177.194.154 1 9 5079959 20231229220739 152.44.98.168 0 1 654 52.56.62.211 0 1 10888 51.158.119.107 1 1 0 20231209152044 176.25.252.217 3 25 5107912 20231231084242 159.223.154.62 1 1 3669 20231212015345 86.161.198.90 4 52 10283038 20231221153154 45.76.150.68 0 1 4831838 86.166.46.215 21 29 364721 20231207150304 178.239.172.60 4 33 10049380 20231208164134 5.254.40.54 2 2 12202 20231224151252 82.132.224.38 1 1 12152 20231231091408 52.56.62.208 0 2 12063 31.94.38.211 1 1 3769 20231213152316 81.159.190.135 10 41 5162234 20231231222123 114.111.32.78 1 1 5660 20231211001144 85.255.236.157 18 57 15230002 20231229184852 31.94.71.172 1 15 3635 20231226214921 34.74.24.146 0 1 7650 31.94.66.202 1 22 5079307 20231221012318 82.132.224.75 5 22 5063559 20231209103015 86.9.174.208 2 11 134441 20231203161329 104.28.193.100 1 1 14019 20231203014013 104.28.86.84 1 22 5080812 20231213111421 27.156.196.13 1 1 12131 20231215224240 86.147.63.95 1 20 5057932 20231201155701 18.116.240.29 7 15 56899 20231207003301 176.116.21.100 1 23 5107052 20231225212921 82.25.62.14 2 4 51393 20231226194304 81.97.8.209 5 22 5050889 20231208215442 149.241.232.2 3 20 264613 20231203122015 91.125.12.118 1 7 54926 20231215103126 157.230.249.1 0 6 67619 66.102.9.38 0 1 244872 34.222.165.221 0 2 489744 82.17.65.24 2 21 5071331 20231209233241 82.132.219.179 1 1 3776 20231216091957 104.28.86.99 2 29 10043733 20231216093947 157.230.241.128 0 2 14507 148.252.128.240 4 27 5093134 20231216090723 193.188.20.66 60 60 507330 20231230051133 92.40.171.166 1 2 115094 20231219091227 146.199.94.127 1 20 5067931 20231203075817 84.33.213.158 0 1 165214 199.102.105.242 2 2 12208 20231215231940 192.126.236.161 1 1 2947 20231228102128 104.28.40.132 3 21 271279 20231224194439 41.223.234.116 1 1 12131 20231215224111 196.240.237.38 1 1 2947 20231231142915 152.228.228.164 1 1 4428 20231224022538 202.239.5.226 0 1 20214 5.133.198.74 1 1 3189 20231214122550 92.40.170.227 3 4 4846109 20231231111846 81.152.232.90 1 19 5267331 20231219103511 159.223.33.228 0 4 132950 103.118.47.74 2 2 13750 20231229172426 31.94.39.46 1 1 12713 20231217074529 45.77.253.75 0 6 40457 130.44.200.3 0 1 654 185.220.101.46 1 1 12131 20231222225853 131.96.255.1 0 1 12838 131.153.240.178 16 16 58839 20231222081845 94.0.108.22 1 18 5031513 20231208164319 192.171.84.85 1 1 8552 20231215042143 31.94.26.7 2 4 38288 20231213233540 149.28.132.162 0 1 13806 92.40.170.247 2 4 32493 20231220100413 119.63.195.220 0 2 17554 82.26.202.176 1 20 5127099 20231203142509 8.222.177.141 2 2 12208 20231222220751 145.224.65.66 7 37 10028797 20231206210759 27.115.124.109 0 1 654 37.214.5.131 2 2 12202 20231204075714 78.86.38.154 1 3 4946692 20231222102418 162.158.33.150 1 1 8543 20231221154708 82.132.226.198 3 3 18158 20231221080925 14.116.239.33 0 1 195900 185.172.128.116 1 1 12939 20231205101835 64.137.112.82 0 1 165214 94.103.80.181 2 2 12208 20231228211441 86.128.22.178 1 18 5030143 20231205024312 208.70.245.226 13 17 1201135 20231231125259 87.74.142.17 3 9 161943 20231207204400 64.137.91.62 0 1 100391 77.222.101.21 0 2 347646 192.71.126.249 1 1 3663 20231222012553 69.59.111.249 2 2 12208 20231216005132 31.94.5.84 1 6 55018 20231212194848 34.243.143.151 2 9 49930 20231218182117 152.58.114.82 2 2 12208 20231226173806 90.200.127.157 3 16 188356 20231204223623 52.56.62.231 0 2 12272 216.213.27.11 0 1 568 62.133.47.154 2 2 13025 20231209012000 80.195.231.90 3 20 5039992 20231228212505 5.161.56.235 1 1 3843 20231212121421 84.65.110.254 4 5 106048 20231204211049 27.115.124.38 0 2 1489 205.210.31.207 1 1 13643 20231216165830 109.152.242.67 3 43 10148486 20231227042158 3.254.77.207 12 12 47495 20231229205916 148.252.133.14 1 1 4367 20231205125728 84.71.83.185 6 31 5182584 20231222230430 40.94.100.39 0 1 654 92.40.214.226 1 1 11502 20231207121123 154.55.93.64 0 1 165214 39.173.107.227 0 1 20214 15.235.46.248 1 1 3231 20231227041617 90.221.36.220 3 19 5107137 20231202163632 195.234.109.68 0 1 244872 31.94.60.107 1 4 35721 20231230213333 89.241.86.22 1 24 5140811 20231210092827 84.9.88.67 4 29 5146753 20231221105728 192.121.157.111 1 1 3189 20231214122553 86.175.5.172 43 93 10523565 20231231083617 35.88.135.200 0 1 244872 194.35.122.145 2 5 39467 20231231104215 82.20.206.219 1 18 5032084 20231229101245 104.167.0.32 0 1 100391 86.141.71.86 4 42 19921082 20231231192209 3.147.27.20 1 1 3210 20231214205846 193.233.90.79 2 2 6933 20231204125253 86.129.239.248 27 180 55465409 20231230124529 110.93.150.85 1 1 8866 20231221003108 171.253.61.96 2 2 12208 20231215230209 82.132.234.37 2 15 5050539 20231208203132 31.94.37.166 2 6 134135 20231203032124 178.157.102.58 0 1 100391 94.14.205.90 72 179 40339470 20231231165645 31.94.26.57 5 45 800459 20231206132855 202.239.5.110 0 1 1286 101.44.249.187 0 1 14343 148.252.133.86 6 34 5264751 20231212174927 94.195.27.198 1 1 3793 20231202083503 5.133.198.217 1 1 3189 20231214122552 104.28.89.81 4 68 20072598 20231214135624 31.94.60.135 2 5 60619 20231220150321 82.132.224.150 4 7 5050519 20231206184648 57.128.164.235 3 3 23479 20231223132343 34.73.12.78 0 1 244872 86.142.104.220 1 3 18923 20231211191520 45.32.114.132 0 2 2149 8.222.167.197 1 1 3478 20231221211545 82.132.217.120 5 29 5247322 20231207013550 149.56.160.145 1 24 5117830 20231211210717 18.206.177.240 1 1 11809 20231203055923 199.45.154.19 1 1 3771 20231218015941 142.147.110.2 0 1 568 194.39.35.192 0 1 165214 82.132.215.18 2 2 7574 20231216142931 3.15.188.92 1 1 4218 20231214194256 81.146.20.186 4 25 19955723 20231223201607 154.12.99.190 0 1 100391 185.201.140.149 0 1 165214 89.22.234.3 56 56 474329 20231230055915 205.210.31.74 1 1 14463 20231212094033 92.43.87.34 1 1 3904 20231213164800 120.16.43.186 1 1 3612 20231202151912 5.227.198.150 1 1 12131 20231228144213 54.188.21.82 0 1 8613 191.101.92.247 1 1 2947 20231217011603 34.73.39.63 0 1 32718 31.94.7.180 2 21 9867516 20231213173817 185.69.144.147 3 26 5136555 20231225065339 35.89.212.51 1 1 9955 20231217003813 45.77.171.226 1 3 7068 20231210220414 164.90.205.35 1 1 13856 20231227013202 31.42.181.16 2 2 12208 20231226180815 82.132.225.12 1 2 26599 20231213015442 18.237.111.49 0 1 244872 86.165.15.171 46 69 663097 20231230104626 31.94.64.64 1 9 163063 20231227220408 165.231.133.108 1 1 14640 20231217035831 86.131.92.223 39 120 1244013 20231216095841 78.86.7.118 2 5 90432 20231218121224 199.250.222.202 2 2 12208 20231228125747 85.255.235.214 2 6 9053 20231228093756 147.78.5.112 2 26 9917663 20231214161255 193.188.21.238 44 44 372914 20231230055826 161.123.226.61 1 1 3650 20231213164812 95.143.190.169 3 3 26192 20231208162957 185.222.57.69 4 4 7416 20231203073604 172.96.80.245 0 1 1286 78.86.134.201 1 2 4835516 20231212145342 35.231.149.7 0 1 53689 199.244.88.219 1 1 3578 20231227021209 82.15.158.17 3 37 10067870 20231209150415 130.255.166.166 1 1 3591 20231231050550 51.255.225.228 1 1 4526 20231213164801 31.94.56.75 1 1 3907 20231219155756 149.28.17.229 0 1 4831838 104.28.86.106 2 49 15024937 20231208184701 86.159.175.95 25 108 20576181 20231220181333 98.96.169.179 3 26 5095418 20231212220244 31.94.37.205 1 1 4844 20231222071153 104.248.153.159 0 2 15301 82.132.226.190 1 1 3741 20231230132203 173.252.83.116 0 1 244872 44.213.63.89 1 1 3488 20231220211107 5.70.114.15 1 2 248538 20231204001930 31.173.81.9 2 2 12201 20231227202556 31.94.36.72 1 1 4844 20231208182026 92.40.218.187 2 2 7156 20231224080210 45.77.41.171 0 4 29675 109.157.69.169 8 47 39909949 20231227210526 82.132.214.127 1 3 3635 20231226211416 217.144.110.86 1 1 3654 20231229114145 77.99.188.99 2 25 5184452 20231207145906 212.77.220.109 1 5 4888652 20231214015928 3.137.147.1 1 1 4297 20231211074211 3.219.29.153 1 5 107418 20231202081803 31.94.57.68 1 3 24595 20231220142208 31.94.66.200 1 2 127277 20231221012546 104.248.74.65 1 1 0 20231217114524 82.132.224.113 1 18 5029929 20231204115537 41.0.60.22 2 2 6242 20231210112026 82.132.247.58 2 18 5087596 20231223145857 209.205.207.130 2 2 12208 20231216013852 139.180.228.57 0 1 654 52.56.62.198 0 2 42509 31.94.26.56 4 27 326099 20231204201254 104.28.30.136 1 15 277772 20231215173620 205.210.31.220 1 1 13439 20231209200930 178.157.102.60 0 1 211475 34.218.210.115 5 5 146966 20231216225356 104.28.89.65 0 1 20214 82.132.244.4 1 17 237006 20231216195719 44.210.107.95 1 1 2891 20231220160453 176.24.245.53 16 61 744453 20231216082659 45.77.36.12 0 4 4981 65.154.226.170 3 27 5127357 20231227013444 84.33.21.207 0 1 255655 194.35.122.140 1 3 36677 20231225140520 34.23.229.89 0 2 60814 208.113.186.110 2 2 12208 20231215235645 8.219.235.86 2 2 12208 20231227020750 60.188.9.90 0 1 921 176.59.168.168 2 2 13039 20231216104807 46.4.81.149 4 4 33432 20231215144038 172.59.212.221 2 4 51606 20231207051156 15.204.182.106 9 9 25389 20231218103756 89.240.128.57 7 10 14522541 20231229151846 195.168.91.238 1 1 12969 20231223112938 149.28.156.86 0 3 4124 149.56.160.169 12 12 246225 20231202102527 74.119.147.209 2 2 12208 20231211164725 202.239.4.139 1 1 3557 20231230164534 72.49.49.11 2 2 24262 20231225165043 31.94.64.156 1 1 15093 20231218154603 220.181.157.18 0 1 75586 8.222.189.117 1 1 3473 20231222000647 86.177.234.152 13 17 268098 20231203131423 82.26.166.11 2 31 10060700 20231212191216 172.226.0.4 1 1 4844 20231208143845 85.209.176.109 4 4 39798 20231210165856 64.137.64.149 0 1 155435 90.192.36.171 4 29 5205211 20231229013031 82.4.254.130 5 39 10077558 20231208211935 3.231.212.245 0 1 654 104.28.193.94 1 1 13536 20231209225631 185.201.140.105 0 1 165214 178.254.24.91 1 1 3578 20231228085911 91.196.223.215 1 3 109708 20231203083624 82.132.227.66 1 7 82250 20231221150835 38.107.87.140 3 3 10773 20231231082907 31.94.24.188 2 5 72166 20231220083935 34.139.21.116 0 1 9467 148.252.141.220 2 22 5120754 20231210133254 80.88.193.46 1 18 5029929 20231204121339 185.195.63.179 0 1 155435 90.199.113.148 1 20 5081590 20231205000333 57.128.29.178 2 2 12596 20231227190440 64.137.91.3 0 1 165214 78.86.5.67 1 2 36094 20231217160918 164.92.109.21 1 1 3566 20231230015427 82.132.232.19 2 2 7089 20231205105335 194.81.239.185 2 2 8179 20231213081818 216.173.73.253 0 1 155435 92.14.60.130 1 8 171579 20231229092227 167.172.81.85 0 3 2947 92.11.99.149 1 20 5121243 20231202175643 192.42.116.196 1 1 12954 20231230075144 51.148.116.219 9 32 5171287 20231217222942 172.81.112.106 0 1 6415 109.145.176.50 10 80 15603825 20231211125310 86.144.218.132 6 52 10271768 20231212131214 66.249.156.146 6 33 5311005 20231210130044 45.32.121.22 0 4 56352 84.9.88.52 1 20 5112498 20231204205809 86.129.102.235 1 18 5030571 20231204192444 140.205.196.90 0 1 10279 35.91.215.132 0 1 6665 92.16.243.176 1 20 5057876 20231201154554 101.44.250.230 0 1 8777 148.252.133.114 3 26 5168467 20231216160411 31.94.12.142 2 25 5152793 20231208141831 31.94.7.176 1 18 5031513 20231208195317 92.40.168.244 0 6 4987430 168.91.44.149 0 1 6415 104.222.186.32 0 1 117708 2.220.74.141 2 19 5036357 20231208214356 78.86.131.216 1 6 61018 20231202124729 60.188.9.93 0 1 1286 66.249.72.39 1 1 10942 20231212222225 86.7.93.111 2 2 11019 20231226155606 86.177.66.171 3 3 11220 20231204212652 85.255.235.47 1 17 5164 20231209140340 31.94.7.181 1 1 4844 20231213173909 88.218.149.78 0 1 165214 49.7.69.41 4 4 14571 20231231024920 193.38.235.158 60 60 507312 20231230055258 73.255.177.84 12 64 10444909 20231230043638 156.239.59.172 1 1 2947 20231211170703 176.124.223.175 2 2 13013 20231210094200 3.230.212.218 2 20 5032077 20231212040146 86.162.173.216 7 31 5140673 20231228101910 82.132.227.105 2 2 7208 20231202060506 137.184.191.169 0 3 24444 44.212.95.35 1 1 4819 20231221101057 147.161.167.92 2 4 47604 20231208125811 223.29.253.52 1 1 2947 20231201054721 148.252.132.45 5 15 5097061 20231212151343 79.77.194.37 2 25 5184632 20231207172958 2.126.45.111 3 37 10067870 20231208214234 8.222.168.177 2 2 12208 20231218111133 23.236.156.124 2 2 3024 20231231020433 199.15.238.73 4 36 89969 20231231090455 82.132.224.200 1 18 5031513 20231208142052 82.132.218.78 1 14 121897 20231222193717 172.96.87.2 0 1 6415 185.31.155.120 2 22 5166942 20231219122450 82.132.219.197 2 7 191769 20231221230202 36.110.131.134 0 1 24112 148.252.132.162 1 3 21246 20231226204335 178.128.212.26 1 3 24036 20231208205646 18.130.226.204 2 22 5106773 20231223092333 82.132.226.176 4 26 289783 20231228175836 84.68.169.114 1 21 4930127 20231227123915 45.77.162.220 6 6 49473 20231203132504 123.6.49.10 0 1 13806 143.198.215.68 0 3 22363 184.170.248.5 1 1 12131 20231206104650 176.251.114.190 1 18 5031471 20231201213456 149.241.227.71 77 121 5671856 20231231203234 27.76.194.231 1 1 12131 20231228123902 82.46.215.119 4 24 10182915 20231212173440 114.111.32.61 1 1 3488 20231220122656 38.107.85.198 3 3 10773 20231231081158 82.132.214.66 1 1 3658 20231221132709 128.90.154.17 2 2 12208 20231221010055 185.220.102.252 1 1 77 20231225153607 31.94.60.73 1 18 5031627 20231222221052 78.129.191.6 1 1 3711 20231207101413 92.40.216.195 2 2 15263 20231206143755 100.27.49.108 1 2 4683 20231221054853 138.128.151.25 0 1 165214 31.94.37.182 2 18 242304 20231201092038 154.95.34.28 0 2 265613 143.198.193.89 1 7 38033 20231210145301 82.132.185.64 2 25 5171137 20231203145505 31.94.57.36 2 16 5033810 20231226070229 172.226.0.48 1 1 3612 20231202184420 139.180.143.119 0 4 4845231 78.145.163.30 10 80 15452348 20231218065407 154.194.9.128 0 1 165214 31.13.127.116 0 7 4870395 111.207.155.211 2 2 28372 20231216225547 159.89.194.117 0 2 12850 38.98.194.9 2 2 12208 20231228212641 51.6.249.14 7 59 19980872 20231227125023 98.67.160.184 2 2 27950 20231215013906 43.143.60.88 2 2 7488 20231206193906 90.221.19.16 1 18 5033926 20231204194436 83.146.28.169 1 1 11039 20231213091607 92.40.170.143 3 3 13442 20231214165337 31.94.24.226 1 12 149336 20231216090137 178.128.63.195 0 10 207432 92.40.219.0 1 1 3768 20231218172206 154.38.35.82 0 1 100391 44.192.247.118 1 1 3035 20231222100914 62.31.104.42 2 12 91233 20231201152852 1.169.124.223 8 8 48832 20231206231719 51.79.77.186 1 1 4789 20231209164647 92.40.170.151 1 5 10023592 20231214171533 69.167.9.200 2 2 0 20231221093819 46.246.122.87 2 2 12208 20231215072025 31.13.127.8 0 1 10888 31.94.2.91 1 1 4844 20231209185539 64.137.64.85 0 1 255655 139.59.108.225 2 16 216112 20231228150852 64.137.64.243 0 1 165214 34.74.215.195 0 2 16263 85.255.232.114 1 18 5031915 20231223084252 77.97.170.192 2 25 5085996 20231231104706 154.202.127.237 2 2 6613 20231220181329 106.38.221.166 0 1 105436 35.237.127.38 0 1 10623 52.34.214.44 1 1 19878 20231216023142 148.252.140.222 1 4 36823 20231214174620 188.166.211.115 1 4 18089 20231210034644 82.132.235.187 2 18 5091438 20231220111324 104.28.89.57 1 2 3583 20231211213408 185.69.144.206 2 19 5057443 20231208150940 82.132.224.248 2 2 7528 20231203113503 86.189.236.99 1 20 5080888 20231231100614 94.25.169.228 3 3 24339 20231221205715 85.255.232.32 2 10 45558 20231213075122 194.36.97.217 1 1 3113 20231205102304 221.200.217.2 2 2 12208 20231215222206 62.255.218.18 5 14 364270 20231218152656 45.192.131.161 0 1 165214 8.219.200.156 1 1 3781 20231207025223 41.76.102.81 2 2 12208 20231215221723 92.40.169.163 1 1 3578 20231227065807 91.199.84.177 2 2 12208 20231228124913 31.94.60.14 2 6 134358 20231202171928 202.239.5.35 0 1 13806 146.70.52.104 2 2 12202 20231208223255 173.252.87.4 0 1 10888 92.40.215.104 0 3 21142 154.95.34.235 0 1 243068 168.91.11.10 0 2 2572 82.132.234.199 1 1 3769 20231213082420 104.28.86.110 3 28 9940644 20231204134916 193.235.238.163 1 1 3340 20231214122555 58.217.204.219 4 4 14571 20231231024738 165.225.17.176 22 42 557004 20231221115944 121.52.244.247 0 2 19873 148.252.140.190 5 23 5408567 20231201184023 110.85.62.170 1 16 202680 20231219002427 95.144.99.73 3 26 5107114 20231201200951 207.148.69.213 0 4 125017 2.219.80.207 0 4 111035 31.211.142.115 1 1 12131 20231206223357 90.206.126.163 16 50 5522598 20231231155556 128.199.220.119 0 1 111246 1.231.27.148 4 4 24416 20231225132950 82.132.245.44 1 1 3825 20231218171045 94.41.238.160 3 3 25149 20231217092649 154.95.34.98 0 1 100391 34.23.37.82 0 1 10128 148.252.128.190 7 33 5211266 20231211075347 8.219.107.95 2 2 14168 20231224001025 81.159.211.21 4 27 5125302 20231201164241 142.147.107.120 1 1 10778 20231207192806 31.94.60.58 10 16 5044450 20231206123736 104.28.86.101 1 18 5035244 20231205122659 86.185.19.185 1 18 5034577 20231221174256 8.222.179.76 2 2 12208 20231220160813 161.69.71.25 5 28 5217414 20231207132850 86.140.215.106 5 74 15276134 20231230202618 66.42.62.167 0 4 201790 45.32.118.99 0 2 20568 80.41.73.254 1 10 4906115 20231215063121 202.239.4.40 0 1 6415 157.245.147.164 1 3 20619 20231207064157 185.69.144.96 1 5 20215 20231203215542 114.111.32.159 0 1 6415 81.108.180.126 14 42 34329788 20231229235235 78.129.219.171 1 1 9521 20231207101230 82.132.226.251 2 2 18926 20231218062538 31.94.12.179 1 18 4975718 20231224064321 66.220.149.10 0 1 2073 31.94.19.178 2 2 9688 20231208210817 149.20.246.190 0 1 20214 181.214.206.14 3 3 26157 20231201163513 82.132.228.252 2 3 25502 20231211161758 202.239.5.106 1 1 5306 20231230170642 212.170.108.196 2 2 13050 20231229124519 20.174.17.181 1 1 13972 20231208123026 82.132.224.189 2 25 5115124 20231220205658 81.140.226.76 2 25 5078532 20231230224940 3.239.1.108 0 1 1286 90.209.9.5 1 18 5031513 20231208144218 82.132.214.36 1 5 67404 20231216024154 180.76.14.18 0 1 30620 3.147.82.244 1 1 4297 20231211044905 216.24.216.98 3 3 26183 20231215153428 104.28.40.135 10 49 5094976 20231231083602 81.129.185.76 13 13 54824 20231208193219 109.150.175.237 6 7 21045 20231203210412 43.225.73.205 1 21 5031617 20231227222812 145.239.113.73 1 1 3904 20231214112607 202.239.5.84 0 1 6415 82.132.217.126 6 6 23199 20231207123124 45.32.108.23 0 4 23689 8.222.178.157 2 2 12208 20231226203627 205.177.85.130 2 2 12208 20231216174701 104.28.86.102 1 7 4881797 20231208145208 154.37.177.191 0 1 100391 114.111.32.32 0 1 1286 202.239.5.105 1 1 3898 20231218171550 103.174.178.133 4 4 35957 20231216025623 31.94.57.157 2 4 36181 20231222155332 176.251.74.95 31 116 16397413 20231231233305 77.98.194.176 1 18 5031833 20231209140605 145.224.67.134 1 20 5057932 20231201193301 31.94.25.18 1 1 3742 20231223123210 172.58.14.21 3 3 24339 20231218212633 59.82.21.224 0 1 8777 35.237.102.174 0 1 244872 86.184.206.238 2 25 5104195 20231201115535 52.56.62.221 0 2 728 3.239.96.117 1 1 3620 20231221043032 3.237.7.225 1 2 3643 20231222132539 45.154.138.137 1 1 12131 20231221032302 82.132.233.251 1 1 3687 20231201093249 3.149.246.26 1 1 12553 20231213032657 154.13.92.246 0 1 165214 185.201.140.104 0 1 156759 82.132.225.16 1 1 3905 20231219061238 62.232.175.18 31 156 11523929 20231228101312 94.2.154.152 1 20 5057932 20231201162123 86.142.32.93 5 22 5047649 20231208171720 64.137.64.252 0 1 165214 165.225.17.21 2 25 5082007 20231215125458 213.105.183.98 14 33 5093054 20231229235049 31.94.57.213 1 1 3474 20231229221555 58.211.23.183 1 1 3578 20231226210421 182.22.30.53 0 1 20214 85.255.234.139 6 27 9766105 20231230111659 38.152.41.98 2 2 3024 20231206075507 109.248.204.252 1 1 3578 20231224135725 211.249.46.194 0 1 20214 31.94.37.180 6 20 155855 20231202112720 18.207.252.249 2 10 211396 20231202110501 35.87.213.254 91 91 1695787 20231221232836 104.28.86.114 4 22 203000 20231226121657 203.119.159.225 0 1 8777 44.200.21.228 1 1 2947 20231221014131 176.116.21.36 11 99 25297949 20231231192425 90.243.223.232 2 7 120592 20231217222142 141.45.94.78 0 1 12838 62.172.88.200 18 38 291112 20231227163309 82.132.244.168 1 13 73073 20231231172334 192.171.83.73 0 1 921 8.217.96.236 0 1 10623 95.152.217.99 1 24 5140620 20231209175903 202.239.5.184 0 1 654 31.94.24.49 1 1 5038 20231205162739 91.196.223.216 8 16 166999 20231201184255 139.180.189.170 1 2 9973 20231207151702 82.132.224.2 1 1 3421 20231205075658 185.220.101.59 1 1 3635 20231226125111 18.117.144.34 1 1 3023 20231213011748 45.32.103.40 1 4 20327 20231204033905 31.94.57.236 1 1 5164 20231209114422 34.222.171.21 1 1 3737 20231202114610 138.68.240.227 1 1 13975 20231215194933 154.30.58.203 0 1 165214 15.235.48.193 1 1 3634 20231222153014 51.146.117.220 4 30 5274029 20231203112408 45.32.123.142 1 2 4836 20231202180312 31.94.64.180 1 12 4979391 20231205180652 36.74.159.216 1 1 2947 20231201171344 109.144.20.1 3 23 5099515 20231201164057 31.94.38.62 2 6 32869 20231223134230 86.147.176.29 4 52 14969193 20231228083021 194.81.239.186 3 6 55036 20231206111743 202.239.4.237 0 1 568 35.89.212.22 3 3 63306 20231216173714 193.35.48.118 2 2 13027 20231202052831 149.18.56.238 1 1 4162 20231202041101 217.146.93.16 1 6 3793 20231217100244 86.191.140.124 4 20 159845 20231229141034 90.206.157.41 2 25 5111074 20231225201721 154.79.248.98 5 5 16740 20231206010902 82.132.233.181 3 4 4847885 20231205150243 92.40.170.147 5 46 10149207 20231214171742 185.223.249.175 1 1 4073 20231212111941 77.232.40.104 2 2 12208 20231216220551 82.132.216.111 1 18 5031513 20231208150158 57.129.34.175 1 1 9332 20231225231628 27.115.124.118 0 1 1286 34.217.39.76 39 39 771971 20231216022611 132.145.167.122 0 3 26538 35.237.100.36 0 2 108288 91.212.12.132 0 3 246 45.95.39.131 1 1 3130 20231202044516 47.88.104.193 1 1 12131 20231216010851 45.77.250.192 1 3 25616 20231205011255 86.158.68.138 5 27 258812 20231223160217 94.228.169.182 4 4 15118 20231219055101 178.128.80.135 1 3 120504 20231201210151 200.58.181.219 2 2 12208 20231206192954 51.186.253.73 1 1 7271 20231201161329 94.201.87.104 0 2 4838253 82.132.225.238 2 19 5036357 20231208145151 54.37.100.107 1 1 3835 20231212111955 59.82.21.120 0 1 11986 5.71.246.109 18 38 63113698 20231231152314 147.147.191.194 0 3 22421 216.169.73.65 1 1 12131 20231204104054 205.169.39.172 2 29 5132211 20231227013230 109.144.210.68 3 5 45575 20231213224159 202.239.5.29 0 1 921 31.94.24.255 5 28 5100618 20231231112211 82.129.77.23 2 2 7713 20231207102445 51.161.115.227 1 1 11638 20231213052910 109.157.50.217 2 19 5036610 20231209152415 34.220.88.70 10 10 137790 20231216052946 139.99.221.198 32 32 139551 20231227101952 3.147.205.225 1 1 10637 20231214201603 178.176.75.114 2 2 12201 20231222001110 92.40.171.131 1 6 5028313 20231218165312 86.184.47.227 10 59 5548251 20231224102232 176.12.106.30 2 25 5145072 20231219133553 82.132.217.96 2 5 63386 20231222221953 36.110.131.174 0 1 42588 85.65.170.166 1 1 2947 20231222024057 52.56.62.218 1 1 3578 20231228162423 43.239.251.69 2 2 12208 20231228154248 101.67.50.98 0 1 921 199.244.88.227 1 1 3621 20231206045037 139.180.227.30 0 2 2207 92.40.198.36 2 2 18813 20231218065606 86.191.114.227 2 16 10209094 20231207171139 31.94.12.177 1 1 4881 20231206080816 165.232.175.90 2 5 12826 20231208161143 107.181.149.212 0 1 165214 93.100.152.5 4 4 24404 20231221045751 143.110.160.83 1 5 113426 20231209153408 154.92.118.139 0 1 165214 34.23.187.217 0 1 10418 35.90.58.176 0 1 244872 90.196.188.238 1 15 5029915 20231208203125 149.241.225.31 1 20 5057876 20231201165227 84.33.21.125 0 1 165214 45.85.240.156 1 1 3707 20231213164800 177.85.173.92 1 1 12131 20231206235344 64.137.64.43 0 1 138245 85.208.117.181 1 1 12131 20231218170350 2.217.7.188 7 11 183694 20231206195920 148.252.133.100 4 22 10039297 20231207081936 8.219.248.44 3 3 20897 20231227191307 81.87.12.59 3 17 100461 20231202104324 31.94.60.31 0 3 22421 157.230.243.201 1 5 120357 20231201195346 82.24.123.72 82 932 189892996 20231231194734 185.195.63.48 0 1 100391 3.80.73.190 8 8 32593 20231211093221 51.219.15.146 3 6 42669 20231215115831 81.155.36.95 1 17 5029440 20231209204654 189.195.176.99 2 2 12208 20231206054243 82.132.215.61 2 4 109605 20231203171759 94.192.182.79 0 4 111035 114.78.107.63 1 18 5031064 20231201223858 8.219.58.190 1 1 3263 20231207023911 86.190.74.174 6 32 565286 20231206162843 178.68.168.145 2 2 12208 20231223232201 176.116.21.79 3 60 15204003 20231210100931 140.205.196.85 0 1 11986 210.21.229.138 0 2 106206 104.167.0.116 0 1 165214 117.185.229.12 4 4 14571 20231231024903 105.214.74.226 2 2 12208 20231215221010 95.165.163.188 2 2 12208 20231206195807 90.199.112.202 1 18 5034567 20231219210727 54.205.197.133 1 1 3654 20231229114155 206.189.155.30 0 3 25114 168.91.9.69 0 1 13806 40.94.93.76 0 2 14727 82.132.232.7 2 25 5108209 20231202092433 198.235.24.184 1 1 14599 20231230053347 34.214.237.66 0 1 7650 95.79.191.197 1 1 3711 20231207123051 64.137.91.82 0 1 165214 134.209.98.10 1 10 44888 20231208215743 139.180.129.127 0 2 6460 194.81.239.181 5 6 42272 20231213142652 82.132.235.230 1 8 166670 20231212194635 178.168.115.145 13 13 116427 20231209142627 86.132.224.211 1 12 259276 20231209172326 86.167.76.27 3 15 10895 20231202080832 109.157.99.235 1 20 5060886 20231209213326 89.149.87.89 6 6 47848 20231202162910 104.28.40.145 0 6 4870709 109.157.42.76 15 101 15560605 20231231212734 92.40.170.220 2 2 7277 20231231112107 194.35.122.97 1 1 3711 20231208094614 208.103.166.66 0 1 13806 144.76.22.133 1 1 5108 20231209135419 165.232.135.29 0 3 9056 86.18.148.216 6 55 15099401 20231219061154 3.135.226.175 1 1 9942 20231217045839 34.200.212.249 0 1 12838 139.59.177.92 1 1 3713 20231214010712 36.110.131.246 0 1 111246 216.24.213.242 2 2 12208 20231225144803 176.111.174.153 6 6 53192 20231229044322 34.138.204.207 0 1 14343 173.252.95.119 0 1 244872 64.137.68.61 0 1 165214 92.40.215.192 1 1 4844 20231208150004 104.239.93.133 0 1 100391 2.120.24.224 17 67 5840377 20231228215750 5.66.130.253 1 18 5030204 20231202200846 82.132.224.139 1 18 5031676 20231226130946 205.210.31.77 1 1 14333 20231230015226 86.137.119.31 0 1 244872 92.40.169.196 5 6 46054 20231209122418 91.190.18.190 1 1 3768 20231218144027 218.57.210.186 2 2 12208 20231227100012 192.42.116.183 7 7 102186 20231201234143 109.145.90.195 11 45 14816831 20231214001815 109.157.213.248 1 1 3766 20231207200151 92.40.198.34 2 2 16289 20231218065655 45.146.54.27 1 1 3123 20231230065436 45.154.138.222 1 1 70 20231221032302 85.29.144.114 2 2 13019 20231210035936 111.13.145.23 4 4 14571 20231231024945 16.171.194.189 1 1 14810 20231209072103 82.132.226.204 1 1 3725 20231204061910 82.132.219.76 1 24 5107341 20231221211952 167.99.79.53 2 8 76316 20231208161449 172.241.168.213 1 1 3123 20231230063120 135.125.97.131 1 1 15833 20231209141207 18.236.75.183 1 1 3672 20231206124503 176.250.23.208 1 20 5086557 20231205114927 94.0.180.180 2 24 5113437 20231219144320 31.94.12.110 1 1 3764 20231203045554 82.132.234.120 2 8 158771 20231221181907 80.66.79.162 1 1 12131 20231221055331 92.118.61.192 1 1 3608 20231222101922 31.94.60.164 1 15 4978999 20231220213012 104.167.0.65 0 1 32135 148.252.140.101 6 13 115070 20231230080510 57.128.26.120 2 2 13346 20231224070508 31.173.85.184 2 2 12201 20231212001109 122.107.105.36 0 1 244872 156.146.36.69 2 2 3343 20231209122022 15.235.49.21 2 2 19800 20231227021603 44.203.103.78 1 1 3658 20231210130803 91.196.223.198 2 21 5067949 20231201205639 185.197.74.94 60 60 507330 20231230051619 192.44.68.188 0 1 12838 31.94.64.10 1 18 5031513 20231208141354 81.100.44.184 8 100 20441702 20231231161726 86.147.253.26 1 18 5031513 20231209153018 31.94.74.240 1 1 3502 20231204075522 165.225.17.83 1 20 5062278 20231208135417 40.94.93.83 0 3 33753 82.132.226.100 2 11 34253 20231219022235 86.14.85.80 7 59 15160791 20231217114340 90.207.14.118 7 55 10284352 20231218082604 31.94.26.45 6 29 5220734 20231209125612 92.40.171.159 0 4 22161 52.201.139.210 1 1 3608 20231222054827 52.35.157.79 2 25 5161639 20231204152854 35.237.181.236 0 1 30620 34.138.204.148 0 1 75586 86.4.145.192 92 252 212592000 20231231163734 216.24.216.79 4 4 38283 20231223050543 31.94.57.246 2 2 7232 20231217190833 54.213.195.191 1 1 13641 20231211204410 104.194.8.237 0 2 115511 31.94.26.94 1 1 12498 20231210153830 168.91.45.39 0 1 921 178.176.73.52 1 1 12131 20231218075617 195.171.128.2 28 45 58131872 20231221131847 45.79.123.205 4 4 14311 20231220102232 54.189.165.191 0 1 244872 18.234.111.92 1 1 4142 20231204181029 120.234.203.171 9 9 73412 20231219013044 143.198.219.104 1 4 4877161 20231208005658 86.155.95.19 2 25 5166277 20231203221019 64.137.112.55 0 1 156759 213.152.59.167 6 14 339545 20231207145216 86.14.52.74 5 51 10320979 20231217011350 101.44.250.212 0 1 8613 83.215.206.56 11 53 15347709 20231228174214 101.44.250.113 1 1 2931 20231228183205 154.95.34.141 0 1 165214 191.96.168.238 2 2 7628 20231208232358 185.158.242.146 4 8 165338 20231207092754 86.165.50.124 30 137 30324810 20231231140120 37.139.53.191 5 5 52294 20231217075920 199.45.155.19 1 1 3526 20231211195656 52.56.62.227 0 6 22798 31.94.60.154 1 1 3383 20231216233225 31.94.12.84 1 1 3635 20231227095143 92.40.214.0 1 10 4987102 20231208155242 84.33.21.150 0 1 245801 138.199.31.23 2 2 12202 20231219214316 212.55.99.157 4 4 24416 20231216033708 148.252.128.178 1 4 44186 20231216000816 86.171.225.238 1 1 3635 20231226234640 165.232.175.180 1 4 7824 20231208075948 82.132.225.150 1 1 3776 20231215060645 194.35.122.141 2 2 7156 20231228142754 65.154.226.171 1 2 16364 20231211110402 94.156.68.3 1 1 3621 20231206071742 205.210.31.234 1 1 13949 20231201103742 128.176.193.69 0 1 12838 193.183.102.155 1 1 3189 20231214122553 156.252.23.189 0 1 568 18.207.136.68 1 1 2989 20231220232157 3.239.10.74 1 1 3046 20231222015313 89.22.233.74 56 56 474329 20231230063819 54.245.165.27 1 1 9955 20231221064809 39.103.168.88 3 3 7536 20231218163821 202.239.4.172 1 1 4390 20231210164930 198.244.141.165 1 1 10498 20231224045635 45.192.131.153 0 1 165214 31.94.7.212 1 18 5031833 20231209135626 89.22.232.206 40 40 339907 20231230060454 92.40.169.152 1 5 57931 20231223095059 65.154.226.169 1 1 3771 20231218101143 104.28.30.142 1 6 4868656 20231215172818 139.59.244.101 1 7 12850 20231210231822 167.99.70.135 0 4 53854 172.191.169.61 1 1 3713 20231214073613 159.223.41.14 0 2 14727 209.58.170.216 2 26 5181907 20231210142249 82.132.225.29 1 18 5031513 20231208202735 85.255.237.183 2 4 40190 20231219073341 92.40.218.221 2 3 4839194 20231212192139 165.232.175.182 0 3 25851 44.214.1.187 1 2 10029 20231218000628 140.248.40.25 1 18 5034223 20231202144717 101.44.251.130 0 1 11096 123.138.60.91 4 4 14571 20231231024653 3.238.175.168 1 1 4819 20231221050759 124.237.181.138 1 1 3578 20231224184631 31.94.57.171 1 1 3687 20231201075551 85.255.233.74 1 13 5064289 20231216134620 154.92.127.229 0 1 165214 54.244.73.203 0 1 244872 66.42.55.225 0 2 1622 81.140.230.99 16 48 5322654 20231224004457 34.207.239.1 1 1 3048 20231222134905 45.77.252.100 0 2 21709 178.250.73.49 0 3 734616 85.255.232.173 5 22 10165401 20231204115312 40.94.28.56 0 5 17573 148.113.142.222 1 1 3608 20231222201149 191.101.130.53 2 2 7338 20231204102112 31.94.5.85 0 1 185 31.94.24.168 2 2 7713 20231207082029 202.239.5.0 0 1 13806 86.159.64.69 19 108 25387257 20231224233150 94.11.196.222 4 46 19954472 20231220151025 31.94.14.138 1 1 8965 20231209115300 105.162.54.179 5 5 30975 20231207174245 202.239.5.2 0 1 20214 185.15.210.114 1 1 13940 20231204000943 178.23.189.67 2 2 24262 20231211210516 57.129.34.133 1 1 4332 20231227160132 185.122.194.39 2 5 42966 20231231135111 172.226.114.27 4 27 5096323 20231231233926 104.143.227.148 0 1 156759 104.28.30.141 0 7 48418 148.252.140.181 8 26 293078 20231212142354 46.8.106.193 1 1 12131 20231215063227 211.249.46.155 1 1 3557 20231230164049 195.154.179.161 6 6 21444 20231211194540 92.40.218.222 2 6 67942 20231211151021 146.70.170.50 5 5 52326 20231210055344 31.94.12.143 1 9 4979394 20231208171947 86.154.34.111 15 90 20220202 20231213230806 5.161.226.97 1 1 4998 20231227182415 94.2.13.153 2 22 9899787 20231201171803 92.29.61.69 11 69 34739806 20231231123908 82.14.194.123 2 40 10161776 20231231091822 82.132.226.152 2 16 247518 20231228022946 178.157.102.151 0 1 165214 104.28.89.71 3 15 235732 20231230212758 106.38.226.40 0 1 10128 45.15.158.39 1 1 3711 20231207142658 31.94.67.82 1 2 17183 20231204125748 35.231.119.49 0 3 43762 31.94.24.100 1 1 3383 20231230234713 82.26.194.252 11 23 152797 20231231195252 94.159.143.57 2 2 12208 20231207062001 8.219.40.219 1 1 3436 20231207024855 51.52.28.178 3 50 10446986 20231206100942 154.51.131.142 5 5 18032 20231228025610 89.105.5.167 1 18 5031458 20231211153931 34.221.182.245 0 1 32718 38.170.15.37 0 2 14374 128.90.43.122 2 2 0 20231202064928 54.37.100.115 1 1 3904 20231213164801 27.115.124.6 2 3 40058 20231219002543 172.226.0.91 1 15 5029915 20231210183908 82.132.226.140 2 26 9935592 20231201135235 84.33.21.162 0 1 165214 172.226.0.9 2 28 5092813 20231209131856 185.69.144.121 2 6 4988438 20231207223144 31.94.7.184 1 24 5118030 20231212083412 92.40.199.229 1 2 4835416 20231228144119 148.252.128.226 9 32 5261302 20231204134230 81.100.198.236 18 206 55455701 20231230223836 23.249.161.150 1 1 4789 20231216051611 82.132.245.231 1 1 5164 20231209120508 158.255.46.97 1 5 586570 20231220232948 86.128.85.167 2 21 5065550 20231202052914 3.83.135.127 1 1 3850 20231219141652 154.12.96.96 0 1 28267 86.173.11.239 9 176 40942073 20231231175905 51.190.171.166 4 28 9926318 20231215171419 31.94.37.183 3 3 22731 20231202113803 154.38.173.47 6 6 21975 20231231142943 193.122.144.16 0 3 36071 44.210.106.55 0 1 568 149.56.160.190 1 24 5100576 20231202102545 40.94.93.5 0 11 5013098 45.201.225.131 0 1 89891 146.70.111.145 4 4 24410 20231228204932 47.180.63.37 1 1 12131 20231206063612 82.132.216.219 4 18 257652 20231218211512 129.153.128.42 0 3 32121 154.92.127.38 0 1 165214 165.154.244.2 1 1 3583 20231228172532 52.56.62.229 1 1 14600 20231228101452 57.129.35.245 1 1 4124 20231226190435 211.249.46.150 0 2 14727 31.52.219.253 2 19 5045231 20231216004125 45.251.60.65 0 1 165214 43.156.4.46 0 1 12838 51.183.60.178 3 30 5265778 20231226214726 81.151.238.210 41 142 16075609 20231231124729 85.255.234.248 1 2 14359 20231210140842 45.43.80.58 0 1 165214 118.143.74.20 0 1 12838 86.147.191.199 5 12 5144839 20231208212943 150.230.179.142 0 4 41705 5.80.70.81 11 57 10349324 20231210212308 65.109.127.94 3 3 10801 20231211142827 78.145.181.152 2 36 10069107 20231205212803 51.190.224.131 18 101 15695191 20231219184935 13.40.124.83 1 16 5063261 20231219132053 31.94.12.251 1 2 4094 20231204153104 62.49.195.215 17 154 30951824 20231229141244 93.124.111.227 4 4 29486 20231203084936 74.125.208.12 0 1 244872 211.249.46.23 0 1 568 34.219.27.91 0 1 244872 101.43.164.71 4 4 55568 20231216192625 54.37.17.99 1 1 14050 20231218130853 8.222.170.97 5 5 47716 20231230193333 157.230.246.216 0 5 4859931 192.121.71.173 1 1 3189 20231214122558 15.235.44.97 1 1 4810 20231226000549 36.110.131.158 0 1 11986 185.93.0.213 0 1 155435 31.94.36.74 1 1 3766 20231208123739 94.2.184.11 1 18 5033758 20231231082503 117.70.48.22 1 1 3578 20231227131238 178.254.12.205 4 4 21232 20231227011208 44.210.96.171 1 1 3488 20231221004954 51.15.242.202 2 2 12202 20231210002354 40.94.28.10 0 3 36802 157.230.243.82 0 6 128701 45.90.61.107 1 1 3583 20231227175304 92.1.64.253 55 770 177941999 20231229115859 110.93.150.165 1 1 3487 20231230204651 51.190.48.10 1 7 5015284 20231209135625 101.44.250.47 0 1 7650 94.7.146.12 10 56 10318225 20231208084720 110.93.150.123 1 1 10085 20231226223907 86.172.114.156 20 45 5318187 20231206165629 165.232.175.85 0 2 1222 31.94.64.22 1 1 4844 20231208195104 84.33.21.231 0 1 165214 159.253.120.64 2 2 12208 20231221030627 154.12.12.184 0 1 245801 212.22.70.91 2 2 12208 20231220130837 35.237.37.115 0 1 244872 159.223.41.7 0 3 9381 45.32.106.18 1 4 13621 20231201185526 202.239.4.192 0 1 105436 81.158.56.254 1 1 4844 20231224023145 104.28.92.129 2 36 10073300 20231218190555 211.249.46.184 1 1 2522 20231229001146 82.132.229.152 1 1 3359 20231202110103 82.25.167.64 1 17 5074732 20231230100427 154.12.96.148 0 1 165214 35.93.107.21 0 1 244872 34.223.225.15 0 1 10626 3.136.17.24 1 1 3023 20231217203223 31.94.24.204 1 6 27188 20231213123345 3.141.97.155 1 1 9369 20231214202844 82.132.225.58 3 45 10266966 20231231112008 172.225.152.27 1 24 5158108 20231205134430 172.224.224.12 0 12 4881816 119.145.28.208 0 3 52591 92.40.214.156 1 1 3589 20231211063713 182.106.220.252 4 4 25254 20231223143547 92.40.199.231 1 1 3578 20231228144341 173.252.107.5 0 1 10161 45.77.176.13 0 1 111246 172.59.211.95 1 2 14434 20231220235234 82.132.225.247 1 1 9996 20231219194548 31.94.14.114 1 10 50582 20231204182242 35.165.164.56 0 1 244872 92.40.170.66 1 4 4886418 20231216161045 148.252.141.236 4 19 5196785 20231208145307 194.35.122.139 2 4 40255 20231227103956 1.169.108.107 2 2 12208 20231214022654 140.248.40.24 1 11 218885 20231207200850 176.114.184.82 4 4 36470 20231204134836 34.217.59.243 0 1 25919 90.204.175.132 3 49 10342179 20231208145413 216.173.73.172 0 1 165214 192.186.168.154 0 1 13806 110.93.150.70 1 1 3313 20231220235731 94.195.191.133 7 22 162095 20231219092202 35.89.102.206 0 1 244872 209.97.160.138 0 4 4925143 178.218.144.99 1 1 3488 20231221002753 34.148.10.128 0 1 244872 82.132.235.196 1 12 4930574 20231208120152 2.58.113.194 4 4 55424 20231228021032 36.110.131.247 0 1 4831838 104.28.89.83 2 44 10213889 20231230171225 90.206.150.143 62 108 102130465 20231219200822 94.25.175.65 3 3 24339 20231210185812 82.25.61.132 1 20 5086348 20231203221341 35.231.254.174 0 1 11986 110.93.150.152 1 1 8479 20231223221124 78.86.160.66 1 1 3635 20231225013544 202.239.4.154 0 1 1286 91.92.255.20 1 1 3578 20231224042412 193.56.24.139 1 1 3707 20231214112609 64.62.202.80 2 2 7817 20231227012232 34.220.207.97 14 14 283545 20231216000425 82.132.225.114 4 4 22227 20231201084442 1.169.66.69 6 6 39138 20231223015610 128.90.161.46 2 2 12208 20231227002619 46.248.187.122 2 2 27712 20231228160502 178.157.102.105 0 1 42123 35.93.45.49 0 2 489744 13.58.130.206 1 1 9369 20231217192207 37.139.53.198 2 2 13025 20231209061548 109.150.136.108 1 18 5031045 20231202095640 31.94.24.152 1 2 13821 20231219200642 36.110.131.186 0 1 17561 31.94.37.15 2 2 8090 20231201182329 172.226.134.21 0 7 24137 92.40.169.219 1 1 3686 20231230145115 139.180.136.106 2 4 19869 20231208034452 119.120.18.165 1 1 13856 20231225040917 31.54.74.41 0 4 111035 110.93.150.140 0 1 1286 166.88.122.153 1 1 2947 20231204033307 31.94.5.86 2 2 8824 20231212194926 2.25.99.170 1 18 5031513 20231209185652 185.253.42.218 2 2 13050 20231229053727 82.132.224.84 2 26 10088084 20231219154323 196.244.4.158 1 1 2947 20231231141953 192.0.101.142 0 1 86523 92.40.219.140 2 7 4994123 20231220182314 149.28.148.178 0 2 2781 31.94.74.129 1 1 3485 20231209204252 8.222.203.212 3 3 10530 20231222111459 40.94.100.51 1 3 25154 20231229104056 31.94.56.247 1 18 5031686 20231209070334 86.134.5.31 2 48 10338792 20231208133937 84.68.137.141 4 96 20528327 20231217165113 31.94.12.19 2 9 133042 20231229214748 5.69.119.111 3 30 73134 20231226212109 81.152.105.19 1 1 3591 20231231104349 192.71.144.105 1 1 12960 20231219144737 185.212.160.56 0 1 100391 151.230.24.224 2 25 5121780 20231224224335 85.255.237.29 1 1 3769 20231214190251 31.94.24.164 1 20 5052913 20231216082654 54.88.156.78 1 1 3488 20231220043803 104.167.0.37 0 1 165214 86.134.171.74 25 207 46049652 20231228090507 8.222.208.111 1 1 3717 20231221093002 209.59.231.17 0 1 13806 31.94.6.21 1 1 3905 20231219083706 87.121.94.28 1 1 13856 20231228140856 90.192.137.38 4 27 5193107 20231207235655 123.6.49.41 0 2 1489 172.225.189.121 1 18 5036059 20231213224940 191.101.110.75 1 1 2947 20231208092729 178.128.105.15 1 6 4859905 20231203071228 104.28.86.109 3 23 5138153 20231215074920 194.187.176.126 1 1 3816 20231209055551 199.45.154.16 1 1 3682 20231212164255 192.42.116.187 5 5 79917 20231201234111 36.110.131.87 0 1 20523 92.28.167.206 2 19 5041121 20231205222931 31.94.57.10 1 2 248538 20231203192723 192.126.189.84 1 1 9962 20231215132147 172.224.226.21 1 18 5036089 20231212111145 90.205.54.181 1 16 5038119 20231228172245 82.132.224.79 2 25 5125439 20231217113056 2.217.111.25 1 18 5031513 20231208200026 15.235.48.85 2 2 15435 20231224053552 37.187.205.154 1 1 4073 20231212111942 109.155.167.32 4 4 14218 20231203221445 86.182.13.223 1 24 5180774 20231206192453 43.133.176.76 2 2 7593 20231225041618 3.141.27.108 1 1 9893 20231216225823 27.115.124.45 0 1 6415 31.94.26.106 0 3 1598 8.218.165.76 0 1 11986 148.252.128.168 1 3 23825 20231210151739 82.132.226.219 1 20 80568 20231224122756 172.58.220.149 2 5 59638 20231216160127 5.148.46.36 1 18 5031513 20231208203348 66.249.84.67 0 1 244872 64.137.91.79 0 1 28267 14.139.109.7 0 1 12838 86.186.1.82 3 26 5124490 20231230232442 93.158.90.153 1 1 3765 20231205041342 82.132.232.174 1 8 47625 20231206152856 192.169.140.98 1 1 12131 20231215233921 18.206.16.38 1 1 3035 20231220183421 8.219.175.172 1 1 9542 20231221044044 106.75.164.79 1 7 113201 20231216195904 79.110.184.222 1 1 3488 20231220010033 85.255.233.158 7 27 4953505 20231212105101 18.189.7.186 1 1 3243 20231214201002 20.6.35.43 1 1 13936 20231222125909 38.75.137.222 2 2 7586 20231217095040 206.189.147.242 0 5 5631 128.194.35.58 0 1 12838 65.154.226.168 1 24 5107180 20231227013444 45.77.253.178 0 1 6415 54.38.153.178 1 1 4699 20231212111946 120.24.173.186 2 2 7468 20231218155652 36.110.131.244 0 1 0 113.207.70.231 4 4 14571 20231231024941 51.146.31.68 0 4 111035 5.64.222.166 16 38 216342 20231230204928 90.221.136.214 1 18 5031047 20231205115758 104.167.0.188 0 1 165214 131.153.142.170 17 17 62232 20231222163705 103.197.168.36 1 1 5115 20231218111443 86.153.101.210 2 25 5083799 20231230183518 81.108.180.57 10 73 10443304 20231228204316 86.160.19.55 5 36 448360 20231227080359 94.7.253.168 3 26 5165338 20231205142536 34.76.96.55 1 1 3621 20231206040828 92.40.214.229 2 25 5184562 20231207121045 86.144.121.9 4 35 5299674 20231229233920 8.219.197.101 2 2 8179 20231224061816 84.33.21.168 0 1 165214 82.21.161.181 9 22 248949 20231212182956 86.151.216.145 9 53 5312623 20231221085914 46.35.252.130 10 10 72555 20231218063735 15.235.48.51 1 1 4603 20231226100611 86.137.226.162 2 25 5124412 20231229222101 34.239.184.173 1 1 2959 20231222082428 31.187.2.31 0 1 244872 146.190.237.89 2 4 68026 20231226060349 82.132.226.96 3 4 23430 20231212113914 176.214.81.187 1 1 13439 20231209203511 172.226.183.19 0 11 149716 110.93.150.183 0 1 20214 80.41.75.37 4 32 446066 20231223120410 52.38.30.53 0 1 244872 154.28.145.74 0 1 32135 148.252.132.146 5 7 55112 20231203160647 31.94.17.205 3 26 9953884 20231209192417 211.249.46.169 0 1 1286 52.56.62.188 0 1 354 90.205.225.133 29 212 27353650 20231231100336 202.239.4.18 1 1 3492 20231230210403 85.255.232.111 2 23 5124543 20231202145024 171.248.208.39 7 7 26993 20231217194525 199.34.84.8 0 1 20214 35.87.32.240 0 2 20763 31.94.67.117 1 1 3068 20231223110537 43.133.65.168 4 4 14184 20231220125515 104.28.40.120 4 27 5118115 20231227105638 202.239.4.232 0 1 13806 104.222.186.223 0 1 100391 54.188.218.177 1 1 3578 20231226113126 81.135.113.235 10 36 236597 20231231211519 104.28.40.140 2 24 9921629 20231218235627 92.40.170.225 3 5 9674639 20231231103918 185.220.103.117 2 2 12208 20231211162435 172.224.227.6 1 18 5031513 20231208154441 109.158.73.194 1 24 5112802 20231210203130 146.190.107.60 0 1 2073 94.103.80.119 1 1 12973 20231229063131 91.92.247.35 1 1 3526 20231212000720 31.94.56.111 1 1 3546 20231220125453 2.216.27.178 1 1 5164 20231209135820 47.236.136.14 0 1 12838 152.32.112.61 1 1 3848 20231219064501 82.132.219.218 1 5 42966 20231209182837 193.56.25.226 1 1 3904 20231214112607 86.166.234.22 1 18 5030634 20231230140638 148.252.140.164 2 2 7532 20231207185051 8.222.173.171 2 2 12208 20231225070340 202.239.4.117 0 1 568 18.218.245.210 1 1 9893 20231214173549 185.43.189.182 1 1 12131 20231226200856 194.113.106.9 60 60 507318 20231230055636 82.132.246.245 2 2 14808 20231213103437 92.40.169.162 3 3 10734 20231227063953 86.152.215.124 44 373 67845774 20231211215652 123.184.26.16 4 4 14571 20231231024902 176.223.105.214 1 1 4789 20231216051610 104.28.86.87 1 1 3678 20231201135351 109.151.243.0 4 5 61367 20231225090611 51.182.3.30 16 44 478032 20231217153500 35.90.140.97 0 1 4831838 23.229.43.31 0 1 6415 92.118.61.198 3 6 61904 20231221093846 31.94.57.245 2 6 98006 20231217162021 64.62.202.82 45 45 214186 20231215000731 86.149.211.157 1 20 5090235 20231218090000 205.169.39.188 2 29 5132201 20231227013222 3.239.121.22 1 1 11572 20231204075832 113.75.207.103 1 1 14019 20231203053305 95.45.139.2 0 4 111035 92.40.171.169 0 1 4831838 154.194.9.189 0 1 165214 31.94.24.249 1 1 3769 20231214001755 85.255.232.238 1 19 5086780 20231202200349 158.69.27.213 1 1 4789 20231209165151 35.92.8.227 1 1 3737 20231202114644 92.40.170.4 1 1 9999 20231230164206 57.129.34.101 1 1 3490 20231224000550 2.120.248.41 1 15 153259 20231209225044 82.165.84.193 1 1 14608 20231205074739 77.222.115.125 4 4 24416 20231226115345 199.45.155.34 1 1 3768 20231218204226 3.17.109.82 1 1 3418 20231213030456 64.137.64.48 0 1 165214 81.155.159.189 19 53 5337723 20231231140726 101.67.50.26 0 1 921 109.150.186.174 1 1 11962 20231205130843 86.9.11.237 22 164 45710287 20231224074734 89.149.87.31 6 6 38255 20231212151031 86.131.83.159 7 16 208301 20231220084532 3.12.123.175 1 1 10072 20231212215928 109.159.38.30 1 1 3678 20231201130207 92.40.168.3 1 3 4946662 20231226184253 203.81.95.70 1 1 13702 20231216214746 93.97.242.30 2 25 5108209 20231202094059 31.173.82.141 2 2 12201 20231203034029 94.156.64.75 1 1 3578 20231228193610 159.223.57.32 0 2 22949 154.37.177.174 0 1 165214 92.40.171.108 0 1 4831838 114.224.223.210 2 2 12208 20231221102252 85.255.237.102 1 3 66251 20231204171357 82.132.217.176 2 2 15799 20231231082627 5.188.62.26 1 1 3527 20231213000511 92.40.171.224 1 24 5073742 20231230185441 103.18.47.78 2 2 12208 20231215225207 81.91.182.89 1 1 13856 20231224042129 86.153.132.181 8 59 10349969 20231214221647 82.132.225.124 2 2 15846 20231224120757 51.190.254.122 1 18 5030338 20231209141852 86.4.189.36 1 18 5031513 20231208195002 82.132.226.49 1 3 34335 20231212210903 85.255.237.206 2 4 22808 20231226192010 171.248.210.225 1 1 12131 20231215213118 82.132.212.83 2 7 4869850 20231225221904 85.255.236.174 4 27 10260641 20231224225345 31.94.56.160 2 12 241946 20231221091743 90.193.237.187 28 433 112076065 20231231184559 82.132.225.131 3 7 4997939 20231226091838 57.129.34.122 1 1 4432 20231224051246 172.226.182.27 0 12 140977 146.75.174.12 1 18 5031513 20231210233308 172.226.134.11 0 16 4991094 8.219.199.118 1 1 10324 20231220055715 88.99.136.18 1 1 3578 20231226095848 92.18.223.184 1 1 3616 20231217185029 125.164.132.62 1 1 3608 20231222010140 31.94.36.78 1 8 4900324 20231215150049 104.28.30.137 1 4 24393 20231213225143 85.255.233.142 2 25 5147531 20231218072711 80.195.15.7 2 25 5168025 20231204210533 86.18.110.20 0 1 244872 104.28.92.1 2 48 10361634 20231209135843 66.220.149.116 0 1 32478 92.40.175.186 1 20 5057876 20231201164055 86.170.60.25 1 1 3800 20231206222355 86.160.239.136 1 18 5031513 20231208200335 113.200.73.7 2 16 94998 20231228143436 196.199.104.144 1 1 3130 20231202043050 86.134.234.233 4 34 5022066 20231231131750 31.94.12.92 4 27 5202766 20231209140859 104.28.40.112 1 5 77852 20231216180820 188.74.182.93 0 1 165214 109.146.148.181 10 28 277630 20231231095914 94.25.225.236 5 5 46244 20231201115857 138.229.107.241 0 1 654 92.40.216.41 3 7 5014318 20231217111840 165.232.175.56 0 3 2775 79.77.193.57 1 24 5180858 20231209115645 213.192.73.210 2 23 5155504 20231219091238 157.230.43.236 4 4 40959 20231220115232 31.94.24.147 2 11 4873699 20231211134853 202.239.5.6 0 1 28460 31.94.12.238 8 8 49250 20231204102429 110.93.150.74 1 1 4000 20231230163640 64.233.172.35 0 1 244872 52.56.62.216 0 1 4831838 208.127.199.8 3 17 9868211 20231206140420 82.25.63.111 43 391 91879514 20231231143638 57.129.35.75 1 1 3210 20231225194308 35.161.80.165 0 1 49154 176.53.217.19 1 1 3578 20231227174009 154.12.13.207 0 1 28267 114.111.32.201 0 2 26629 171.236.88.178 2 2 12208 20231215232911 8.219.75.111 1 1 11576 20231228015118 31.94.74.72 2 5 27783 20231223085930 86.18.60.249 1 18 5031513 20231226232220 54.175.112.9 1 1 3737 20231202113550 176.226.172.92 2 2 12208 20231219205648 35.196.110.242 0 1 244872 82.132.232.230 1 1 3883 20231216095125 59.111.248.162 1 1 3578 20231226215715 31.13.127.11 0 1 244872 34.23.122.191 0 1 10623 94.2.142.152 3 3 9780 20231207071347 159.65.14.199 0 6 44885 193.239.232.102 8 8 107804 20231201234042 131.153.240.162 7 7 25817 20231222114700 92.40.219.88 1 1 10795 20231222090921 210.220.70.251 1 1 3707 20231204140752 172.226.0.5 0 9 4879411 202.239.5.30 0 1 10888 202.239.4.2 0 1 23014 3.128.95.167 2 2 7440 20231215064352 223.39.188.126 0 5 94380 91.92.242.136 2 2 640 20231229163844 192.252.214.20 1 1 12131 20231206173419 31.94.66.62 3 20 352276 20231209074903 31.166.211.217 0 1 654 154.85.103.112 0 1 165214 5.161.230.8 2 2 7765 20231221083529 31.94.66.60 8 24 307823 20231211210428 51.68.196.224 14 14 119517 20231231122716 188.74.210.154 0 1 165214 34.204.169.148 2 2 6618 20231221230513 36.110.131.232 0 1 67713 104.28.89.80 1 4 35323 20231211065329 84.17.49.62 3 3 26152 20231201105838 142.93.64.44 1 1 3526 20231211113206 194.36.99.247 1 1 2947 20231208090707 82.26.201.207 12 14 158687 20231204083842 183.240.181.41 3 3 10961 20231230024913 34.216.32.249 26 26 418446 20231230035036 18.169.157.174 1 22 5127919 20231217161537 3.227.1.22 1 1 3620 20231221071627 109.155.66.183 14 230 56215971 20231211204915 193.178.169.166 3 3 9020 20231219092454 86.130.76.227 16 66 10436753 20231211183826 154.12.96.213 0 1 165214 64.137.68.173 0 1 165214 80.4.236.139 51 551 112966063 20231224220834 176.250.115.81 2 25 5085999 20231231134225 78.47.119.61 19 19 272756 20231231235106 99.129.201.227 0 1 12838 45.146.54.32 1 1 2947 20231230003450 3.237.32.87 1 1 2959 20231222124355 86.172.114.170 12 37 5212984 20231212180235 3.235.193.185 1 1 2462 20231221123302 8.218.240.244 0 1 10279 34.75.83.50 0 1 244872 81.105.123.153 4 47 10044961 20231217200905 82.132.232.27 1 24 5158108 20231205162515 86.18.64.30 5 30 371993 20231209190247 114.111.32.149 0 1 1286 103.17.90.6 1 1 12131 20231224065240 92.40.171.107 1 3 125622 20231220202242 82.132.186.208 1 1 10528 20231211104603 104.28.86.108 2 42 10143604 20231223123216 212.69.41.253 3 22 5078190 20231201154537 193.117.212.107 2 2 7270 20231227095319 184.185.2.12 8 8 60268 20231231070538 206.189.147.224 0 1 111246 157.230.251.14 0 4 4855055 110.93.150.133 1 1 3986 20231202235549 123.6.49.15 1 3 37788 20231219002542 86.148.160.144 2 4 45558 20231213083146 90.192.58.230 16 38 212166 20231229142841 202.239.5.67 1 1 3975 20231213065127 86.180.147.102 7 99 20394801 20231226203942 82.129.107.76 4 27 385231 20231210192824 51.195.232.50 1 1 3682 20231222140134 219.144.85.115 4 4 14571 20231231024639 86.134.227.239 4 27 5096670 20231213232641 178.157.102.57 0 1 32135 69.197.156.226 4 4 24410 20231222234852 3.128.33.178 1 1 9893 20231210205836 45.251.60.70 0 1 165214 141.212.113.160 24 24 109704 20231211105023 104.28.86.116 9 34 5301288 20231231223306 92.40.219.192 3 9 5100880 20231206085239 34.139.84.13 0 2 36542 31.94.5.87 1 1 4981 20231212194902 92.40.215.105 0 1 654 141.95.100.52 2 2 29340 20231202055801 78.86.161.107 1 12 83989 20231220124315 58.246.58.150 3 3 25985 20231212185418 40.94.93.90 0 1 6415 2.58.72.18 1 3 47526 20231206114620 147.28.117.216 6 31 5033019 20231224081451 44.221.82.223 1 1 2989 20231222073828 82.132.214.182 2 17 9804773 20231211160255 211.249.46.181 0 2 9267 193.164.22.245 1 18 5032446 20231213214051 209.160.115.32 2 2 13037 20231219121027 2.123.1.113 8 31 5222235 20231206131657 90.192.33.255 6 39 5356194 20231221225306 82.132.227.102 2 2 7600 20231206164631 34.23.128.152 0 1 29325 92.20.251.25 0 3 110492 102.165.125.102 2 2 12208 20231226200059 138.199.31.193 3 3 25703 20231229220024 85.255.233.16 0 1 701 92.40.219.5 1 2 4835606 20231218172110 172.226.0.88 1 16 5020035 20231209152034 90.221.23.246 1 18 5031513 20231208150521 86.189.193.43 2 8 9926713 20231219211504 172.224.227.84 4 6 14713 20231221142702 2.124.148.60 11 60 10345684 20231226145928 185.16.160.154 1 2 4835429 20231231134408 2.127.207.77 4 38 5135448 20231230085910 147.139.163.22 1 1 14059 20231206180855 139.180.156.225 0 2 2727 92.118.75.125 2 2 12208 20231201075657 62.122.184.194 3 3 25729 20231213023639 104.28.30.147 1 17 9790980 20231215173357 95.107.50.223 1 1 12131 20231210202924 92.40.216.187 2 2 15263 20231206140156 206.189.156.82 0 1 20214 217.45.50.18 6 39 603685 20231210183410 64.137.68.221 0 1 165214 31.94.60.226 2 3 16895 20231230131342 86.162.216.164 2 24 5114058 20231224212713 78.86.161.151 4 4 30989 20231211191755 80.193.211.174 6 24 157810 20231204092619 82.147.85.79 6 6 36624 20231222152221 149.28.208.108 0 2 24583 185.69.144.225 8 30 4944778 20231230133408 109.150.51.113 2 19 5043597 20231207115419 86.153.18.109 9 33 5129226 20231231163237 62.84.99.188 9 9 73840 20231230205743 92.26.165.19 6 7 4853486 20231222122947 85.255.236.51 1 2 259480 20231205101114 150.136.66.68 0 2 42997 92.28.178.72 5 76 25064352 20231218070610 82.132.234.97 2 4 59195 20231206161656 64.137.68.84 0 1 165214 91.92.252.222 1 1 3685 20231212140319 86.135.255.230 1 5 48600 20231216134139 104.167.0.213 0 1 165214 31.94.67.170 1 1 3764 20231203104923 92.40.218.223 0 4 5005462 148.252.133.203 1 24 5132893 20231230135418 167.98.252.12 1 20 5083084 20231213110112 168.91.41.85 0 1 654 60.188.11.102 0 1 1286 43.128.68.201 0 1 9467 114.111.32.68 0 1 13806 18.221.58.96 1 1 8997 20231210073549 110.93.150.196 1 1 4007 20231230163745 54.183.113.139 0 1 1248 43.128.6.20 1 1 14768 20231219014157 154.22.61.206 4 4 6048 20231216182109 194.35.122.104 1 1 3711 20231207181021 31.94.5.245 1 18 5031777 20231209143242 5.3.207.246 1 1 13972 20231207124951 82.21.161.89 0 4 111035 60.168.51.125 1 1 3578 20231228130724 178.176.72.183 2 2 12201 20231207002750 86.159.177.233 2 2 18648 20231211200355 45.26.217.61 1 1 12131 20231228211836 90.192.39.51 3 18 4998143 20231204205703 86.177.252.231 2 19 5035093 20231229194923 18.205.56.153 1 1 3762 20231221225032 3.85.214.237 1 1 2690 20231220202329 86.173.95.48 3 47 10097235 20231224101627 85.255.234.234 2 4 117963 20231219174255 148.252.140.252 2 4 75231 20231220160625 44.233.28.224 1 1 3779 20231205173521 211.249.218.1 1 1 3559 20231203184918 44.201.70.77 0 2 14374 139.180.224.59 0 2 14460 52.56.62.234 0 3 112490 31.94.60.54 2 2 7988 20231206213129 77.101.67.236 1 18 5031833 20231209141436 185.161.186.133 1 1 12131 20231216065342 128.90.145.21 2 2 12208 20231214142954 45.141.237.36 1 1 3769 20231214131101 82.132.225.136 1 1 3766 20231208073855 175.144.198.225 1 1 12131 20231207023623 31.94.74.10 2 10 122910 20231218162148 185.201.140.245 0 1 165214 45.156.128.7 1 1 3793 20231217075850 116.203.44.248 1 1 13923 20231221072204 104.28.209.51 1 1 13975 20231216060741 35.91.193.30 0 1 9467 81.129.185.89 7 25 14971780 20231227154453 40.94.28.83 0 7 45158 82.15.38.157 83 981 200778504 20231230112149 31.94.60.155 2 4 58307 20231216233219 92.49.178.245 2 2 12208 20231218172100 172.56.193.177 2 4 9475 20231214221210 104.28.30.138 0 7 4963248 205.210.31.153 1 1 13648 20231216155324 188.134.80.97 1 1 3708 20231203013530 139.180.143.197 0 5 14498130 159.223.46.52 0 1 6415 109.153.62.254 7 58 34743055 20231217064950 92.3.33.146 31 76 5662949 20231226211647 82.132.214.240 2 26 9942952 20231229143346 64.137.91.6 0 1 165214 92.18.214.101 6 121 25595533 20231227204753 82.10.53.71 3 11 315771 20231208173925 86.186.160.129 1 18 5030717 20231202122105 86.156.108.34 1 4 27960 20231210100200 148.252.132.55 4 52 20011299 20231206215551 90.214.128.92 6 14 29646 20231231232940 5.64.147.215 3 37 10067870 20231209211526 86.189.181.111 4 18 19883258 20231210124413 202.239.5.42 0 1 22531 86.149.154.248 9 73 5621761 20231230124000 128.199.252.119 0 5 4836397 31.94.5.149 1 1 11166 20231201231501 148.252.128.46 2 8 20985 20231205122351 64.137.91.172 0 1 165214 162.253.68.179 2 2 7593 20231225131505 54.184.78.75 0 2 21939 139.59.232.249 0 5 20003 207.148.127.232 0 2 23185 86.134.36.148 14 31 376953 20231214172534 128.199.220.150 1 4 4961231 20231207224612 159.255.188.134 2 2 12208 20231231220633 202.239.5.44 1 1 4007 20231218173609 81.108.179.174 1 24 5107237 20231227082054 31.94.12.72 3 7 162011 20231202002832 108.129.14.165 1 1 8941 20231211230018 78.86.38.97 1 1 3676 20231206085337 52.3.231.146 0 1 13806 154.9.23.37 0 1 28267 31.94.24.31 1 18 5034635 20231206173816 31.94.60.28 3 27 5065156 20231231093707 198.244.141.237 1 1 4614 20231223061448 34.148.113.40 1 24 5158036 20231205044901 104.28.89.82 5 65 10569498 20231209114417 86.162.86.228 2 25 5145185 20231219183148 207.148.123.47 1 6 125257 20231207151532 82.19.12.65 1 18 5031513 20231208191202 3.239.117.190 0 1 1286 20.169.49.172 1 1 3608 20231222013040 138.229.103.89 1 1 4671 20231207192804 85.113.47.102 2 2 13046 20231223060919 45.77.26.49 0 1 6415 54.188.104.225 0 1 75586 130.44.212.122 0 1 12838 190.123.226.109 4 4 24416 20231216163711 148.252.140.150 5 7 154853 20231213160853 31.54.218.28 8 34 14830364 20231231101203 85.89.184.87 1 1 12131 20231216160236 31.94.67.211 3 7 19793 20231215205627 169.255.189.105 1 1 13719 20231206054106 85.255.234.175 2 25 5161772 20231205154044 138.199.21.207 1 24 5107303 20231229152529 5.65.11.179 45 90 5839965 20231230211541 192.0.102.138 0 1 93594 104.28.40.85 11 39 10008101 20231224194420 8.219.143.77 2 2 20182 20231226165623 202.239.4.173 0 2 1575 118.200.239.129 0 1 100391 114.110.128.141 0 1 12838 188.74.182.185 0 1 100391 86.8.252.221 1 18 5031513 20231208220531 104.28.30.20 2 20 5047812 20231208144236 139.59.240.214 0 4 139370 89.240.130.120 2 13 5178131 20231202045826 207.148.69.107 1 4 307488 20231203071257 2.28.249.237 1 20 5080888 20231231151900 192.0.114.49 0 1 86523 196.242.200.209 4 4 6036 20231227112829 54.176.67.103 1 1 13439 20231209160808 2.24.127.148 5 47 10179552 20231212235528 95.150.195.129 13 82 15588609 20231209014352 84.68.110.140 2 2 14732 20231223075305 31.13.127.19 0 1 10888 92.40.218.227 1 1 3685 20231212124255 198.245.67.26 0 1 568 105.96.10.201 33 33 135828 20231211081106 142.93.209.213 1 1 3578 20231227160856 104.28.30.149 1 26 5041951 20231213231427 54.188.57.58 0 1 14343 128.83.144.108 0 1 12838 92.40.216.189 2 2 15263 20231206141351 54.202.7.37 0 2 70257 57.129.34.74 1 1 4170 20231222042638 130.44.215.252 0 1 10623 51.191.161.49 1 18 5035900 20231224133433 185.222.58.82 2 2 7586 20231217054558 89.104.100.255 0 1 244872 146.190.107.113 0 2 14160 198.244.140.28 1 1 3993 20231227235854 138.68.180.18 7 7 29720 20231229063922 220.64.105.254 1 1 3721 20231222020313 31.173.83.56 3 3 21976 20231218075816 94.25.225.4 5 5 49612 20231229012143 31.94.24.153 1 3 47045 20231219184530 104.28.30.143 1 16 5032661 20231215172821 199.45.154.51 1 1 3793 20231217031550 77.99.135.175 12 43 5368795 20231228090912 138.199.36.232 3 3 26058 20231227145809 78.32.66.237 1 18 5031331 20231206140814 37.204.161.9 3 3 24339 20231209194946 194.81.239.187 2 2 13971 20231211092541 92.40.217.87 1 14 4915704 20231219181105 168.91.35.34 0 1 20214 85.255.233.37 1 2 14551 20231222162500 8.219.6.41 1 1 10153 20231226034416 86.152.160.93 2 3 187312 20231202212237 101.44.249.242 0 1 9467 151.228.110.96 1 1 4844 20231208191757 149.28.136.115 2 2 12208 20231216001615 64.137.112.175 0 1 100391 82.132.227.49 3 15 171498 20231209200500 146.90.90.159 85 1412 292324057 20231231151741 104.28.86.115 1 24 5095111 20231229220723 119.63.195.252 0 1 9467 92.40.218.155 1 1 12424 20231230103630 18.218.22.39 1 1 8997 20231210094434 174.138.27.21 1 5 9807 20231201195416 90.205.46.222 4 29 5226403 20231206203933 94.25.171.5 3 3 34036 20231213110140 85.255.234.141 3 31 60204 20231216083414 64.137.68.97 0 1 168318 41.0.128.250 1 1 2947 20231218012043 104.222.186.98 0 1 100391 51.187.251.120 50 115 15660258 20231230194935 193.188.20.96 60 60 507342 20231230050609 78.86.33.48 2 2 11024 20231226024539 40.94.100.77 0 5 9932 31.94.38.210 1 1 3769 20231213153145 34.23.150.84 0 1 244872 35.89.129.224 1 1 3622 20231201234657 199.34.83.112 0 1 20214 172.98.190.255 1 1 3650 20231214112614 91.196.223.214 1 1 3737 20231202092450 34.75.95.45 0 1 9467 89.22.235.136 64 64 542776 20231230053530 82.132.224.112 1 3 4946768 20231204174858 139.180.158.163 0 4 26552 8.217.189.251 0 1 8777 104.234.53.219 0 1 12838 84.33.21.18 0 1 100391 31.94.56.163 0 4 1783 208.113.197.86 2 2 12208 20231228205356 103.230.14.118 1 1 3368 20231210195638 178.67.184.30 2 2 12208 20231220074651 82.132.238.175 2 2 18918 20231218113353 52.124.19.25 0 1 6415 52.56.62.230 0 1 568 145.224.65.96 1 4 57849 20231208064029 45.154.138.133 1 1 12131 20231203113206 104.168.99.209 2 2 7156 20231225192347 143.137.148.112 1 1 12131 20231228204551 31.94.67.208 1 1 3519 20231215162939 82.7.148.150 7 65 15309074 20231204220012 31.94.6.32 0 3 1082 159.8.110.197 1 1 8951 20231231222903 86.190.85.1 7 108 20620946 20231231092233 86.142.0.129 71 73 618342 20231206222315 46.8.156.188 2 2 12208 20231215063633 86.134.227.193 2 26 5142725 20231220110952 185.69.144.183 8 31 10104190 20231210092521 193.111.180.230 11 21 170359 20231228160919 86.133.203.148 2 27 5151832 20231212134923 18.116.240.122 1 1 11371 20231217032957 80.42.58.8 4 23 5096326 20231231101331 34.236.187.131 1 1 3046 20231221211815 31.173.82.31 4 4 34113 20231202195532 85.255.233.201 1 4 44406 20231205164318 82.132.218.147 1 11 36633 20231223200741 46.240.68.186 2 9 65017 20231214053456 154.9.22.85 0 1 165214 148.252.133.157 5 10 126619 20231226162427 38.154.160.59 4 4 6048 20231227063150 98.162.25.29 2 2 12208 20231228132150 31.94.64.157 3 3 34011 20231218170638 86.155.135.50 1 18 5029963 20231209214559 101.44.250.176 0 2 36542 202.239.4.82 0 1 1286 64.137.64.83 0 1 100391 154.13.11.178 0 1 165214 199.58.185.9 2 2 12208 20231204033027 89.22.235.74 60 60 507324 20231230051555 104.143.227.86 0 1 165214 202.239.5.115 0 1 1286 40.94.93.13 0 2 11131 59.82.21.56 0 1 10279 23.236.178.217 0 1 568 84.17.51.19 3 3 26078 20231231140522 45.32.139.97 0 2 4832192 182.22.30.13 1 1 3827 20231209110821 64.137.112.14 0 1 165214 54.202.137.216 0 1 29325 104.28.40.143 6 65 24931631 20231209142531 87.80.83.74 26 214 41325797 20231231101747 148.252.132.153 3 15 5021088 20231202164316 52.56.62.220 1 3 6085 20231212104758 113.165.48.28 3 3 19724 20231231230714 8.219.173.83 1 1 4929 20231212155024 77.102.248.230 10 95 30089984 20231228211726 8.219.135.50 1 1 3557 20231222124931 162.83.128.166 24 44 431345 20231219232313 147.28.113.225 1 20 5077288 20231203093436 216.213.29.143 0 1 6415 2.228.138.61 2 2 13235 20231210160140 40.94.28.40 0 2 4838253 52.18.14.182 1 1 11111 20231218235925 45.8.19.35 1 1 2947 20231215121514 18.218.189.56 1 1 3488 20231220184509 86.169.154.234 4 43 10216079 20231207183327 104.28.86.59 2 25 5114008 20231222220451 66.220.149.6 0 1 22295 182.22.30.69 1 1 4623 20231219192333 31.94.36.159 3 4 28099 20231213000732 143.198.201.38 0 4 37930 78.105.82.164 2 19 5036677 20231209191127 5.81.113.0 16 62 10323320 20231215144826 82.132.226.12 3 3 31493 20231218122718 54.195.14.13 1 1 4173 20231204184700 86.149.116.173 26 53 10072231 20231231094301 154.7.26.77 0 1 22295 31.94.18.1 3 17 4974105 20231202171038 198.235.24.77 1 1 14581 20231205171636 34.73.188.184 0 1 244872 92.40.169.221 1 2 13648 20231230150542 149.56.150.24 17 17 372669 20231211210654 15.235.47.79 1 1 3852 20231227021955 104.28.86.112 5 15 212573 20231222220027 34.148.60.104 0 1 32718 183.230.67.252 4 4 14571 20231231024854 82.132.212.25 2 2 6915 20231201120327 52.56.62.192 0 1 1483 221.204.227.2 3 3 41820 20231203205654 65.108.226.48 1 1 3675 20231212091320 54.210.85.167 2 10 209758 20231215082112 81.135.113.34 6 10 123592 20231211072803 145.220.91.19 1 1 3713 20231214120608 82.132.227.34 2 4 50995 20231206035345 154.30.58.219 0 1 165214 199.15.238.81 2 2 7532 20231207110614 185.215.160.27 1 1 12131 20231206221112 8.219.245.129 1 1 12077 20231212182305 192.0.96.187 0 1 175848 104.37.135.145 1 1 12131 20231206090914 195.141.133.77 0 1 12838 13.59.237.62 1 1 3023 20231214181412 84.165.177.128 2 2 0 20231226161158 173.252.107.10 0 1 10777 139.180.145.47 0 4 9850 44.229.249.215 0 1 244872 109.107.172.122 10 10 61848 20231218210632 54.188.51.80 0 1 244872 40.94.100.75 0 2 11478 38.154.1.28 0 1 20214 31.94.57.195 1 5 4957697 20231217213820 93.124.38.252 4 4 36464 20231217235008 178.157.102.143 0 1 32135 119.63.195.206 0 2 22192 104.167.0.165 0 1 255655 198.50.207.20 1 1 3591 20231231180119 2.127.9.82 3 20 5041201 20231208164457 2.221.239.181 90 152 166104245 20231212180429 82.132.224.131 2 5 51425 20231208124149 80.41.54.92 1 1 12131 20231216010000 36.110.131.135 0 1 23978 179.43.182.206 1 1 3488 20231220201132 82.132.214.109 1 18 5034635 20231220202737 3.236.22.200 1 1 3620 20231221061937 52.114.75.216 0 1 244872 31.94.37.181 1 1 3678 20231201185138 82.132.227.104 2 2 7102 20231206062258 219.135.97.88 4 4 14571 20231231024826 81.105.95.32 3 5 54855 20231224072627 104.28.86.79 1 8 4923636 20231227080840 148.252.129.72 1 4 32179 20231230144350 175.44.42.205 1 1 3711 20231207194953 122.180.183.179 2 2 3198 20231212170746 59.102.124.44 2 19 5036107 20231229213752 82.19.117.88 1 20 5157151 20231203172538 86.186.145.222 0 4 111035 156.246.5.101 0 1 161253 94.195.3.182 1 1 3848 20231217074621 154.95.34.12 0 1 165214 94.174.132.17 1 23 5104030 20231211095948 207.244.252.60 2 2 8031 20231219235815 110.93.150.130 1 1 2713 20231229012322 92.40.214.139 1 18 5031513 20231208203352 34.139.194.3 0 1 244872 31.94.7.146 1 17 259054 20231209190237 152.70.204.217 0 1 8613 101.44.248.236 0 1 10128 78.150.79.105 17 283 51696781 20231231234255 86.162.238.50 1 24 5107313 20231229103204 31.49.108.86 1 20 5075393 20231213182747 37.19.223.232 3 3 27671 20231223072824 148.252.132.47 4 14 4954006 20231231150802 31.94.26.95 0 3 1082 145.224.65.156 5 19 138216 20231231191132 64.137.68.188 0 1 165214 2.123.248.87 2 2 17994 20231207075218 167.98.155.88 1 15 5029848 20231226095241 82.132.216.130 1 1 3776 20231215133758 194.35.122.203 2 2 7129 20231205095108 60.188.11.27 0 2 21500 101.44.250.99 0 1 53689 110.93.150.25 1 1 3898 20231230163826 5.196.78.232 2 2 12208 20231228145049 202.149.67.98 2 2 12208 20231215160520 1.140.65.217 7 66 15196056 20231230003005 39.103.187.166 3 3 7546 20231218120700 69.63.189.11 0 1 1495 148.252.140.232 3 13 4929412 20231209130335 110.93.150.45 0 1 13806 82.132.247.27 1 18 5031644 20231229171943 110.93.150.77 1 1 3489 20231203001210 154.95.34.130 0 1 165214 171.247.246.31 1 1 12131 20231216011815 45.141.236.14 2 33 10061428 20231208214514 45.76.146.244 2 4 11453 20231209193738 8.219.119.214 1 1 4818 20231212150448 82.132.233.161 1 22 5087804 20231207072842 176.58.120.182 2 2 12208 20231216004334 93.70.86.7 1 8 111310 20231217175507 104.167.0.135 0 1 165214 82.132.225.5 1 1 3635 20231228192659 78.86.129.72 4 27 5118368 20231229181224 195.224.152.90 1 1 3725 20231203162323 178.128.121.55 1 4 4878206 20231201150558 34.74.211.254 0 4 193778 90.219.247.236 17 189 45829444 20231229180558 140.205.47.241 0 1 10623 176.212.72.42 4 4 34113 20231211214309 13.51.158.61 1 2 17575 20231213135305 84.33.21.216 0 1 100391 139.162.56.175 1 1 13856 20231224223344 65.109.82.91 1 1 3975 20231212003901 35.173.224.162 1 5 106723 20231215053310 92.40.170.154 1 1 3635 20231228112403 36.110.131.190 0 1 4965 66.250.219.24 3 3 10773 20231231074144 145.224.65.4 12 26 203136 20231226182512 82.132.225.130 1 2 14434 20231220164506 212.33.248.45 1 1 12131 20231224104828 176.116.21.165 8 59 5633662 20231212153112 31.94.36.37 2 15 4978065 20231219160008 101.44.248.11 1 1 10855 20231229211713 92.40.219.89 1 5 4979170 20231222090913 47.202.78.126 6 29 331081 20231208223553 82.132.227.64 2 3 17251 20231230183952 114.111.32.64 1 1 4390 20231202233919 159.89.199.14 0 4 119125 117.57.37.75 1 1 3578 20231225174652 86.158.102.92 1 2 23925 20231207224759 31.94.64.82 1 8 164104 20231207171234 90.203.30.254 33 43 511140 20231209212226 82.132.228.140 3 17 162166 20231204161149 66.249.84.68 0 1 244872 35.185.53.0 0 1 10128 78.86.166.77 3 26 5170018 20231204182056 109.145.176.54 1 18 5031833 20231209140628 185.180.143.141 1 1 3578 20231225011843 31.94.5.230 1 18 5031090 20231227194721 46.33.131.240 4 16 9863117 20231216134935 207.148.72.145 0 2 21697 109.154.150.113 1 18 5031513 20231208161700 176.53.222.96 1 1 3578 20231227193816 82.132.235.119 3 5 43569 20231223150029 45.88.223.151 1 1 71 20231218224344 139.180.4.5 0 1 921 20.254.131.181 1 24 5107306 20231229162041 8.219.83.66 3 3 23895 20231228192255 52.56.62.224 0 1 13806 90.201.41.0 1 24 5107237 20231226135129 107.189.8.181 1 1 3765 20231205105234 109.107.176.19 4 4 24416 20231221210827 139.180.191.32 0 4 65158 31.94.36.157 4 4 33071 20231213074446 104.167.0.136 0 1 100391 64.137.68.102 0 1 165214 52.56.62.204 0 2 7069 14.137.139.48 0 3 72430 86.167.131.238 1 18 5030708 20231204200350 92.40.215.205 1 1 3740 20231204180902 2.120.72.120 1 18 5030488 20231225181323 81.110.120.239 27 115 15804982 20231231121909 3.129.206.220 1 1 3488 20231220184509 57.128.30.177 2 2 8565 20231224181213 38.15.159.2 1 1 2947 20231204044933 52.56.62.190 0 6 89523 86.144.24.247 17 165 30990531 20231220230046 45.248.143.6 1 22 5139522 20231203072929 82.132.246.67 1 3 14974 20231211133516 36.110.131.26 0 1 23355 176.53.223.37 0 1 244872 49.51.188.167 0 1 9467 68.183.227.247 1 4 117179 20231201210006 45.97.135.56 2 27 5105737 20231231084418 13.40.27.91 4 27 5109850 20231215215230 31.94.66.61 11 23 350090 20231209115516 139.180.216.128 0 4 22032 13.58.172.248 1 1 4378 20231217075251 44.242.168.215 1 1 3578 20231226035548 213.219.247.57 60 60 507318 20231230052718 85.255.235.112 1 4 41739 20231225115926 45.77.36.130 2 6 166324 20231210145157 209.251.20.57 0 1 13806 85.255.235.54 1 4 47649 20231205212405 194.35.122.142 1 1 3578 20231226174031 82.132.227.147 2 3 30795 20231203085745 84.71.118.44 32 115 74661329 20231230103014 145.224.65.71 17 25 258981 20231206220957 157.245.53.224 1 1 3771 20231218064641 199.45.155.16 1 1 3532 20231211093011 52.11.36.168 1 1 14768 20231219041318 147.28.117.191 1 18 4978503 20231215181950 152.44.104.14 1 1 3440 20231215061751 82.132.231.107 1 24 5082063 20231215233800 82.132.226.24 1 1 3676 20231206081907 90.195.9.243 1 2 16477 20231209070822 92.40.170.0 1 2 4835429 20231231205447 31.94.64.49 1 18 5031513 20231208145932 206.189.147.251 0 3 20575 202.239.5.55 1 1 3949 20231201140710 211.249.218.6 1 1 4832 20231214173144 84.33.213.168 0 1 100391 98.162.25.4 1 1 12131 20231206214140 216.180.107.10 0 1 20214 45.138.116.235 0 1 165214 82.132.230.181 1 1 3359 20231202142703 192.186.157.97 0 1 654 128.199.216.60 2 2 15763 20231210230233 84.139.30.141 2 2 8162 20231205191432 154.12.98.255 0 1 100391 86.168.57.18 2 26 5078734 20231209095754 34.227.16.75 1 1 11809 20231201113843 37.19.223.113 3 3 26072 20231231034129 92.40.170.135 2 5 4879165 20231223152950 31.94.74.128 3 7 121251 20231209190242 27.44.203.3 0 1 195900 14.137.139.194 0 1 12838 31.94.74.11 3 11 99250 20231201204927 81.129.122.63 17 59 10210002 20231231141040 139.180.154.152 1 5 4859745 20231210133950 31.94.26.243 1 18 5031513 20231208142111 20.127.195.37 1 1 3622 20231201171741 211.27.220.191 16 66 29575061 20231212193609 129.80.6.89 0 5 142663 92.40.168.15 3 3 18417 20231214165726 212.118.254.86 9 15 90048 20231206120517 216.228.125.130 0 1 12838 148.252.128.45 1 1 3260 20231204212007 64.137.91.90 0 1 100391 139.180.185.44 0 1 2073 79.124.8.241 3 3 35955 20231218224203 104.28.40.138 12 81 10480654 20231228203850 165.231.182.93 2 2 12208 20231225083412 45.76.163.107 1 3 5316 20231207155129 104.222.186.229 0 1 165214 106.75.133.98 1 7 113196 20231216195109 104.28.86.100 1 18 5031676 20231219202111 154.37.177.189 0 1 165214 36.110.131.138 0 1 34896 92.1.26.189 7 99 20660327 20231209200220 92.40.216.38 1 1 3793 20231217122734 2.123.232.220 2 25 5161380 20231203205214 54.187.25.54 3 3 60653 20231229141851 66.42.49.108 0 2 14349 148.252.140.83 5 10 81967 20231213192513 81.110.202.110 1 18 5030865 20231204192115 85.255.236.200 13 50 10339573 20231212082521 82.132.232.208 1 20 5105553 20231221134657 82.132.227.30 2 19 5035829 20231231162637 165.120.90.175 1 2 23760 20231220200629 3.15.211.19 1 1 10637 20231217171740 199.45.155.33 1 1 3605 20231210031521 86.142.119.85 1 18 5031513 20231208150204 37.139.53.17 3 3 49163 20231221020628 79.137.248.15 1 1 3673 20231230042822 82.26.152.94 1 18 4887301 20231209144305 34.211.42.166 1 1 3526 20231211112851 18.207.160.228 1 1 2690 20231221020827 162.247.74.27 1 1 77 20231230075347 154.95.34.223 0 1 32135 104.28.40.94 1 22 5087015 20231205085530 84.45.127.113 4 9 178292 20231208102114 45.32.118.167 0 2 23018 207.148.79.140 2 8 142969 20231209193837 5.42.65.65 4 4 25226 20231217070827 54.36.88.170 1 1 3650 20231213164812 45.32.118.115 1 6 139583 20231202185436 85.255.235.13 1 19 5031266 20231213064146 85.250.74.157 1 1 2947 20231221022236 40.94.93.34 1 5 28056 20231227192358 86.26.121.31 2 25 5085999 20231231144145 208.91.67.194 2 2 0 20231209055610 20.59.63.204 1 1 3708 20231203074733 152.44.102.245 1 1 4320 20231215061746 202.239.5.181 0 1 921 184.148.123.46 0 4 85603 101.44.250.26 1 1 4439 20231228141028 152.44.109.2 0 1 1286 92.40.215.102 1 2 25058 20231208153631 78.86.34.56 1 1 3881 20231209091831 156.209.228.50 1 20 5059873 20231231171248 172.225.10.45 1 18 5031513 20231208190212 27.76.199.55 1 1 12131 20231216011819 3.137.177.179 1 1 10057 20231210072654 51.222.158.14 2 2 640 20231224113909 78.86.3.25 2 34 5168997 20231201154449 188.166.107.191 1 1 3578 20231228011249 3.239.115.181 1 1 2522 20231220223802 90.200.54.237 3 6 60365 20231208223859 20.243.123.247 5 5 60928 20231209102642 185.197.74.6 52 52 441322 20231230041657 90.198.128.15 1 1 5164 20231209142146 82.132.227.4 1 1 3741 20231230105715 220.64.105.2 1 1 3396 20231226070314 46.0.56.15 1 18 5030473 20231226123024 4.151.136.56 2 2 696 20231213033229 82.132.186.126 2 24 5188616 20231207120633 212.118.40.21 2 2 13016 20231205083859 82.40.164.209 4 27 5123363 20231202090852 206.189.155.60 1 8 4864876 20231206034645 146.190.57.165 0 1 20214 69.160.160.58 25 48 5190034 20231213121208 3.209.12.220 0 1 568 113.64.105.230 1 1 13856 20231225025628 31.94.64.193 2 4 39390 20231205220937 52.114.77.236 0 2 489744 62.84.96.213 2 2 12202 20231221133620 13.42.54.10 1 1 3608 20231222123704 92.40.198.37 1 20 5115450 20231218065518 104.28.40.147 1 11 159084 20231202103539 104.167.0.231 0 1 100391 86.164.247.118 5 51 10378784 20231209105035 154.55.93.103 0 1 165214 104.222.186.199 0 1 33109 95.148.28.62 2 25 5103642 20231201143009 90.218.127.214 4 35 10108198 20231214162806 82.132.224.228 1 20 5059870 20231231092431 31.94.15.0 13 17 143391 20231229162341 31.166.171.171 0 7 130640 44.192.91.48 1 1 2690 20231221075635 82.40.173.85 12 46 5305982 20231229195905 194.36.96.105 1 1 3113 20231205104102 59.82.21.109 0 1 10623 84.33.213.220 0 1 100391 92.255.0.115 1 1 4699 20231212111944 86.190.13.32 2 25 5085578 20231215013653 140.205.196.133 0 1 30620 8.222.204.90 2 2 17962 20231228074437 217.182.228.56 1 1 4526 20231214112609 119.8.242.214 0 1 10623 157.122.214.103 4 4 14571 20231231024858 90.208.252.202 2 25 5085996 20231231122513 82.132.219.185 3 5 10905 20231226203055 199.127.56.236 1 24 5107256 20231229020559 216.238.76.141 4 4 14338 20231231173343 36.110.131.154 0 1 44993 35.237.83.215 0 1 8777 128.199.220.158 0 3 2208 62.141.44.236 2 2 7185 20231218192451 140.82.6.156 2 2 7402 20231205214357 182.22.30.10 0 1 921 174.58.63.160 2 12 114001 20231216002804 148.252.129.222 1 23 5157811 20231203190120 92.255.52.179 1 1 3835 20231212111954 45.77.251.182 0 4 4866405 8.219.168.35 1 1 9530 20231223234703 31.94.57.149 1 18 5030204 20231213150217 93.124.78.113 2 2 25987 20231227045259 176.224.23.31 0 2 1987 109.168.235.101 2 2 12208 20231201140717 34.138.92.129 0 3 36810 171.248.221.201 1 1 12131 20231228211027 212.80.45.211 3 3 24339 20231211021949 107.181.133.7 0 1 165214 64.23.138.66 4 4 41847 20231214000732 52.56.62.223 0 2 4833911 172.224.226.1 2 25 5150047 20231218193742 202.239.5.20 1 1 3608 20231222225822 31.94.57.21 3 8 70722 20231213074841 54.173.228.92 1 1 3488 20231220170700 31.94.71.165 4 28 5158289 20231222101507 182.22.30.5 0 1 20214 86.149.155.107 1 1 5017 20231209075545 66.220.149.120 0 1 4831838 95.148.94.84 1 18 5031023 20231227194111 31.54.194.77 1 19 5185316 20231213150247 185.137.36.86 1 24 5107306 20231229183440 135.125.96.3 0 2 2719 85.255.232.86 2 4 27581 20231220195310 34.235.138.88 2 10 211442 20231229053112 157.230.251.78 0 5 251194 31.13.127.18 1 9 182172 20231222055746 1.169.121.88 2 2 12208 20231228004011 82.19.112.100 1 18 5031513 20231208203346 104.167.0.214 0 1 165214 109.232.57.62 7 19 246891 20231206125823 167.235.1.20 1 1 14615 20231209011148 150.136.214.114 0 4 84878 92.40.216.35 1 1 3793 20231217125713 109.149.169.67 2 13 9976480 20231203201434 149.88.28.5 1 1 2947 20231204030536 145.224.65.132 4 13 194513 20231219060915 104.28.30.140 1 7 155699 20231215173339 123.6.49.18 1 6 44906 20231219002440 104.167.0.173 0 1 100391 176.252.216.60 1 18 5033840 20231204142533 35.93.51.201 0 1 244872 82.26.207.235 1 18 5035048 20231204155652 167.88.61.92 2 2 7064 20231211013117 18.225.54.200 1 1 9893 20231210195939 45.132.194.57 2 2 12202 20231208223632 84.33.21.134 0 1 28267 104.28.89.70 17 90 15427414 20231229025451 8.222.198.192 1 1 10220 20231207020455 84.67.116.159 2 25 5085996 20231231105043 89.104.111.103 0 1 244872 31.13.127.117 0 1 111246 104.167.0.29 0 1 165214 82.69.26.100 99 481 82961210 20231231150819 94.14.151.186 1 18 5031739 20231215194921 139.99.216.114 2 2 7178 20231228102011 44.201.166.229 5 5 18435 20231204213824 45.133.235.70 1 1 12131 20231224001625 54.186.197.195 10 10 186205 20231216034243 31.94.24.101 1 1 3549 20231230234740 122.13.248.160 1 1 3720 20231216091022 213.175.211.17 0 61 4489 86.160.216.60 8 31 5484753 20231228085823 90.211.142.238 12 40 19817850 20231228082421 196.18.229.202 2 2 3018 20231227091802 171.248.222.146 2 2 12208 20231215210956 35.85.40.113 0 1 10279 115.79.26.196 1 1 12131 20231206182046 64.137.64.206 0 1 165214 129.158.253.200 0 1 9467 138.201.17.213 3 3 29696 20231206153542 40.94.28.78 1 5 31796 20231216144809 199.244.88.232 1 1 3720 20231214231024 149.102.232.71 2 2 13025 20231209011115 64.137.64.37 0 1 165214 38.154.165.22 0 1 1286 45.138.16.222 1 1 17229 20231201234144 68.183.234.163 1 5 39793 20231210230303 202.239.4.194 1 1 4000 20231218155855 82.132.216.19 4 5 32101 20231226123351 149.28.131.134 1 3 6708 20231210133918 146.75.174.28 1 1 3760 20231229161456 45.32.103.64 1 3 5071 20231210145219 209.251.19.5 0 1 921 91.196.223.241 1 18 5031513 20231208153555 66.102.8.131 0 1 244872 104.28.86.51 0 9 4927069 1.9.27.213 1 1 12131 20231216003310 86.166.170.101 1 18 5030881 20231209153233 82.132.225.66 3 26 5188887 20231206195849 109.154.221.20 52 62 517941 20231217190202 151.106.8.100 1 1 12131 20231225053425 3.235.227.101 1 1 3608 20231221235906 148.252.132.174 4 7 43872 20231214163250 92.19.99.155 1 17 4956583 20231224150540 89.149.23.189 3 3 26174 20231207114126 60.210.40.190 8 8 48832 20231228224549 81.129.94.214 1 20 5137856 20231207222953 110.227.255.61 6 6 20457 20231225234220 82.25.53.46 77 109 1067259 20231231203350 34.208.159.126 3 3 16857 20231231233230 149.102.232.69 1 1 2947 20231220123259 185.195.63.8 0 1 165214 14.102.127.50 2 2 6506 20231217170419 31.94.26.244 2 13 4909045 20231213235336 31.13.127.21 0 7 32424 211.249.46.119 1 1 5306 20231230163959 92.40.171.186 2 7 5085507 20231207140202 202.239.5.90 1 1 3589 20231216171313 106.38.226.9 0 1 32478 81.107.70.239 6 63 15265050 20231209005402 103.253.24.29 4 4 41568 20231227145629 31.94.57.247 1 4 65439 20231217001250 63.141.36.147 1 1 4526 20231213164800 90.208.191.85 1 18 5030416 20231217213102 185.168.158.161 0 1 165214 149.28.130.157 0 1 4965 27.115.124.53 0 1 13806 18.207.246.59 6 6 21981 20231216214807 82.132.227.151 2 3 17420 20231220162723 54.88.132.110 1 1 3610 20231205080001 31.94.67.209 2 2 7512 20231214203542 104.248.254.146 1 1 3666 20231204010111 213.219.247.106 78 78 676312 20231230043251 2.221.251.121 1 1 3800 20231206155100 82.132.214.194 2 2 7470 20231212164105 85.255.234.152 6 30 5099233 20231230191323 92.40.215.189 1 18 5031513 20231208144720 74.125.208.14 0 1 244872 66.249.83.14 0 1 244872 85.209.11.117 6 6 51774 20231220140459 84.70.151.120 24 75 60253311 20231213135115 86.180.77.189 16 34 235874 20231208221023 150.230.173.71 0 1 54144 145.224.65.11 4 14 128067 20231215064028 31.94.64.192 2 25 5085865 20231213210256 128.199.142.3 0 1 701 109.70.100.71 3 3 25997 20231219010913 101.44.251.230 1 1 4559 20231231133829 8.219.123.98 1 1 9959 20231226160522 113.101.213.172 1 1 13893 20231221102322 199.34.86.236 1 1 9957 20231215061750 216.41.232.5 1 1 13668 20231215042141 3.234.210.189 1 1 4819 20231221051316 207.182.25.68 0 1 1286 34.219.125.199 0 1 10128 178.128.208.138 0 2 2404 110.93.150.66 0 1 149771 92.40.170.27 1 4 4979412 20231219174527 82.132.226.64 6 9 108410 20231217143936 90.192.34.89 5 29 9942497 20231213141047 86.149.155.120 1 20 5057597 20231211150635 154.13.10.204 0 1 165214 31.94.5.104 1 13 5032463 20231216104123 51.146.28.33 5 25 5103780 20231203100620 185.104.136.50 3 7 66435 20231220064530 92.40.111.92 5 12 5050634 20231231083949 18.222.58.18 1 1 9788 20231213063045 31.94.17.207 1 4 5029 20231207154359 165.22.251.214 15 15 139112 20231231093440 54.245.12.96 6 6 134141 20231228020058 34.139.178.155 1 24 5107256 20231229073002 94.177.131.146 2 2 12208 20231215212116 184.94.240.88 1 1 3816 20231209080252 35.237.116.128 0 2 19873 57.129.34.106 1 1 10339 20231223175351 120.18.165.121 1 21 4937738 20231213043621 90.212.120.150 1 18 5031833 20231209141040 82.132.215.147 2 2 6915 20231201131448 20.107.58.38 0 2 25676 68.183.227.193 1 2 5186 20231210231753 86.132.224.230 1 24 5107313 20231229084042 154.55.89.32 0 1 165214 194.72.241.186 2 34 48698 20231231085354 92.59.187.139 3 26 5133536 20231229223302 82.132.213.93 1 5 13729 20231224172734 14.22.11.163 0 1 12838 145.224.65.12 3 3 19348 20231231123710 86.140.6.149 1 18 5030364 20231212232517 194.88.153.140 23 23 157747 20231228215111 3.81.221.54 1 1 3572 20231204161855 86.148.235.103 2 19 5033397 20231204215648 104.225.142.141 1 1 13856 20231228155647 82.132.227.161 2 8 65031 20231216140332 104.222.186.243 0 1 155435 64.137.64.114 0 1 165214 52.56.62.193 0 1 701 163.152.163.208 0 1 10623 64.137.64.19 0 1 165214 191.101.157.212 2 2 12208 20231224110616 104.28.40.133 2 2 7227 20231203170608 81.144.83.219 8 21 247012 20231220161257 47.245.82.254 2 2 12208 20231211165911 84.129.47.26 1 18 5039299 20231205154826 86.148.19.113 8 146 30897763 20231205154720 193.216.224.108 2 2 12208 20231225225302 2.220.68.18 5 32 291196 20231216154057 104.28.40.139 1 1 15253 20231219065749 57.128.24.5 1 1 4173 20231221161532 104.28.89.52 2 22 5084451 20231226081036 90.218.73.113 1 1 4844 20231209220954 213.1.30.220 2 28 5136776 20231228202402 92.1.76.96 52 536 146915850 20231211230711 89.22.232.186 60 60 507324 20231230042637 176.251.34.99 6 29 5207352 20231208094405 159.89.199.31 0 5 4125 81.105.122.51 2 19 5041437 20231226215226 185.197.195.30 0 2 206232 77.99.188.171 1 18 5031513 20231208203351 84.139.12.227 2 2 9959 20231224061217 77.34.139.6 1 1 3527 20231213011344 98.71.25.189 2 2 13037 20231219072210 64.137.112.83 0 1 165214 151.253.170.173 1 16 193230 20231227183319 62.232.33.62 26 40 332016 20231225202026 98.158.95.110 0 1 10128 31.94.12.111 2 2 15108 20231202144857 119.8.243.113 0 1 14343 51.186.253.158 8 123 25749669 20231211201249 90.208.52.51 2 2 11370 20231202112951 216.173.73.67 0 1 165214 185.195.63.185 0 1 165214 154.95.34.59 0 1 165214 165.154.224.222 5 5 18476 20231228213914 31.94.36.66 1 1 7577 20231202111641 12.219.85.62 2 2 12208 20231216002157 38.170.4.37 0 1 6415 82.132.217.26 2 9 160156 20231207213313 107.23.134.161 0 1 13806 113.160.132.215 2 2 12208 20231228204301 31.94.36.210 2 30 37343 20231222110633 18.205.41.210 1 1 3488 20231220191720 80.44.55.244 8 26 5077519 20231208204640 104.28.89.72 4 4 15043 20231219070641 154.7.191.143 0 1 100391 192.71.2.9 1 1 3368 20231210194313 87.115.243.208 3 9 5028708 20231223095505 62.119.167.36 0 3 42346 34.209.46.14 0 3 75185 37.188.40.202 3 3 25997 20231219122703 185.253.42.242 2 2 12208 20231217232534 183.88.135.105 1 1 12131 20231215215449 195.234.109.4 0 1 163964 8.219.198.76 1 1 8552 20231227220701 51.38.245.48 1 1 3707 20231214112610 5.69.142.184 1 2 248556 20231204185642 86.133.75.39 2 25 5125300 20231210175657 131.153.143.50 16 16 58842 20231222141411 194.36.98.200 1 1 2947 20231201052937 52.12.78.112 0 1 11096 185.241.224.162 2 25 5166277 20231203171020 159.223.41.199 0 1 4831838 3.86.80.209 8 8 29468 20231210123350 51.75.121.63 2 2 12208 20231228140441 172.224.227.2 1 18 5031545 20231213021504 211.249.46.36 0 1 13806 66.42.70.209 0 1 10565 178.128.51.91 0 2 4852052 104.28.30.144 0 7 4877678 212.231.197.29 1 1 12131 20231206203320 92.40.170.146 4 16 5012904 20231214165520 37.19.223.222 3 3 26174 20231207043434 89.22.234.115 60 60 507330 20231230042122 202.239.4.72 0 1 654 49.178.181.231 1 1 3766 20231207115939 31.94.57.150 1 18 5031239 20231228131214 8.222.165.101 2 2 12208 20231228125637 2.217.5.235 6 14 142795 20231214215255 92.1.79.11 9 147 30647257 20231231192546 86.141.23.110 2 46 10227911 20231229231732 66.249.93.77 0 1 244872 31.94.25.19 3 5 39505 20231223123547 2.120.119.159 13 122 30021396 20231231115810 202.239.4.219 0 1 13929 65.154.226.166 1 1 4143 20231206141648 84.33.21.15 0 1 165214 104.28.89.49 1 10 15333 20231228114552 82.147.85.78 8 8 50503 20231229060052 199.250.188.38 0 1 1286 101.190.183.192 75 542 117413558 20231231231507 185.69.144.5 9 12 125169 20231217233727 78.86.134.191 1 2 5736 20231222163931 54.188.66.243 0 1 12838 86.137.75.206 10 26 5333059 20231221214706 103.146.197.43 2 2 12208 20231216015916 92.40.219.137 1 1 3488 20231220183158 213.244.248.48 0 3 206423 27.46.103.131 0 1 11986 66.249.88.230 0 4 979488 52.56.62.196 0 1 185 139.180.223.88 1 5 4857177 20231203132245 183.136.225.46 1 1 13975 20231214221036 38.15.158.221 1 1 4681 20231211170707 146.66.177.93 1 1 14612 20231230130955 46.0.203.140 3 3 35880 20231216062517 2.122.190.37 1 15 5029915 20231208142735 180.76.14.137 0 1 8777 80.41.79.22 5 28 5173076 20231202222241 140.205.41.241 0 1 30620 202.239.5.152 0 1 568 139.162.238.184 2 2 12208 20231215231133 31.54.30.223 2 17 5053905 20231231131244 8.217.189.75 0 1 32718 90.210.246.34 74 264 263067860 20231230205123 31.94.24.48 1 1 3837 20231205162722 89.22.235.226 64 64 542788 20231230043943 94.1.183.73 1 4 31856 20231215125845 45.77.33.23 1 5 7233 20231207224547 219.151.138.203 4 4 14571 20231231024842 86.131.47.75 91 290 32178791 20231223095108 34.239.153.100 1 1 9800 20231205184711 192.42.116.189 2 2 28288 20231201234030 31.94.36.67 1 1 3793 20231202111630 34.75.58.162 0 1 244872 34.148.119.201 0 1 49154 82.26.164.2 6 97 25235088 20231216070938 84.68.178.168 2 2 13816 20231201080730 54.217.60.207 5 12 66732 20231218180142 169.255.139.153 1 1 3666 20231204075333 212.103.125.48 2 2 13046 20231223105033 151.227.184.129 2 27 5169510 20231230014402 34.148.88.6 0 1 244872 198.13.43.42 0 1 10777 45.77.246.143 1 5 29553 20231208034305 86.178.229.104 3 25 5003469 20231207154746 191.101.31.172 2 2 12208 20231228223457 64.62.243.165 1 1 3654 20231229030935 93.124.58.139 7 7 63173 20231230153257 154.38.35.234 0 1 165214 178.176.80.2 3 3 24333 20231230163654 114.111.32.86 0 1 654 172.96.81.174 0 1 921 141.148.47.144 0 5 100399 81.163.253.142 4 4 24416 20231231085512 185.221.32.183 4 4 25239 20231212224453 192.210.224.172 0 1 921 54.201.116.46 0 1 30620 39.173.105.156 0 1 20214 139.59.227.173 0 2 1111 82.132.225.78 2 27 5171319 20231219121657 46.208.170.242 2 19 5130850 20231210005323 END_VISITOR # Date - Pages - Hits - Bandwidth - Visits BEGIN_DAY 31 20231201 1303 2826 371748880 216 20231202 762 2143 348116759 198 20231203 459 1650 341929058 205 20231204 461 1858 368429863 205 20231205 461 1839 362711497 217 20231206 512 1713 351498607 224 20231207 372 1574 287954968 184 20231208 633 3277 712298387 294 20231209 531 2427 514973853 256 20231210 384 1560 328386246 186 20231211 407 1537 308221208 189 20231212 4126 5186 345567207 191 20231213 416 1600 326020929 188 20231214 1131 1887 259628785 158 20231215 791 1919 305700650 181 20231216 368 1427 249315695 179 20231217 302 1283 272676467 153 20231218 426 1285 253605262 178 20231219 349 1570 313997789 167 20231220 257 1052 225252681 162 20231221 474 1208 217744913 179 20231222 278 1027 200817489 155 20231223 253 1136 212300038 130 20231224 10253 11000 348222325 153 20231225 166 679 153485672 98 20231226 365 1269 260847462 177 20231227 495 1670 326111459 159 20231228 304 1311 261513660 187 20231229 2175 3431 336107122 196 20231230 7491 8583 400704059 208 20231231 3062 4499 407470016 199 END_DAY # Session range - Number of visits BEGIN_SESSION 7 30s-2mn 432 5mn-15mn 182 0s-30s 4394 15mn-30mn 128 2mn-5mn 411 30mn-1h 174 1h+ 51 END_SESSION # URL - Pages - Bandwidth - Entry - Exit # The 25 first Pages must be first (order not required for others) BEGIN_SIDER 19952 / 4462 18480925 3424 2223 /latest-fixtures 1100 10381683 270 633 /contact 814 4889777 62 412 /home 651 2577624 413 313 /contact/ 567 4118771 313 300 /fixture-board-advertising 362 3511936 2 13 /news/551a96dbac679/ 307 3470886 307 6 /news/glebe081223 273 1408916 156 199 /isthmian-league 171 1052462 25 36 /southern-counties-east-football-league 155 926300 18 64 /news/becklitt301223 109 1143670 12 60 /news/eritrams171223 105 1425404 8 67 /news/eritlitt201223 105 1247181 12 63 /news/hythwhit121223 105 1181621 8 54 /news/lingdeal021223 102 1090977 4 53 /news/tunbcori231223 99 1317706 11 58 /news/phoeashf161223 94 1084062 10 56 /news/eritrust051223 91 742360 6 51 /news/fishbear091223 86 1033339 7 38 /news/lordswood011223 85 349623 5 47 /news/crayhari101223 81 888440 3 46 /news/margate061223 72 318810 4 39 /news/crayenfi291223 65 558942 3 35 /news/doverathletic051223 63 256127 4 28 /news/lordswood041223 62 287187 12 24 /news/kentleague/deal/Sampson4.html 1 0 0 0 /news/551a9c919a7ba 2 17194 0 0 /national-league/www.heineken.co.uk/www.heineken.co.uk/ 1 4852 0 0 /news/itwouldbeadreamtogetintotheplay-offssaysmcmahon 1 18737 0 0 /news/drmartens/eastern/tonbridge/16thnov04.html 1 0 0 0 /news/phoenixsports180119 2 27020 0 0 /news/hollands&blair120920/ 6 78675 6 6 /news/551bc5dd537cc 2 20015 0 0 /news/wellingtown301117 1 11931 0 0 /news/18thaug04A.html 1 0 0 0 /news/longhurstpleasedwithcharactershownbyhisnine-men 1 12764 0 0 /news/35-daybanforswearingisalittlebitharshbemoansburman 1 17571 0 0 /news/jonmainiskeentogetbackinvolvedsaysramsgatebossjustinluchford 1 14482 0 0 /news/29thmay04A.html 1 0 0 0 /news/budgetcutsmakelifedifficultfornewmargatebossashby 1 13359 0 0 /news/551a95b3c0658 3 28188 0 0 /news/tonbridgeresidentobrienguttedtobeleavinghamlet 1 12832 0 0 /news/weknewwehadadecentchanceofgoingthroughinthefirstgamesaysdisappointedbradbrook 1 17294 0 0 /news/ithoughtwedturnthecorneradmitsfisherbossstevefirkins 1 15808 0 0 /archive-2006-2014/89 1 21068 0 0 /news/hawkinsexperiencewillbeinvaluablesaysdaish 1 12224 0 0 /news/vcdathletic0-2afchornchurch-wecouldnthitabarndoorwithabanjoadmitstonyrussell 1 27813 0 0 /news/551bc99a8be18 2 14446 0 0 /news/551a97b1b1dc2 1 14292 0 0 /news/aveley280305.html 1 0 0 0 /news/551a956c25cfe 1 3391 0 0 /ramsgate-2003-2006/4 2 15654 0 0 /news/werestillfindingourfeetintherymanleagueadmitslilywhitesbossjustinluchford 1 16387 0 0 /news/folkestoneinvicta6-1badshotlea-stuartkingsfinishingwastopdrawersaysneilcugley 1 20908 0 0 /news/dartsvisittoashfordhasslimchanceofgoingahead 1 11007 0 0 /news/kentcountyleaguestatement021220 1 13809 0 0 /news/kentcountyfootballleague.co.uk 1 0 0 0 /news/nostonewillbeleftunturnedsaysholmesdalecoachrossmitchell 1 16153 0 0 /news/onthenightthatwhitstablesecuredrymanstatusseagersayswewillmoveforwardnextseason 1 15395 0 0 /news/wewillreviewourtargetsinjanuarysaysfoley 1 20989 0 0 /news/tunwells170804.html 1 0 0 0 /news/doverre-signmainsponsor 1 12906 0 0 /news/wewillgiveeverythingwecantomakesureramsgategive100everyweekvowstimdixon 1 12120 0 0 /news/drmartens/eastern/chatham/23rdjuly03.html 1 0 0 0 /news/trottfacesinterestingtestagainsthighflyingfleet 1 11007 0 0 /news/soccershortskeithpiperstandsdownasmargateschiefexecutive 1 31458 0 0 /news/551a97b16fcf4 1 17315 0 0 /news/sevenoakstown200222 3 35597 1 1 /news/kentleague/lordswood/15thaug04.html 2 0 0 0 /news/fordthinkingaboutquarter-finals-exclusiveinterview 1 12788 0 0 /news/wp-content/plugins/wp-file-manager/lib/files/abruzi.php4 1 0 0 0 /news/faversham161018 2 27164 0 0 /archive-2006-2014/53 1 20577 0 0 /news/drmartens/premier/welling/11thnov04.html 1 0 0 0 /news/kentleague/tunbridgewells/9thsept03.html 1 0 0 0 /news/wedlovetoseeabigcrowdbackingtheladssaysfisherbossstevefirkins 1 13779 0 0 /news/EbbsKiernan010415 2 15339 0 0 /news/theroadtowembleyeverettsmellscupsuccessforhishome-townclub 1 15787 0 0 /news/bromley070318 1 15784 0 0 /news/dealtown11021 1 13233 0 0 /news/phoenix120118 2 27491 0 0 /news/551a97b133e20 1 14831 0 0 /news/dartford070618 2 14341 0 0 /news/ashford191115 1 15195 0 0 /news/551bc99aab638 2 17000 0 0 /news/551bc5e0c6029 1 20499 0 0 /news/kentleague/deal/Samspon11.html 2 0 0 0 /news/ashfshep100416 2 44892 0 0 /news/sevenerith130218 1 35003 0 0 /news/aveley3-1chathamtown-itsgottogetbetteratsomepointsayschathamtownbosskevinwatson 1 23731 0 0 /news/sitting090915 2 26353 0 0 /news/rymanleaguecupfinalramsgatechairmanreadytostepdownafter20yearsatthehelm-exclusive 1 20300 0 0 /news/kentseniortrophyfinalimtheavramgrantofthekentleaguesaysfirkins 2 26358 1 1 /news/551a967809934 2 20641 0 0 /news/drmartens/eastern/fisher/21stjuly03.html 1 0 0 0 /news/klickitout290516 4 51316 0 0 /news/551a9c92784d1 3 49451 0 0 /news/551a95b42a5f1 3 39852 0 0 /news/soccershortstonbridgeangelsgivetommywarrilowfiveyearstogetintoconferencepremier 1 29720 0 0 /news/bromleyaresingingintherainastheygoelevenpointsclear 2 20041 0 0 /news/ouraspirationsaretoobviouslywintheleaguesaysramsgatebossjimward 1 16183 0 0 /news/13thmay05.html 1 0 0 0 /news/folkestone250615 2 25182 0 0 /news/ashfordunitedbosstonyreynoldsnamessquadtofacecharltonathletic 1 15008 0 0 /news/canterbury030219 1 18408 0 0 /news/tomparkerhasbeenacredittowhitstabletownsayschairmanjoebrownett 1 14617 0 0 /isthmian-league/21 3 46834 0 0 /news/551bc5e625b48 1 14605 0 0 /news/fastatement190320 2 25293 0 0 /news/wevealwayslookedupwardssaystonbridgeangelsbosstommywarrilow 1 14564 0 0 /news/551bc99dbe7a4/kentleague/tunbridgewells/kentyouth/03-04teams.html 2 15653 0 0 /news/551bc5e2935fa 1 14600 0 0 /news/faversham280816 2 29118 0 0 /news/drmartens/premier/dover/harrow231104.html 1 0 0 0 /news/ourrewardistoplayatwembleysaysfleetstarmcphee-exclusive 1 13843 0 0 /news/bromley170821 2 17471 0 0 /news/craywanderers3-0crockenhill-supportlikethatwillmaketheclubstrongersaysjenkins 1 35524 0 0 /news/tunbridgewellsswiftlyappointnewmanagerfromwithin 1 13943 0 0 /news/551a97998e8c4 1 4951 0 0 /news/fcelmstead080521 1 11096 0 0 /news/tonbridge291216 2 26016 0 0 /news/kentleague/deal/1stjuly03.html 1 0 0 0 /news/kentleague/cray/crayvgree061203.html 1 0 0 0 /news/drmartens/eastern/folkestone/worthing231004.html 1 0 0 0 /news/wecouldstillwinthelastsixgamesinsistskinnear 1 12381 0 0 /news/idlovetoseebromleywintheleaguebutiwouldntputanymoneyonitsayshaydenbird 1 18966 0 0 /news/hythetown011121 2 30158 0 0 /news/daishaddsquinntohisdepletedsquad 1 11889 0 0 /news/551bc99b23049 1 4302 0 0 /news/ashfordapologiseforlatecuppostponement 1 11332 0 0 /news/nortonsportskick-offatfavershamtown 1 12704 0 0 /news/margate140119 2 24469 0 0 /news/dartford0-1margate-wedefendedabsolutelyheroically-oconnell 1 20243 0 0 /news/wedliketobeatthatlevelwheregillinghamaresaysbromleyravenettesbossstevepayne 1 16138 0 0 /news/551a96dba0e22 2 14308 0 0 /news/hythe090815 2 26267 0 0 /news/lordswood011216 1 12518 0 0 /news/3gpitchesarethewayforwardsaysvcdathleticbosstonyrussell 2 18740 0 0 /news/551bc5dbc6021 5 59531 1 1 /news/millwalllionesses290921 2 25536 0 0 /news/morganstepsdownfromhernebayoverfundamentaldisagreementovertacticsandteamselection 1 12885 0 0 /isthmian-league/58 3 43199 0 0 /news/croydon3-0sladegreen 1 12837 0 0 /news/breakingnews11pmrymanleagueagmdegeneratedintoalittlebitofmayhem-exclusive 1 14180 0 0 /news/551bc5e77bae5 1 14240 0 0 /news/Resultsmarch2020 3 63532 0 0 /news/wevegottostartperformingsayshessenthaler 1 18601 0 0 /news/kscfinal300415 1 32327 0 0 /news/whitstabletown2-5bognorregistown-welookedlikerabitsinheadlightsadmitsjustinluchford 1 18975 0 0 /news/drmartens/eastern/ashford/19thsept04.html 1 0 0 0 /news/maidstoneunited3-2ramsgate-stonescomebackfrustratesstrugglingrams 4 43566 2 2 /news/dovereagerforfacupglory 1 20258 0 0 /news/551bc99dbe7a4/drmartens/premier/dover/kentleague/lordswood/1stjuly03.html 2 15653 0 0 /news/kentfootballunited220219 1 14671 0 0 /news/20thjune05.html 1 0 0 0 /news/kenthavemademassiveimprovementsinsistscoach 1 13454 0 0 /news/othernews/gotravelkentleaguetables270304.html 1 0 0 0 /news/hayesyeadingunited3-2tonbridgeangels-imnotthrowinginthetowelsaysdefiantwarrilow 1 29785 0 0 /news/wallismadebravedecisiontore-signfordoverathletic 1 13415 0 0 /news/ourluck-andtime-isrunningoutsaysconcernedmargatedirector 1 11609 0 0 /news/doverathleticunveilsigningofhighly-ratedmoore 1 18258 0 0 /news/fisher170417 1 14574 0 0 /news/ivelearntalotthisyearandiwillendeavourtogetthingsrightvowsdartsbosstonyburman 1 17437 0 0 /news/billericaytown2folkestoneinvicta0 2 21374 0 0 /news/551a979a1ecca 1 5770 0 0 /news/knightreadyforthecalmbeforethestorm 1 19229 0 0 /news/sloughtown2folkestoneinvicta0 1 15440 0 0 /news/soccershorts070820 2 31833 0 0 /news/dealtown261015 1 11397 0 0 /news/ifitoldyouihaventbeendreamingofatriptoguernseyidbelyingsayskfubosssammacneil 1 20051 0 0 /news/erithbelv290818 2 14559 0 0 /news/seasonhasbeenalearningcurveformeadmitsmcmahon 1 14454 0 0 /news/kentunited101123 6 47548 1 2 /news/croyholl090316 1 33790 0 0 /news/soccershortsitwasquiteaneasydecisiontojoinincrediblebrightonsaysjamesmarrs 1 21116 0 0 /news/wehavetosetrealistictargetsandstayintheleaguesayswellingunitedbossjamieday 1 16594 0 0 /news/drmartens/eastern/sittingbourne/wivenhoe271104.html 1 0 0 0 /news/wemustputlastyearbehindussayslewis 1 15092 0 0 /news/NationalLeagueStatement200121 2 13982 0 0 /news/551a9c918b565 2 25801 0 0 /news/theresstillalotmoretocomefromuswarnsholmesdalebosshughes 1 20208 0 0 /news/bromley020717 1 13002 0 0 /news/wevegottostartgettingsomepointsontheboardsaysbromleycoachneilsmith 1 18137 0 0 /news/551a97985c314 1 4584 0 0 /news/soccershortsdagenhamredbridgesnapupformerangelsdefendernathangreen 2 29152 0 0 /news/chathamdelightastheyreturnsouth 1 23995 0 0 /news/weretheholdersandwewanttoretainitsayssittingbournebossgaryabbott 1 20887 0 0 /archive-2006-2014/266 2 23400 0 0 /news/551a96dbed70c 1 4147 0 0 /news/soccershortsmarkarberquitsdartfordoverlengthofcontractoffer 1 16594 0 0 /news/rusthall060918 1 15207 0 0 /news/kentleague/erithtown/erithtown.html 1 0 0 0 /news/551bc5e84e4fe 1 11981 0 0 /news/11thsept04.html 1 0 0 0 /news/pitchero.com/clubs/afccroydonathletic/ 1 0 0 0 /news/legendhessenthalerreturnshometogillingham 1 16329 0 0 /news/kentleague/maidstone/10thdec04.html 1 0 0 0 /news/ashfduns300116 2 35032 1 1 /news/onlyhavingoneteamgoupautmaticallyintherymanleagueisharshsaysjaysaunders 1 16051 0 0 /news/kentleague/sladegreen/tunwells191004A.html 1 0 0 0 /news/ashfordtown0-2merstham-lovelltakespositivestobuildon 1 24330 0 0 /news/welling081217 1 12183 0 0 /news/551bc99dbe7a4/drmartens/eastern/ashford/kentleague/erithtown/7thjuly03.html 2 15653 0 0 /news/craywands220218 3 30412 0 0 /news/upbeatseagerplottingcupupset 1 14436 0 0 /news/ournewgroundwillensurethelongtermstabilityoftheclubsayskfubosssammacneil 1 18534 0 0 /archive-2006-2014/77 1 20508 0 0 /beckenham-2003-2006/www.heineken.co.uk/www.heineken.co.uk/ 1 3183 0 0 /news/preseasonresults2021 2 71231 0 0 /news/theresnoteamonthisplanetthatareunbeatablesaysgillinghambossjamesmarrs 1 19150 0 0 /archive-2006-2014/176 1 19222 0 0 /news/maidstone091216 1 14157 0 0 /news/tommysampsonlaunchessuddenexitbook 1 13248 0 0 /news/vcdathletic1-2needhammarket-wewerementallygoneandlackedcharactersaystonyrussell 1 24806 0 0 /news/resultsfebruary2018 4 116662 0 1 /news/twodirectorsstepdownfrommaidstoneunited 1 14802 0 0 /news/vcdathletic5-1beckenhamtown-wedidntshowupinthesecondhalfadmitsshockedjasonclews 1 28212 0 0 /news/resultsseptember2021 2 105549 0 0 /news/doverathletic270820 1 11013 0 0 /news/play-offheroesfolkestonehavegottonamearoadincugleyshonour-sayschairmanwoods 1 21328 0 0 /news/hythetown270320 2 27426 0 0 /news/551bc5df8a8b9 1 13937 0 0 /news/551bc99d35a02 2 21986 0 0 /news/aylemarg011120 6 188113 0 0 /archive-2006-2014/284 2 22400 0 0 /news/gillingham2-1rochdale-jacksononthespotasgillsheadtowembley 1 18470 0 0 /news/rymanpremiertitledeciderwehavetobeatourbesttoremovestainesfromtitleracesaysmoore 1 12487 0 0 /news/ebbsfleet020618 1 13494 0 0 /isthmian-league/50 3 44331 0 0 /news/werefightingfitforfavershaminsistspiggott 1 21319 0 0 /news/favershamunveillucrativesponsorshipdeal 1 15266 0 0 /news/charitybeginsathomeforbrickies 2 13733 0 0 /news/othernews/kentcupdraws0405A.html 1 0 0 0 /news/3rdnov03.html 1 0 0 0 /news/meridian300819 1 13524 0 0 /news/vcdathletic260620 2 23877 0 0 /news/drmartens/eastern/sittingbourne/newportvsitt261003.html 1 0 0 0 /news/551bc5e8e1737 1 14727 0 0 /news/binkssignspottertoaddsomemagictohischathamside 1 11527 0 0 /news/tonbridgeangels0-1maidstoneunited-wevegotsomedifficultdecisionstomake-jaysaunders 1 28081 0 0 /news/itsnotgrimupnorthinsistsmeadsmcmahon 1 19813 0 0 /news/hernebay131204.html 1 0 0 0 /news/beckenhamfacinguptomorebrokendreams-exclusive 1 14789 0 0 /news/wewillbelookingtostaywiththechasingpacksaysramsgatebosstimdixon 1 12909 0 0 /isthmian-league/44 3 44859 0 0 /news/margate010917 2 24819 0 0 /news/551a9718d9330 3 25472 0 0 /news/whereareyougoingthisweek 1 15410 0 0 /news/FAStatement070420 3 33335 0 0 /news/bromley030619 2 17624 0 0 /news/vcdathletic6-0romford-nooneintheleaguegaveusachancesayschampionbosstonyrussell 1 36171 0 0 /news/theproblemiswedontscoreenoughgoalssayscugley 1 15929 0 0 /news/551a97b0a355c 2 30494 0 0 /news/sheppey180817 1 13440 0 0 /news/scottporterresignsafterdisagreementovernextseasonsplayingbudget 2 18040 0 0 /news/551a95b3e8241 3 33326 0 0 /news/beckinghamasksforpatienceashebidstoputtramsbackonrighttrack 1 16280 0 0 /news/theplay-offtargetis75pointssaysbromleybosshaydenbird 1 13787 0 0 /news/weregoodenoughtostayupinsistsashfordbossthorogoodexclusive 1 12887 0 0 /news/ifweplaytoourbestwevegotachanceofstayingupsaysthamesmeadtownbosskeithmcmahon 1 16508 0 0 /news/14thoct04.html 1 0 0 0 /news/wevegotalongwaytogotobeatourbestsaysbromleybossmarkgoldberg 1 14109 0 0 /news/551a92506349a 4 37719 0 0 /news/chathamtownunveilkevinwatsonastheirnewmanager 1 11198 0 0 /news/551bc99dbe7a4/drmartens/premier/dover/drmartens/eastern/sittingbourne/rothwellvsittingbourne20903.html 2 15653 0 0 /news/spriggsreturnstovickerstorunreserves 1 14626 0 0 /news/werelookingforsomecharacterfromtheplayerssayschathamtownassistantmanagerkeithlevett 1 17287 0 0 /news/horsham2-0whitstabletown-ifwegetto40pointsithinkweresafesaysnickysouthall 1 24360 0 0 /news/vcdathletic1-3hythetowncrawfordhelpshythebuzz-exclusiveinterviews 1 18164 0 0 /news/doverstrikeroptsfortakingintensivephysiobutdeclinesoperation 1 11093 0 0 /news/wp-admin/network/xmrlpc.php 1 0 0 0 /archive-2006-2014/42 1 20754 0 0 /news/meridiansearchforanewmanagerwithenthusiasmcommitmentanddiscipline 1 11263 0 0 /news/sportkent170918 1 30693 0 0 /news/brombar140417 2 43247 0 0 /news/folkwalt250316 2 56492 0 0 /kent-county-league/www.heineken.co.uk/ 1 3936 0 0 /news/thamesmeadbeatthebigfreeze 1 10949 0 0 /news/hessenthalerdemandscharacterfromhisteam 1 16780 0 0 /news/itsabouttimeweplayathome-itfeelslikeweretheharlamglobetrotterssaysfisherboss 1 17158 0 0 /news/551a9b4822f9a 4 35228 0 0 /news/pmstatement040617 2 34979 0 0 /news/kentleague/greenwich/3rdsept04.html 1 0 0 0 /news/ebbsfleetunited3-1wrexham-iowealottomyteammatessaysrelievedopinel 1 21733 0 0 /news/weveshownitcanbedonesaystunbridgewellsbossmartinlarkin 2 34317 0 0 /news/dartford130518 1 13736 0 0 /news/craywanderers0-1lowestofttown-craybossianjenkinsunimpressedwithlowestoft 1 19915 0 0 /news/braveheartbarrettruledoutforrestoftheseason 1 13393 0 0 /news/glebe010520 1 15038 0 0 /news/551bc5de296fe 1 16536 0 0 /news/hessenthalerlookstobringinprolificstriker 1 13795 0 0 /news/bromleyfc.tv. 2 0 0 0 /news/sheptunb151021 4 142338 0 0 /news/beaconsfield170804.html 1 0 0 0 /news/cugleyremainsupbeatdespitelosingfourplayers 1 18737 0 0 /news/hollands270817 1 12129 0 0 /isthmian-league/5 5 81941 0 0 /news/tunwells041215 1 13983 0 0 /news/kentleague/thamesmead/18thsept03.html 1 0 0 0 /news/551bc99c89930 2 29464 0 0 /cray-2003-2006/4 3 28554 0 0 /news/551bc99dbe7a4/kentleague/tunbridgewells/conference/margate/margvnorthwich270903.html 2 15653 0 0 /news/dealtown200821 1 13209 0 0 /news/ashfordtown2-1tilbury-weshouldhavewonbymoreadmitswalker-exclusive 1 17288 0 0 /news/dartford120317 2 18120 0 0 /news/551bc5dd9819c 1 11512 0 0 /news/katiejoynes260420 2 23601 0 0 /news/terrorsareinafalsepositionwarnsburman 1 12625 0 0 /news/wemustmatchwhitstablesenthusiasmtoliftcupsaysford 1 12447 0 0 /news/551bc5dee08c8 1 17069 0 0 /news/canterbury201017 1 12880 0 0 /news/hernebay280419 2 25590 0 0 /news/ivecometodovertosucceedsayshendon 1 22737 0 0 /news/sevenroch141015 1 29334 0 0 /news/551bc5e196150 2 21883 0 1 /news/2ndoct05.html 1 0 0 0 /news/iwanttobetopbosssaysmanageresspowell 1 14435 0 0 /news/doncasteraretheteamtobeatsaysmillwalllionessesskipperdionnelennon 2 18437 0 0 /news/itwillbenicetoprogressandcontinueourrunsayscrayvalleybossstevechapman 1 12557 0 0 /news/hastingsunited0-4maidstoneunited-hat-trickheropinnockrepaysthefaith 1 20225 0 0 /news/phoenix240818 2 28895 0 0 /news/cosgroveiwontfailgettingderestowheretheyshouldbe-exclusive 1 15977 0 0 /news/wecertainlycantaffordtolosetophoenixsportsadmitsbearstedbosstonycornwell 1 13871 0 0 /news/iveprobablyhadeightorninegoodplayerscometomewhowanttocomenextseasonsayscollins 1 14350 0 0 /news/drmartens/eastern/sittingbourne/sittvburg170104.html 1 0 0 0 /news/thurrockvbfcfac141003.html 1 0 0 0 /news/doverquashdrydenmoverumours-dulwichsignstrikerbremnerfromcraywanderers 1 13108 0 0 /news/luchfordfumingasfavershamgoofftherails 1 18183 0 0 /news/doverathleticnetkeistercoup 1 12040 0 0 /news/vcdaphoe290423 5 153270 0 0 /news/sheppey040717 1 12852 0 0 /news/10thoct05.html 1 0 0 0 /news/iwillbeadoverplayernextyearinsistsgoalscoringmachinedryden 1 15028 0 0 /news/facarlsbergtrophyfirstrounddraw-1 1 12328 0 0 /news/greensitt161217 1 34035 0 0 /news/5thjune04.html 1 0 0 0 /news/kentcounty/22ndjune03.html 1 0 0 0 /news/favershamtown2-4eastthurrockunited-itwasamissedopportunitytodayadmitsrayturner 1 24382 0 0 /news/wevecomeanawfullongwayinaveryshortspaceoftimesayscanterburycitybosssimonaustin 1 14454 0 0 /news/folkestoneinvicta2-2croydonathletic-jacksonscoresbestevergoalbuttworedcardsmarsgame 1 15593 0 0 /news/wp-content/plugins/wordpresss3cll/includes.php 1 0 0 0 /news/craywanderers0-0leiston-wevehadabadrunathomesoitsgoodtogetapoint-ianjenkins 1 22922 0 0 /news/otfordunited090520 1 11158 0 0 /news/itsveryhardtosellrymanonefootballtolocalbusinesspeopleadmitsdoverdirector 1 13198 0 0 /news/sheppeyunited161023 2 29773 0 0 /news/551bc5dedc57e 1 16338 0 0 /news/7thjuly05.html 1 0 0 0 /national-league/19 2 24953 0 0 /news/enticingofferstowatchthecomebackkingsofkentfootball 1 17524 0 0 /news/wellcauserebelsproblemssayscugley 1 17223 0 0 /news/wewantaclubthatashfordcanbeproudofsayschairmanerniewarren 1 12989 0 0 /news/26thjune03.html 1 0 0 0 /news/resultsjanuary2022 3 149542 0 0 /news/551a95b37b16f 2 13893 0 0 /news/551bc5dbb5fe8 3 32321 0 0 /news/sittingbournemanagerabbottinvitedtowingsinterview 1 18308 0 0 /news/ashford170716 4 25172 3 3 /tunbridge-wells-2003-2006/2 1 14571 0 0 /news/551a979a8fc4c 1 5848 0 0 /news/vcdathletic1-0dealtown-winchcombecelebrates300thappearancebybaggingleaguetitle 1 19550 0 0 /news/folkestoneinvicta011021 2 24381 0 0 /news/resultsfebruary2019 2 91439 0 0 /news/30thjuly03.html 1 0 0 0 /news/kentleague/maidstone/10thjuly03.html 2 0 0 0 /news/27thapr04.html 1 0 0 0 /news/tonbridge100619 1 12399 0 0 /archive-2006-2014/52 1 20799 0 0 /news/greenwich030317 4 30637 2 2 /news/craywands081217 2 16958 0 0 /news/thefleetatwembleywinningistheonlythingonourmindssayskimble-exclusive 1 16408 0 0 /news/hawkinge030516 1 13645 0 0 /news/ebbsfleetunited0-1stevenageborough-theygavemeeverythingsayscrestfallendaish 1 21249 0 0 /news/551bc5de6288b 1 13736 0 0 /news/hopefullywecangetourseasonbackontrackandturnmaidstoneoversaysscottporter 1 15045 0 0 /news/thamesmead050815 2 25250 0 0 /news/formerkentleaguerefereejonathanstonelinesupdatewiththestars 1 14382 0 0 /news/551bc99dbe7a4/kentleague/erithtown/kentcounty/17thdec03.html 2 15653 0 0 /news/winningonopeningdayisallthatmatterssayswellingbossjamieday 1 15923 0 0 /news/kentleaguecupfinalspecialcassiusgivenchancetoshowhistalentsonthebigstage 1 28044 0 0 /news/coldsnapwipesoutalloftonightsfootball 1 10837 0 0 /news/7thmay05.html 1 0 0 0 /news/playingrymanleaguefootballisagoalofoursrevealssevenoakschief-exclusiveinterview 1 17472 0 0 /news/ryman/bromley/bromvwalton060903.html 1 0 0 0 /news/woking0-1wellingunited-wemadehardworkofitbutwereinnextroundsaysjamieday 1 24724 0 0 /news/frenchcompanytoinvest25inmaidstoneunited 1 12528 0 0 /news/longhurstpleasedwithplayersresponsefollowingradbournesresignation 1 17130 0 0 /news/8thsept04.html 1 0 0 0 /news/imgoingtohavestrikerscassandmayattheclubnextseasoninsistsburman-exclusive 1 13763 1 0 /news/wedefinatelywontbetakingeastgrinsteadlightlysayswhitstablebossmarklane 1 13783 0 0 /news/resultsmarch2023 4 173879 0 0 /news/doverathleticbookplaceinlastsixteentokeepwembleydreamalive 1 11523 0 0 /news/551bc99dbe7a4/kentleague/maidstone/ryman/bromley/windsorvbrom090903.html 2 15653 0 0 /news/fleetladiesbolstertheirsquadaheadofcanariesopener 1 14760 0 0 /news/cugleyslamswhyteleafeoverpostponement 1 16188 0 0 /news/worcesetercity2-1greenwichborough-itwouldhavebeengreattobeinthehatsayspaulblade 1 26800 0 0 /news/itscrucialwegetbackontrackintheleaguesaysmaidstoneunitedassistantnickysouthall 1 14659 0 0 /news/margate291115 1 12781 0 0 /news/551a9cf4ed8dd 2 13843 0 0 /news/dockersbossoboylewantsglamourtie 1 13971 0 0 /news/soccershortserithbelvedereunveilthearrivalofplayer-jointassistantaaronlacy 1 29251 0 0 /news/551a979b26d86 1 4535 0 0 /news/whitgraham110515 2 32752 0 0 /news/wevejustdrawntoomanygamesadmitstonbridgeangelsbosstommywarrilow 1 14781 0 0 /news/ryman/bromley/10thnov03.html 1 0 0 0 /news/cugleycastshiseyeoverhisnew-looksquad 1 14639 0 0 /news/parkinsonbidsfortescocupglory 1 15993 0 0 /news/maidstonewillattractbetterplayersinrymanleaguesayshumeexclusiveinterview 1 17903 0 0 /archive-2006-2014/97 1 19998 0 0 /news/tunbridgewells2-3tonbridgeangels-icantfaulttheireffortsayswellsbossdavewilliamson 1 21194 0 0 /news/551bc99dbe7a4/kentleague/sevenoaks/kentleague/cray/kentseniortrophyqf030104.html 2 15653 0 0 /news/lordswood100921 1 12623 0 0 /news/daishwehavearesponsibilitytolookafterourplayers 1 14077 0 0 /news/dockerssufferpenaltyheartacheagainstwells-wholosethreeplayers 2 16443 0 0 /news/ramsgate0leatherhead0 2 15036 0 0 /news/ifwewanttobesuccessfulweneedthesupportheresayswellingunitedbossjamieday 1 14152 0 0 /news/chairmanbenwestmancotthailsfishersgreatestvictory 2 32038 0 0 /news/thamesmeadtownbosskeithmcmahonunveilstwonewsignings 1 11604 0 0 /news/charlton241015 2 16295 0 0 /news/sullivanquitsastonbridgeangelschairmanbutwarrilowstaysonasboss 1 13892 0 0 /archive-2006-2014/264 2 23951 0 0 /news/march2011results 1 74962 0 0 /news/wellchel050519 1 30016 0 0 /news/fleetladiessearchfornewtalent 2 14589 0 0 /news/gillinghampartcompanywithpetertaylorafterfourteenmonthsincharge 1 16890 0 0 /news/kentnon-leaguesoccerfeaturesheavilyinnewsportsmagazine 1 17721 0 0 /news/20thsept04.html 1 0 0 0 /news/551a925075bab 2 25050 0 0 /news/charlton180915 2 16674 0 0 /news/1stjan05.html 1 0 0 0 /news/rusttunw040716 2 18094 1 1 /news/ithinkitsabitsillytosuggestthisisthetitledecidersaysstonesbossjaysaunders 1 20364 0 0 /archive-2006-2014/197 1 18924 0 0 /news/greenwich221217 1 13288 0 0 /news/oldbideh120518 1 31788 0 0 /news/ksports190719 1 13109 0 0 /news/chathamtown1-0godalmingtown-mileshailshislyonsking-exclusiveinterviews 1 30459 0 0 /news/wewillnotthrowallawayourhardworksayslangton 1 15714 0 0 /news/seangloverleavesorpingtonaftertwosuccessfulseasons 1 11991 0 0 /news/craywanderers281221 3 30337 0 0 /news/551bc5de1337b 1 12213 0 0 /news/becksfacingraceagainsttimeexclusiveinterview 2 22926 0 0 /news/bromgate170318 4 66347 1 1 /archive-2006-2014/174 1 19199 0 0 /news/crayhast210922 3 41283 0 0 /news/551bc5e221187 1 17644 0 0 /news/ashfordmustsplashout106000toalleviatewaterlogging 1 12453 0 0 /news/kentleague/lordswood/erith131104.html 1 0 0 0 /news/sevenoakstown120822 2 26775 0 0 /news/tolfreystepsdownasholmesdaleschairman 1 14925 0 0 /news/kentleague/hernebay/greenwich140804.html 1 0 0 0 /news/doverathletic200221 1 12144 0 0 /news/thamesmald150216 2 58882 0 0 /news/kentleague/deal/dealvcrayfav181003.html 1 0 0 0 /news/wardwantstomakeupforrecentcupdisappointment 1 13345 0 0 /archive-2006-2014/286 2 22442 0 0 /news/ashfordtown2-3chipstead-seanlakeepsuphisimpressivegoalscoringform 1 15931 0 0 /news/sittingbourne2-0whitstabletown 1 17221 0 0 /news/551a9c91dc71f 2 31152 0 0 /news/favershamturner270415 2 33402 0 0 /news/551a96dbae3a8 1 5050 0 0 /news/heromcpheehumbledbyfleetreturn 1 12001 0 0 /news/19thaug04.html 1 0 0 0 /news/17thoct03.html 1 0 0 0 /news/lewsct250917 1 30857 0 0 /news/wattscompletsmovetohishome-townclub-exclusive 1 12418 0 0 /news/phoeerit111023 3 81569 0 1 /news/sladegreen221105.html 1 0 0 0 /news/551a967717378 2 13959 0 0 /news/icanmakethegradeinsiststrialistbonneywell-exclusiveinterview 2 20226 0 0 /news/551bc99dbe7a4/drmartens/eastern/dartford/kentleague/ramsgate/27thoct03.html 2 15653 0 0 /news/bromley131017 1 15396 0 0 /news/dulwich311217 2 23259 0 0 /news/folkestone150416 2 25876 0 0 /news/sheppey110920 1 13826 0 0 /archive-2006-2014/155 1 19318 0 0 /news/facupspecialeveryonehastobeontheirgame-cronin 1 14675 0 0 /news/lucrativeramsgatedealprisesgarethcornhillawayfromwhitstabletown 1 12189 0 0 /news/dulwichhamletfanscanasktheexpertsonfanownership 2 29620 0 0 /news/vcdathletic2-0corinthian-wethoroughlydeservedtogetsomethingsaysvcdbossrickybennett 1 27801 0 0 /news/hythetownpulltheirreservesoutofthekentleague 1 12022 0 0 /news/werenotgoingtochangethewayweplaysayshernebaybosssimonhalsey 1 16243 0 0 /news/weseemtobedoingbetterawayfromhomeadmitsbromleycoachneilsmith 1 14297 0 0 /news/stonesloveshackforturningdownlucrativemove 1 13266 0 0 /news/holmesdale300916 1 13546 0 0 /news/erithbel020317 1 12512 0 0 /news/tonbridge111019 2 14276 0 0 /news/mcmahonwantstoaddtothamesmeadtownssuccess-exclusiveinterview 1 16247 0 0 /news/wingsreceiveclearanceforpairintimeforopeningday 1 10420 0 0 /news/canterbury010116 1 12628 0 0 /news/farniecapturesexperiencedstriker 1 10592 0 0 /news/snodlandtown300819 1 12299 0 0 /southern-counties-east-football-league/37 1 20954 0 0 /news/tonbwort100318 2 59656 0 0 /news/soccershorts110621 4 42471 0 0 /news/localbusinessmencomeintohelpwhitstabletown 1 13233 0 0 /news/ifwearetoachieveanythingathuddersfieldtheresgoingtobeelevenheroessaysmartinhayes 1 23713 0 0 /news/lordswoodfc.co.uk 1 0 0 0 /news/itwillbeagreatendtoadisappointingseasontowalkawaywithatrophysaysmarkgoldberg 1 13210 0 0 /news/dartfordawardedpersonalisedpostcodeforprincespark 2 15686 0 0 /news/ramsgate011216 2 28507 0 0 /news/551a99e49031a 1 12096 0 0 /news/26thsept05G.html 1 0 0 0 /news/othernews/19thoct04.html 1 0 0 0 /news/hampdulw201015 2 53129 0 0 /news/holmesdale281018 1 12216 0 0 /news/sporstan090320 2 43738 0 0 /news/stadiumrevamphasbeenalongtimecomingsaysmargatesecretarykentomlinson 1 20817 0 0 /news/sesayhandedpremiershipchance 1 12016 0 0 /news/551a9797df1fb 1 4478 0 0 /news/erithbelvedere3-2beckenhamtown 1 15433 0 0 /news/longlane100516 1 16032 0 0 /news/551a9cf58586f 3 33860 0 0 /news/tabletoppingdartsbosswarnsagainstcomplacency 1 13142 0 0 /news/bromley080217 2 17601 0 0 /news/tunblord091022 4 123878 0 0 /news/sctholm070417 1 34925 0 0 /news/551a979900ddf 1 6335 0 0 /news/erithbelvedere4-1corinthian-thehardgraftspaidoffsaysdoublewinnermickycollins 1 35821 0 0 /news/thanksforthememorieschris 1 12889 0 0 /news/551bc5e85e01f 1 12831 0 0 /news/18thnov04.html 1 0 0 0 /news/itsprobablythefirsttimewevegoneintoagamethisseasonasunderdogssaysjaysaunders 1 16184 0 0 /news/crayhors160823 5 146465 0 0 /news/stoneslookingtogosevenpointsclear 1 14187 0 0 /news/erithbelvedere0-0erithtown 1 13215 0 0 /news/fansraise1600forfolkestoneinvicta 1 14969 0 0 /news/ifwerenotmentallypreparedforabattlewellcomeunstuckwarnswellingunitedbossjamieday 1 15680 0 0 /news/louifazackerleypensnewone-yearcontracttostayatwellingunited 1 13759 0 0 /news/otfordunited211120 1 11909 0 0 /news/angelsreservesreachsecondcupfinalascasualssurrendertie 2 15231 0 0 /news/23rdfeb05.html 1 0 0 0 /news/30thaug05.html 1 0 0 0 /news/551a9799b9d93 1 4848 0 0 /news/youcantaffordtomissyourchancessaysashfordunitedbosspaulchambers 1 12869 0 0 /archive-2006-2014/211 1 19512 0 0 /news/championshipwinningpartyletsendtheseasoninstylesaysburman-exclusive 1 14815 0 0 /news/wereconcentratingontryingtowinthekentleaguesaysvcdathleticbossrickybennett 1 15909 0 0 /news/itsbusinessasusualformeatashfordtowninsistslovell 1 22023 0 0 /news/rusthallsignbalmertoaddsomesteel 1 12163 0 0 /news/erithbelvedere2-3chathamtown-weshowedalitltebitofresiliencesayskevinwatson 1 33537 0 0 /news/sevenoakstown3-3sladegreen 2 19326 0 0 /news/drmartens/premier/dover/4thsept04.html 1 0 0 0 /news/fishvfolk201203.html 2 0 0 0 /news/11thjune05.html 1 0 0 0 /news/punjab250118 1 11887 0 0 /news/drmartens/eastern/erith&belvedere/folkestone301104.html 1 0 0 0 /news/glebe130417 1 14011 0 0 /news/margateunveilexcitingplanstotransformhartsdownparkintofootballleaguegradedstadium 1 17001 0 0 /news/craywanderers1-1ware-itsaboutstayingintheleaguenowadmitsgaryabbott 2 38205 0 0 /news/whitstable120205.html 1 0 0 0 /news/weknowhowdifficultitwillbetoknockfleetout-ward 1 13369 0 0 /news/glebe190822 4 53542 0 0 /news/551bc5e39e5bf 1 22547 0 0 /news/humehailshawkinsloansigning 1 17838 0 0 /news/chathamtown3-1molesey 1 13010 0 0 /news/bromley1-1wealdstone-wevegainedanimportantpointsaysmarkgoldberg 2 35930 0 0 /news/cugleymakesdoublesigning 1 12301 0 0 /news/13thfeb05.html 1 0 0 0 /kent-invicta-league/15 2 25564 0 0 /news/someofmyplayershavebrightfuturesinthegamesaysvickersbossrickybennett 1 16716 0 0 /news/drmartens/eastern/folkestone/folkvstam221103.html 1 0 0 0 /news/551a97b0831ae 1 11061 0 0 /news/apmcontrast271115 2 17387 0 0 /news/wp-includes/pomo/wp-login.php 1 0 0 0 /news/kentleague/sevenoaks/hernebay161004.html 1 0 0 0 /news/mcmahonsnapsuplong-termtargetcampbell 1 13530 0 0 /news/551a97b106c35 2 32304 0 0 /news/551a9798675f7 1 3509 0 0 /news/dartford3-1bromley-charliesheringhamtakeshisgoalscoringtallytosixinderbywin 1 17315 0 0 /news/favershamtownreluctantlyacceptjustinluchfordsresignation 1 13953 0 0 /news/551a967857970 2 15025 0 0 /news/IsthmianLeague240320 3 31490 0 0 /news/hessenthalertellshisclassysidetokeepthemomentumgoing 1 15824 0 0 /news/551bc5dd78053 2 27671 0 0 /news/fansquizfavershamtownmanagementduo 1 11100 0 0 /news/551bc5e0cd1d0 1 12564 0 0 /news/wellpunj110320 4 66303 0 0 /news/FAStatement040820 3 32470 0 0 /news/551a97189c984 2 14241 0 0 /news/angelsproberamsgatemisdemeanour 1 14841 0 0 /news/derespreview130705.html 1 0 0 0 /news/stonesconquereurope 1 13987 0 0 /news/551bc5e524b8f 2 20250 0 0 /news/551a9798c2421 1 5750 0 0 /news/wereequippedforpromotionsaysashfordunitedbosspaulchambers 1 14807 0 0 /news/erithtudor070617 1 14317 0 0 /news/thefatrophyisagoodcompetitionandwewanttogoasfaraswecansaysjamieday 2 27436 0 0 /news/humehailssupermario 1 14248 0 0 /news/whitstabletown171022 1 13241 0 0 /news/dulwich251118 1 12611 0 0 /news/beckenham251218 1 14602 0 0 /news/ksports030317 1 12703 0 0 /news/551a9718aba4d 3 26929 0 0 /news/ourseasonisnotoverinsistshythebossfiskexclusiveinterview 1 14174 0 0 /news/crosbieashfordwillproducesportingchampions 1 12992 0 0 /news/wewanttokeepthegreeniwchboroughtraditiongoingsayschairmandevonhanson 1 19272 0 0 /news/fanspraisecouncilforbuildingbreathtakingnewstadium-exclusiveinterviews 1 18419 0 0 /archive-2003-2006/ 1 2464 0 0 /news/severedh080921 3 79549 0 0 /news/wemustdevelopourownhomegrowntalentsaysjenner 1 15238 0 0 /news/sevenoakstown1-0tunbridgewells-roughdiamondshinnerscanplayhighersaysjones 1 30945 0 0 /news/hernebay1-0larkhallathletic-wecantletthevaseslipthroughourfingerssayssimonhalsey 1 24812 0 0 /news/imnotgoingtomargateinsistsward 1 22937 0 0 /news/bowey190804.html 1 0 0 0 /news/holmkent190920 1 38302 0 0 /news/larryo'connelltribute050120 2 19012 1 1 /news/hendon0-0ramsgate-wardpleasedwithhiscapitalgains 1 17251 0 0 /news/551bc5dd02f1c 1 11864 0 0 /news/bridsutt300316 2 44311 0 0 /news/fleetshareholdersagreefanswebsitedeal 1 10909 0 0 /news/jenkinsunveilsbremnersreturn 1 16828 0 0 /news/harlowtown2-0chathamtown-youneedtoscorewhenyoureontopsayskevinwatson 1 26974 0 0 /news/dealtown080819 1 11983 0 0 /news/kentleague/cray/15thaug04.html 1 0 0 0 /news/weymouthrobberykicksdaishintheteeth 1 16029 0 0 /news/551bc99dbe7a4/drmartens/eastern/dartford/nationwide/7thjuly03.html 2 15653 0 0 /news/chathamtown0bedfordtown2 2 15919 0 0 /news/canterbury111215 1 13504 0 0 /news/fixturelistletskeepthefacupdreamalive 1 12040 0 0 /news/craywands100319 3 44728 0 0 /news/erithandbelvedere310820 1 13966 0 0 /news/29thfeb04A.html 1 0 0 0 /news/wingfolk161121 2 62710 0 0 /news/soccershortstommyosbornestaysformaidstoneunitedshomecoming 1 14124 0 0 /news/inanidealworldidliketocomeawaywiththreetrophiessayshernebayherostevehanson 1 17666 0 0 /archive-2006-2014/43 1 21034 0 0 /news/ryman/bromley/bromvcroyath240204.html 1 0 0 0 /news/hernebay2-2fleettown 1 13230 0 0 /news/bromleymillwall140715 2 31139 0 0 /news/6thfeb04.html 1 0 0 0 /news/craywands270918 3 31117 0 0 /news/dartslooktohavetheedgeovertheirmainrivals-exclusive 1 13788 0 0 /news/sctjoy091216 1 13293 0 0 /news/kentleague/thamesmead/14thnov03.html 1 0 0 0 /news/551a9c91b06bd 3 38072 0 0 /news/sportingclubthamesmead101019 1 14415 0 0 /news/weknowtheopportunitytogoupispotentiallyhugethisseasonsayskfumanagersammacneil 1 12489 0 0 /news/shorts160615 2 37600 0 0 /news/lordswood191115 1 16512 0 0 /news/holmesdalesgroundsmanscoopstopfaaward 1 11604 0 0 /news/551bc5e76b6a8 1 13518 0 0 /news/triomakewayascugleyswoopsforstarstriker 1 19266 0 0 /news/sittingbourne010715 2 31649 0 0 /news/maidstone240619 1 11794 0 0 /news/ourpoorrunwillendinsistsburman 1 12612 0 0 /news/charltonathletic1-1millwalllionesses5-4pens-kiobelsbossdeniesmillwallcupglory 1 41219 0 0 /news/rymanleaguepublishfixtures 1 24794 0 0 /news/551a95b479d55 2 19611 0 0 /news/iamveryclosenowtocompletingthesquadsaysfavershamtownbossrayturner 1 12856 0 0 /news/earlystartforkentishclash 1 11746 0 0 /news/facupthirdrounddrawnoglamourtieforheroesdoverathletic 1 22256 0 0 /news/cottonnipsprogressinthebud-exclusiveinterview 1 29662 0 0 /news/551bc5e76e41a 1 13776 0 0 /news/daishweacquittedourselveswell 2 18780 0 0 /news/vcdvwhitstable120803.html 1 0 0 0 /news/favershamtown3-2hythetown-wewasntatourbesttodayadmitsfavershambossrayturner 1 31775 0 0 /news/tonbridgeangels0-1ramsgate-dolbycomplainsaboutmorepoorrefereeing-exclusiveinterview 1 18340 0 0 /news/kentleague/lordswood/lordvseve061203.html 1 0 0 0 /news/sittingbourne0uxbridge3 1 14451 0 0 /news/eritbrid240419 1 33672 0 0 /news/tonbridgeangels210121 4 22881 3 3 /news/551bc99c2abb6 2 23338 0 0 /news/wewanttomakecrockenhillaforcetobereckonedwithvowsadams-exclusive 1 17457 0 0 /isthmian-league/51 3 44846 0 0 /news/hopefullyitsgoingtobethirdtimeluckysaysabbott 1 20380 0 0 /news/kentleague/maidstone/11thdec03.html 1 0 0 0 /news/iexpectmyplayerstolookafterthemselvessayscraybossianjenkins 1 22407 0 0 /news/werenotjumpingofftheroof-topssaystable-toppingbromleyassistanthaydenbird 1 21778 0 0 /news/thameshorn211215 2 62696 0 0 /news/weareveryhappytohelpgreenwichboroughsaysdartfordco-chairmanbillarcher 1 11305 0 0 /news/doverathleticsettounveilexcitingappointment 1 10935 0 0 /news/soccershorts190523 7 108626 0 0 /news/bridon291216 2 16358 0 0 /news/canterbury080116 1 12434 0 0 /news/craywands170317 3 28788 0 0 /news/smissenruledoutfortherestoftheseason 1 12356 0 0 /news/kentleague/ramsgate/15thmar04.html 1 0 0 0 /news/iwillnotfailtodeliverthegoodsvowslovell 1 12773 0 0 /news/551bc5df14cab 1 14974 0 0 /news/holmesdalewalkedoutandforfeitedgame-claimsanonymousholmesdaleplayer 1 14674 0 0 /news/resultsmarch2016 2 110134 0 0 /news/wellingtown030719 1 11568 0 0 /news/bromley061218 2 15387 0 0 /news/resultsoctober2021 2 117957 0 0 /news/551bc5e11e889 1 10637 0 0 /news/winningisagoodhabittohavesaysdoverathleticbosschriskinnear 2 18761 0 0 /news/soccershorts010723 3 64045 0 0 /news/phoecray280717 2 68080 0 0 /news/erithandbelvedere070804.html 1 0 0 0 /news/551a97b05bbdb 1 11575 0 0 /news/budgetcutsforcedaishtooffloadhisassistant 1 12339 0 0 /news/kentleague/maidstone/7thJan04.html 2 0 0 0 /news/soccershortsgloverturnshisbackonashfordtown 1 17697 0 0 /news/551bc99dbe7a4/drmartens/eastern/ashford/drmartens/eastern/dartford/12thoct03.html 2 15653 0 0 /news/favershamistheplacetobesayscopley 1 13898 0 0 /news/vcdathletic280320 2 27695 0 0 /news/fisher190205.html 1 0 0 0 /news/551a95b4096df 3 36285 0 0 /news/crayeast200422 6 163137 0 0 /news/hayesdiplock140316 1 16089 0 0 /news/lastyearsheartbreakwillspurustowardspromotionsaysnolan-exclusiveinterview 1 17028 0 0 /news/fisherfc.org 3 0 0 0 /news/wellingunited1-2salisburycity-wellingplayersmissinghomecomforts-exclusiveinterviews 1 23605 0 0 /news/beckcrys150716 1 29008 0 0 /news/551bc99dbe7a4/othernews/kentleague/maidstone/maidvlord271203.html 2 15653 0 0 /isthmian-league/28 3 45432 0 0 /news/551bc5e552630 2 24493 0 1 /news/slough031205.html 1 0 0 0 /news/551bc99dbe7a4/kentleague/sladegreen/othernews/facup7thjuly03.html 2 15653 0 0 /news/threepointsaremoreimportantthanfacupwin-porter 1 18333 0 0 /news/glebe0-2bexhillunited-todaywasthefirstblipoftheseasonsaysglebebossrockymcmillan 1 26275 0 0 /news/drmartens/eastern/folkestone/braintree091004.html 1 0 0 0 /news/byronwalkersreturnisamassiveboostsayshernebaybosssimonhalsey 1 16084 0 0 /national-league/39 2 22579 0 0 /news/welltrytobringanicebrandoffootballtobromleysaysmurrayjones 1 14742 0 0 /news/elmsteadareembarkingonafive-yearambitiousdevelopmentplansaysfabiorossi 2 26072 0 1 /news/lewiscontroversialmovetomargatehangsinthebalance 1 13966 0 0 /news/harrow020405.html 1 0 0 0 /news/551bc5e84249c 1 11374 0 0 /news/newownersploughinhalfamillionquidintoconferenceboundashfordtown-exclusive 1 19828 0 0 /news/wp-content/updates.php 1 0 0 0 /news/551a96dcad3f7 2 17548 0 0 /news/bromley080722 4 63250 0 0 /news/wembleyissocloseyoucanalmosttouchitsaystommysampson 1 17403 0 0 /news/wearereallylookingforwardtomeetingthefanssayscraywanderersbosskeithbird 1 12241 0 0 /news/551a96dc3a9bc 4 63920 0 0 /news/lordswood091118 1 12131 0 0 /news/beckenhamtown3-0littlehamptontown-garygormanhastoscoreinthebiggamessayshuntley 1 30095 0 0 /news/551bc5e30223e 1 18878 0 0 /news/windsorvbrom090903.html 1 0 0 0 /news/theresnoformguideinthekentleaguesayserithbelvederebossmickycollins 1 13537 0 0 /news/wevegotaverygoodchanceoffinishingwherewewanttobesaysnickyforster 1 14162 0 0 /news/551a9c0e54116 2 16688 0 0 /news/wemustimproveinbothpenaltyboxessaysyorath 1 11782 0 0 /news/onedaystevehansonwillbecaptainofhernebaysaysbosssimonhalsey 1 15633 0 0 /news/raynesparkvale0-1croydon-imlookingforcommittedplayerssayscroydonbossdicksongill 1 24882 0 0 /news/551a92506a90a 2 21346 0 0 /news/otfordunited4-4gurunanak-promotionsamustforusthisyearsaysgurunanaksandystevens 1 36117 0 0 /news/welltryandgetthroughpeacehavenandgoasfaraswecansayssittingbournebossrichardbrady 1 13320 0 0 /ashford-2003-2006 14 173810 2 2 /news/sittingbourne040120 2 33426 0 0 /news/itsarebuildingjobatcorinthianthisyearsaysjamescollins 1 14231 0 0 /news/croydon130919 1 12322 0 0 /news/551a96783e957 2 19208 0 0 /news/favershamtownbossjustinluchfordtargetsthe50pointmarktomaintainrymanleaguestatus 1 21507 0 0 /news/drmartens/eastern/erith&belvedere/flackwell021004.html 1 0 0 0 /news/wellchar200917 1 26425 0 0 /news/551bc5e874989 1 11812 0 0 /news/greenwich170619 1 13240 0 0 /news/chathamtown210721 2 16552 0 0 /news/kentleague/cray/6thoct04.html 1 0 0 0 /news/soccershortsbromleypulloffcoupbysigningstarstrikeradambirchall 1 22321 0 0 /news/afccroydonathletic260720 1 11522 0 0 /news/bromley150421 6 59986 0 0 /news/15thdec03.html 1 0 0 0 /news/551bc99dbe7a4/drmartens/premier/dover/kentleague/ramsgate/ramsgatevdeal071003.html 2 15653 0 0 /news/thamesmead120205.html 1 0 0 0 /news/551a97b1c2062 1 13574 0 0 /news/princesparktostageshowpiecefinal 1 10950 0 0 /news/551a97b1e8a21 1 15522 0 0 /news/horsham3-1maidstoneunited-humeleftfumingoverworthlessperformance 1 16001 0 0 /news/arunrams100919 3 69774 0 0 /news/threrams091223 18 99265 0 2 /news/551bc5e04a3e7 1 19303 0 0 /news/facarlsbergtrophythirdqualifyingroundreviseddraw 1 15038 0 0 /news/whitehousepraisesclokeasdoverathleteickillofftootingstitlehopes 1 14206 0 0 /news/kentleague/VCD/29thjune03.html 1 0 0 0 /news/iftheproperbeckenhamturnupifancyustogetaresultsaysmichaelmarks 1 17374 0 0 /news/englandlionesses030715 1 18797 0 0 /news/551a956c8db89 2 20298 0 0 /news/fisherfanianmurphyraisesnearly300followinggroundhoparoundlondon 1 14541 0 0 /news/ijusthopegeorgecangetbetterandseejusthowmuchpeopleappreciatehimsaysrichmondkissi 1 23749 0 0 /news/erithtown040823 1 14504 0 0 /news/theroadtowembleyrevisedfacupsecondqualifyingrounddraw 1 11329 0 0 /news/itwasnteasytoleavegreenwich-butineedanewchallengesaysnewfisherbossstevefirkins 1 14087 0 0 /news/craywhyt260918 3 75034 0 0 /news/paulfoley150617 2 25873 0 0 /news/dover301215 1 12675 0 0 /news/snodland080917 1 12961 0 0 /news/soccershortshythesearchforyoungkeepertogainexperienceunderhyde 1 18716 0 0 /news/kentleague/hythe/13thaug04.html 1 0 0 0 /news/mcmahontellswantawaystrikeryouveletmedown 1 11142 0 0 /news/kentleague/maidstone/maidvfolk171203.html 1 0 0 0 /news/bromwrex281120 5 134729 0 0 /news/551a967831815 2 22941 0 0 /news/ebbsfleetunited3-2leytonorient-daishreadytoofferdeals 1 24066 0 0 /news/sheppey090218 1 14614 0 0 /news/whitstable260418 1 12970 0 0 /news/551bc5e069aab 2 20787 0 0 /news/hernebay101218 2 28368 0 0 /news/warrilowspendstonettargetrook-exclusive 1 13388 0 0 /archive-2006-2014/169 1 19671 0 0 /news/wemustconcentrateonpickingupleaguepointssaysfocusedmunday 1 14788 0 0 /news/fleetladiesreceivelotteryfunding 1 21582 0 0 /news/551bc5e8824da 1 14935 0 0 /news/kentleague/ramsgate/12thoct03.html 1 0 0 0 /news/jacksonpledgeshisfuturetofolkestoneinvicta 1 20624 0 0 /news/551a9718a635b 3 26469 0 0 /news/andyhessenthalerbackskentfascampaigntocutoutbadbehaviour 2 25374 0 0 /news/withfinancialbackingcrockenhillcoulddowellsayswilliams 1 16496 0 0 /news/letsmakeitaneveningeveryoneatdartfordwillneverforgetsaysacademycoachderenibrahim 1 19705 0 0 /news/wewanttogiveagoodaccountforourselvessaysbridonropesbossbenkotey 1 15316 0 0 /news/FAVaseStatement060720 1 11498 0 0 /news/haritunb220920 3 45882 2 2 /news/lewisham210917 1 12938 0 0 /news/551a96db3d2c3 2 15097 0 0 /news/551bc99aeec47 2 17700 0 0 /news/stonesapplyforstadiumgrant 1 11956 0 0 /news/peckham290417 1 12785 0 0 /news/othernews/SECWFL210304.html 1 0 0 0 /news/tonbridgeangels270521 1 12633 0 0 /archive-2006-2014/151 1 19375 0 0 /news/mcmahonbringsbigfishtobaylissavenue 1 16325 0 0 /news/FAstatement220920 3 33268 0 0 /news/southallsettosignone-yeardealfordovertonight 1 22401 0 0 /archive-2006-2014/279 2 23181 0 0 /news/croydonlookingforhomefriendly 1 11378 0 0 /news/bromalt141115 2 33879 0 0 /news/tonbridgeangels290620 1 11722 0 0 /news/ashfordunited200220 3 34261 0 0 /news/daishgivenfundstosignfiveplayers 1 13852 0 0 /news/erithbelvedere3-0lordswood-werenotgoingtomakeiteasyforthemsaysjasonlillis 1 24452 0 0 /news/canterbury260419 2 17375 0 0 /news/bearsted090821 1 12652 0 0 /news/thetargetthisyearistofinishinthetopeightsayslarkin 1 16884 0 0 /news/pitchero.com/clubs/sportingclubthamesmeadfc 1 0 0 0 /news/balham200520 1 11934 0 0 /news/vcdgreen081016 2 69427 0 0 /news/slattersignsnewone-yeardealtostayatfleet 1 12767 0 0 /news/hyththre250223 2 62800 0 0 /news/favasesecondroundspecialfarnieblastsschooloversheaselection-exclusive 1 16059 0 0 /news/maidstone080616 1 10938 0 0 /news/ashford200517 3 29737 0 0 /news/551a96db589d5 1 5906 0 0 /news/erithandbelvedere300519 1 15648 0 0 /news/icantthankdartfordenoughhelpinggreensrecoverysaysobrien 1 18199 0 0 /news/whitgraham070515 3 33218 0 0 /news/551bc99e0a41f 2 25967 0 0 /news/croydonlookforwardtonewsurroundings 1 30364 0 0 /news/20thjuly03.html 1 0 0 0 /news/eastbourne011104.html 1 0 0 0 /news/551bc5dec806d 1 23034 0 0 /southern-counties-east-football-league/53 1 19947 0 0 /news/beckenham090920 1 16690 0 0 /news/551a99e3ab95a 1 12262 0 0 /archive-2006-2014/148 1 19418 0 0 /archive-2006-2014/215 1 19702 0 0 /news/troubledfolkestoneinvictaprepareforadministration 1 11949 0 0 /news/bromley1leyton2 2 16888 0 0 /news/arrangementsareinplacetogetourgrounduptostandardsayscrayvalleybossstevechapman 1 15123 0 0 //twitter.c 1 3711 0 1 /news/edgardavidsturnsdownambitiousgreenwichboroughapproach 1 12943 0 0 /news/greenwichboroughpulloffmajortransfercoupbysigninggoalkeepercraigholloway 1 12246 0 0 /news/craywanderers0-2billericaytown-dontperformandyoullbedroppedwarnsjenkins 1 23541 0 0 /news/sevenoakstown1-2eastpreston-wejusthaventputtheballinthenetadmitsmickycollins 1 29970 0 0 /news/551a9677bee1e 3 30256 0 0 /news/cray070804.html 1 0 0 0 /news/ramsgateshockatlosingfour-pointdeductionappeal 1 11734 0 0 /news/metrogas1-2fleetleisure-wejustcouldntgetoverthefinalhurdleadmitsroydavies 1 30699 0 0 /news/tunbridgewells2-1sevenoakstown-wewantedtoputtherecordstraight-larkin 1 37979 0 0 /news/wecangofromstengthtostrenthinsistsfavershamchief 1 12333 0 0 /news/thefacupsponsoredbyeonfirstrounddraw 1 14161 0 0 /isthmian-league/2 7 96601 0 0 /news/comeandsupportourpromotiondrive 1 12603 0 0 /news/erithbelvedereapologiseforcrockenhillcancellation 1 11523 0 0 /news/shamefulstephensonbootedoutbysevenoaksforspittingatreferee 1 11303 0 0 /news/soccershortsmanypeopletipusforpromotionthisyearsaysramsgatebosstimdixon 1 18932 0 0 /news/ryman/bromley/epsovbrom061203.html 1 0 0 0 /news/ashford200117 1 12525 0 0 /news/FAStatement190820 3 20818 1 1 /news/SCEFL130421 5 110984 0 0 /news/hythetown2-2hernebay4-5pens-maybeourwake-upcallhascomeattherighttime-porter 1 26154 0 0 /news/trophyticketsforhighnoonshowdownupforgrabs 1 11510 0 0 /news/klpdcupfinalpreview050504A.html 1 0 0 0 /erith-town-2003-2006/2 4 27100 0 0 /news/othernews/gotravelkentleaguetables220204.html 1 0 0 0 /news/wardexcitedaboutlocaltalentcomingthrough-exclusive 1 16180 0 0 /news/551bc5dcb8b57 3 33250 0 0 /news/lyddtown031117 7 34854 6 6 /news/harrysmith100816 2 27746 0 0 /news/551a99e4ac81e 2 38134 0 0 /news/peckhamambitions100415 2 35586 0 0 /news/langtonweonlyhaveplayerswhowanttoplayforashfordtown 1 17196 0 0 /news/faversham170117 2 29773 0 0 /news/kentleague/tunbridgewells/21stoct04.html 1 0 0 0 /news/sevenwhit050219 2 61831 0 0 /news/fisherathletic1-2eastleigh-ivegotthetoughestjobinfootballadmitsmehmet 1 20433 0 0 /news/551bc5dd19d7f 1 10162 0 0 /news/551a96dc2fe25 5 87973 0 0 /news/551bc5e5ec317 1 17408 0 0 /news/ramsgate3-2horsham-ramskeepupwiththejoneseys 1 21629 0 0 /news/dovertargetconferencesouthstandardplayers 1 14109 0 0 /news/wp-content/plugins/dzs-zoomsounds/abruzi.php4 1 0 0 0 /news/chatham100219 1 15308 0 0 /news/551bc5da7a5a2 4 48200 0 1 /news/dartford050205.html 1 0 0 0 /news/drmartens/eastern/fisher/7thdec03.html 1 0 0 0 /news/4thmar04.html 1 0 0 0 /news/bearsted240416 2 17381 0 0 /news/551a97984908c 1 4850 0 0 /news/metrogas080519 1 13969 0 0 /news/craysct100118 2 44561 0 0 /news/551a97b1c55e7 1 14189 0 0 /news/551bc5e00bf27 1 13110 0 0 /news/drmartens/eastern/sittingbourne/histvsitt151103.html 1 0 0 0 /news/lewiskent080118 1 31947 0 0 /news/birchallturnsdownfull-timeofferstosignforhessenthaler 1 14533 0 0 /news/punjab091217 1 12289 0 0 /news/othernews/25thjuly03.html 1 0 0 0 /kent-invicta-league/4 3 43148 0 0 /news/greesutt111021 5 160124 0 0 /news/erithbelvederefc.co.uk 3 0 0 0 /news/551bc99d1c621 2 35727 0 0 /news/kentleague/lordswood/beckvlord270304.html 1 0 0 0 /news/greeniesfridaypreview-4 1 18667 0 0 /news/551a96dbbfb62 1 4084 0 0 /news/holmwell131021 1 38274 0 0 /news/bromley160817 2 25803 0 0 /news/551bc5e10abc1 1 15385 0 0 /archive-2006-2014/102 1 20534 0 0 /news/551bc5e0ba55e 1 16926 0 0 /news/craywanderers3-1molesey-werepleasedwiththeprogressthatwevemadetodaysayskeithbird 2 38889 0 0 /news/551a979983e89 1 4773 0 0 /news/16thsept05.html 1 0 0 0 /news/foleywilllandthetitleforussaysversatileparkinson-exclusive 1 12404 0 0 /news/tonbridgeangels090522 2 35875 0 0 /news/welling260518 1 11334 0 0 /news/551a979af22b3 1 4854 0 0 /news/551bc99dbe7a4/kentleague/sladegreen/drmartens/eastern/folkestone/folkevsitt230903.html 2 15653 0 0 /news/thefacupishugefortheclubandhugefortheplayerssayssittingbournebossnickdavis 2 19294 0 0 /news/scefl210720 1 12334 0 0 /news/551bc99dbe7a4/drmartens/eastern/sittingbourne/drmartens/eastern/sittingbourne/3rdjuly03.html 2 15653 0 0 /news/dealtown100120 1 14451 0 0 /news/derestargethalfadozennewfacesforseriouspromotionbid 1 15057 0 0 /news/dartford0-3crystalpalace 1 16610 0 0 /news/vcdathletic3-2tilbury-ihavesomuchbeliefintheboyssaystonyrussell 1 25166 0 0 /news/wevegottowinthefightinsistschatsleaderobrien 1 16481 0 0 /news/sevenoaks140118 1 13990 0 0 /news/margate3-4maidstoneunited-strikercumberswantshisgillinghamchance 1 21502 0 0 /news/ramsgate260620 2 25203 0 0 /news/551bc5e7cb47c 1 11607 0 0 /news/nuneaton051105.html 1 0 0 0 /news/theresgoingtobeloadsoftwistsandturnsthisseasonsaysangelsbosstommywarrilow 1 13065 0 0 /news/wemustdobettersaysperona-exclusive 1 13383 0 0 /news/folkestoneinvictachairmanstandsdownafternineyearsatthehelm 1 11701 0 0 /news/wellingunited3-1bromley-warrenmcbeanisstayingatbromleysaysbarrymoore 1 30520 0 0 /news/wewereshockingadmitsupsettrott 1 12841 0 0 /news/icouldntperformforangelsadmitsdisappointedgreen 1 27871 0 0 /news/fernandes210715 4 36517 2 2 /news/craywanderers2-1maidstoneunited-ilookatmyplayersandweshouldntbeinthismess-nott 1 43747 0 0 /tunbridge-wells-2003-2006/3 1 14078 0 0 /news/wevegottofancyourselvesnowsaysbeckenhamtownbossjasonhuntley 1 15841 0 0 /news/favershamtown1-2chipstead-wejusthavetoregroupforchristmassaysrayturner 1 16257 0 0 /news/craycars091016 3 70806 0 0 /news/551a956bbe55f 1 3003 0 0 /news/sevenacre191115 1 12920 0 0 /news/fisher200820 1 13633 0 0 /news/canterbury261218 1 16177 0 0 /news/playersdontsignatthistimeoftheyearsayswalker 1 12151 0 0 /news/doverathleicbossmartinhayessignsanotherdiamond 1 11270 0 0 /news/whitstable170419 2 29092 0 0 /news/strikerboostforfolkestoneinvictabossneilcugley 1 15166 0 0 /news/thereisachancehereforcanterburytohavearealproudassetsayschairmantimclark 1 15247 0 0 /news/havingmybudgettakenawayfrommemadeitverydifficultformesaysglennbarlow 1 13861 0 0 /news/kentleague/VCD/28thjan04.html 1 0 0 0 /isthmian-league/20 3 45892 0 0 /news/becklanc141123 5 48990 0 0 /news/hopefullywecancomehomefrombromleywithsomepointssayswellingbossjamieday 1 15824 0 0 /news/averymakeschathammovepermanent 1 11984 0 0 /news/othernews/15thoct04.html 1 0 0 0 /news/mysidewillbefiringonallcylindersinsistsfoley-exclusive 1 16210 0 0 /news/wedliketogetasfaraswecaninthefacupsayswellingunitedbossjamieday 1 13566 0 0 /news/tunbridgewellsappointworldcupstarasdirectoroffootball-exclusive 2 15570 0 0 /news/551a956ca282c 3 23671 0 0 /archive-2006-2014/69 1 20365 0 0 /news/iveseenenoughthatwecanworkonsayspositivedartfordbosstonyburman 1 14773 0 0 /news/werebuildingforthefuturesayssittingbournejoint-managerjimward 1 16020 0 0 /news/ankleinjuryforcessimpsontoretire 1 14044 0 0 /news/sportmeri031218 1 28979 0 0 /news/551bc5dbcbdfc 3 36277 0 0 /kent-invicta-league/6 3 43107 0 0 /news/erithbelvedere1-4withamtown-imprettyconfidentresultswillchangesayschriscosgrove 1 29877 0 0 /news/othernews/coneyhall220904.html 2 0 0 0 /news/wellingunitedapproachfootballconferencetogetcripplingtransferembargolifted 1 23779 0 0 /news/weresecondfavouritestowintheleaguesaysvcdathleticbosstonyrussell 1 18371 0 0 /news/dolbymainhascometoabiggerclub 2 17148 0 0 /news/wererebuildingandthingsareontheupsaysgraveshamboroughbossgrantduff 2 14990 0 0 /news/beckenhamtown0-2thamesmeadtownaet-wegotwhatwewantedsaysmeadbosskeithmcmahon 1 25578 0 0 /news/tunwells210417 1 14820 0 0 /news/chesbrom271118 2 37406 0 0 /news/margatesyoungstersputpentopaper 1 11150 0 0 /news/551bc5e35880e 1 16907 0 0 /news/551bc5dc3545b 2 15516 0 0 /news/sevenoaks191017 1 15822 0 0 /news/551bc5e32752d 1 14717 0 0 /news/lymingtonreplay070804.html 1 0 0 0 /isthmian-league/45 3 44550 0 0 /news/warrilowdolke150415 3 35568 0 0 /news/tunbridgewells1sladegreen1 1 14169 0 0 /news/551bc5e72df65 1 15403 0 0 /news/soccershortsdaishcompletesdoubleswoop 4 24848 3 3 /news/doverathletic160123 1 13843 0 0 /news/thingsarebadbutnotasbadastheywereadmitsfolkestoneinvictabossneilcugley 1 16027 0 0 /news/551a9c9180444 2 16024 0 0 /news/croydon070819 1 12574 0 0 /news/phoenixsports280423 2 47447 0 0 /news/waltbeck050222 4 127654 0 0 /news/dartford3-0bishopsstortford-impleasedtogetthefirstwin-burman 1 22269 0 0 /news/imreallypleasedtohavejonmainattheclubsaysthamesmeadtownbosskeithmcmahon 1 16366 0 0 /news/551bc5dd7e602 2 18432 0 0 /news/wingsshinethrough-exclusiveinterview 1 14933 0 0 /news/hichamakhazzan030717 2 30170 0 0 /news/ksports100921 4 47310 0 0 /news/551bc99dbe7a4/drmartens/eastern/tonbridge/othernews/fat1stnov.html 2 15653 0 0 /news/551a9250bdea5 2 15759 0 0 /news/chathamtown3-2merstham-cassisgettingbacktohisbestsaysobrien 1 23158 0 0 /news/thamesmeadtown2-1whitstabletown-ryanbriggscanonlygetbettersaysmcmahon 1 38710 0 0 /news/thamhari011116 2 53085 0 0 /news/lordswood111204.html 1 0 0 0 /news/wemustkeepourfeetonthegroundsaysthurgood 1 14852 0 0 /news/bromvhamp251003.html 1 0 0 0 /news/thambren030215 2 46939 0 0 /news/551a96dc793a8 2 20694 0 0 /news/dartford0-3afchornchurch-welostwithdignitysaysproudburman 1 19670 0 0 /archive-2006-2014/142 1 19455 0 0 /news/tozercontractsswinefluinibiza 1 19619 0 0 /news/greenwich210120 3 18073 2 2 /news/551bc5d9d5efb 4 44182 0 0 /news/justgiving.com/fundraising/Ricky-Bennett3 1 0 0 0 /news/sittingbourne250420 2 24141 0 0 /news/aylesburyunited4-2favershamtown-itsnotbeenagoodweekfortheclubadmitsrayturner 1 8965 0 0 /news/resultsforaprilmay2010 1 75350 0 0 /news/cugleybothramsgateandfolkestonehavedoneeversowelltogetwherewearenow-exclusive 1 16252 0 0 /news/fleetbouncebackatfirstattempt 1 13848 0 0 /news/becksissueultimatumtounderperformingstars-exclusiveinterview 1 15819 0 0 /news/phoevcd011215 2 78113 0 0 /news/wehopetoreigniterobdennessenthusiasmforthegamesayscorinthiancoachmattlonghurst 1 16879 0 0 /tonbridge-2003-2006/2 2 29370 0 0 /news/tonightsresults 1 10928 0 0 /drmartens/eastern/ashford/cray260205.html 1 9955 0 0 /news/ramsgatedontfearbrightoninfayouthcupshowdown-exclusiveinterview 1 15408 0 0 /news/maidstoneunited5-0dulwichhamlet-imsohappyweperformedforanamazingcrowdsayssaunders 1 22608 0 0 /national-league/6 4 46571 0 0 /news/weneedagoodeastersaysnott 1 16739 0 0 /news/551a9c92ace77 2 16053 0 0 /news/weneedtobeatourbesttogetanythingoutofdaventrytiesaysramsgatebosstimdixon 1 12812 0 0 /news/hernebay3-1lordswood 1 20143 0 0 /news/Leaguestatements090922 3 38937 0 0 /news/weworkedoursocksoffagainsterithtownsayssevenoakstownbossdarrenanslow 1 12330 0 0 /news/tonbridgeangelssignlewishamilton 1 18169 0 0 /news/savethewingscampaignonelastpushandwerethere-targetisnow6312 1 24994 0 0 /news/ihavesupportersbestinterestsatheartinsistsashfordchairman 1 15445 0 0 /news/thekeywillberecreatingtheintensityofplayingagainsttheholderssaysmartinlarkin 1 15355 0 0 /news/erithbelvedere2-1maidstoneunited-yiadomisourmaninsistsderesbosscosgrove 1 20899 0 0 /news/FAGuidance010620 2 17290 0 0 /news/551bc99d56395 2 17618 0 0 /news/quested040522 4 60366 0 0 /news/folkestone220518 2 23900 0 0 /news/551a979ac8b4f 1 4963 0 0 /news/wevegottogetthisshowontheroadsaysstunnedramsgatebossjimward 1 18567 0 0 /news/othernews/AEI221104.html 1 0 0 0 /news/dartford250522 5 54476 0 0 /news/wp-content/plugins/superstorefinder-wp/ssf-wp-admin/pages/SSF_WP_UPLOADS_PATH/csv/import/xo.php 1 0 0 0 /news/shepwhit080418 1 33201 0 0 /news/strikernugentcompletesstones18-mansquad 1 11392 0 0 /news/tunbridgewells101123 2 27408 0 0 /news/twoin-twooutforangels 2 15115 0 0 /news/resultsaprilmay2018 3 162919 0 0 /news/ourgrailistowinthekentleagueandanythingelseisabonussayshernebaybosssimonhalsey 1 15477 0 0 /news/stonesgivenonelastchance 1 13844 0 0 /news/holmdeal160322 4 155966 0 0 /news/hillgoesundertheknife 1 12369 0 0 /news/kspofish130318 1 30649 0 0 /news/lordswood0-3hythetown-peopleareraisingtheirgamesagainstussayshythebossscottporter 1 18120 0 0 /news/551bc5dbd8ba0 3 33660 0 0 /news/mangotsfield111005.html 1 0 0 0 /news/favershamtowngivengreenlightforpromotion 1 16861 0 0 /news/hernebaygearing250519 2 29631 0 0 /news/kentleague/tunbridgewells/pagham040904.html 1 0 0 0 /news/othernews/youthleaguetables010304.html 1 0 0 0 /news/drmartens/eastern/ashford/29thnov04.html 1 0 0 0 /news/551bc99dbe7a4/drmartens/eastern/folkestone/kentleague/sladegreen/2ndjuly03.html 2 15653 0 0 /news/wellgivelordswoodrespecttoavoidcupupset-munday 1 20249 0 0 /news/glebesutton090216 1 36990 0 0 /news/burmanactstobringacouplequalityplayerstodartford-exclusive 1 12857 0 0 /news/dealtown050421 1 12221 0 0 /news/11thjuly03.html 1 0 0 0 /news/tommywarrilowquitsaftertonbridgeangelssufferthedrop 1 14986 0 0 /news/dannygannon241117 1 14863 0 0 /news/editorsnote21112014 1 12777 0 0 /news/thamesmead020815 2 33705 0 0 /archive-2006-2014/108 1 20610 0 0 /news/kentleaguetitledualwemusttreatwellswithrespectinsistshuggins-exclusiveinterview 1 13653 0 0 /news/hessenthalertargetstwoloansignings-exclusive 1 13946 0 0 /news/ramsgate130816 2 24805 0 0 /news/glebe04062015 2 15211 0 0 /news/greenwich200519 1 14531 0 0 /news/551bc5dc0df3b 2 15217 0 0 /news/551a97b175270 1 17454 0 0 /news/whitstabletown1-3folkestoneinvicta-ifwewinourlastfivegameswellbechampions-cugley 1 26650 0 0 /news/canterbury010219 1 13092 0 0 /news/551bc99dbe7a4/kentleague/thamesmead/drmartens/eastern/fisher/21stjuly03.html 2 15653 0 0 /news/551a9c915cecd 2 18229 0 0 /news/aclondon170416 2 23624 0 0 /news/under21leagueexpandsto22teamsnextseason 1 12948 0 0 /news/wewillnotbeacasulatyatharefield-hume 1 13837 0 0 /news/551a92503fcf4 2 17579 0 0 /news/FAConstitutions180521 2 20088 0 0 /news/551a9c0f329cf 2 21592 0 0 /news/westandaverygoodchanceagainstchelmsfordinsistsburman 1 17985 0 0 /news/551bc99dbe7a4/ryman/kentleague/thamesmead/18thnov03.html 2 15653 0 0 /news/eighthwonder241016 2 35492 0 0 /news/sittingbourne180915 2 26783 0 0 /news/chathamtown0-1ashfordtown-sodjeimpressesbutlackoffirepowerconcernsmiles 1 19699 0 0 /news/551a99e5203dd 1 25633 0 0 /news/bromvwalton060903.html 1 0 0 0 /news/starstrikersrejectwellsadvances 1 13758 0 0 /news/soccershortsstrikerstuartzanoneoptstoquitashfordunitedtoreturntorochesterunited 1 29300 0 0 /news/chathamtown1-1horshamymca-strikershadnoluckinfrontofgoalsaysobrien 1 22631 0 0 /news/doverathletic250521 1 12653 0 0 /news/crowborough260521 1 10831 0 0 /news/sevenoaks170716 1 16639 0 0 /news/craywanderers3-2margate-wehavenodefenceadmitsbutler 2 77670 1 1 /news/saturdaysfixtures 1 24283 0 0 /news/sladegreenunveilnewmanagementteam 1 12267 0 0 /news/wemustplugthegapssayscugley 1 16542 0 0 /news/AFCWimbeldon041204.html 1 0 0 0 /dartford-2003-2006/www.heineken.co.uk/ 1 3151 0 0 /news/551a97996a468 1 4871 0 0 /erith-town-2003-2006/www.heineken.co.uk/ 1 3170 0 0 /news/holmcori211023 4 112657 0 2 /news/551bc5e782cb5 1 11236 0 0 /news/corbytown2chathamtown0 2 16532 0 0 /news/quinnisourcaptainmarvelsaysseager-exclusive 1 18209 0 0 /news/whitstabletown3-0ashfordtown-welackedfightbemoanslangton 1 33192 0 0 /news/fleetsmarchtothewembleyarchwemustmakeourhomeadvantagecountsaysdaish 1 14652 0 0 /news/551a95b464a59 2 18634 0 0 /news/crowborough031117 1 13732 0 0 /news/chathamtown3-1doverathletic-chatsshineindoublewinoverdover 1 19007 0 0 /news/seagerkeepseveryonesfeetontheground-exclusiveinterview 1 19659 0 0 /news/551a967819dcc 2 15654 0 0 /news/itsgoingtobeagreatmarchandaprilbecauseeveryonesgottoplayeachother-simonhalsey 1 14270 0 0 /news/thamesmead310704.html 1 0 0 0 /news/threesev180919 2 51016 0 0 /news/551bc5deacd3f 1 10912 0 0 /news/whitstable010218 1 12575 0 0 /news/551bc5e4dd621 1 12581 0 0 /news/floodlights210819 3 38130 0 0 /news/drmartens/eastern/folkestone/gravesend170704.html 1 0 0 0 /news/551bc99dbe7a4/drmartens/eastern/dartford/drmartens/eastern/sittingbourne/rothwellvsittingbourne20903.html 2 15653 0 0 /news/stevefirkinsquitsbottomsidefisherthroughfamilycommitments 1 12497 0 0 /news/tunbridgewellsbossmartinlarkinissuesrallyingcryaheadofbigweekend 1 23933 0 0 /news/tunbridgewells4-2tonbridgeangelsgibbonsafewofourguyslookedutterlyterrified 1 19449 0 0 /news/551bc5e7ef294 1 10625 0 0 /news/drmartens/eastern/folkestone/22ndjuly03.html 1 0 0 0 /archive-2006-2014/189 1 19574 0 0 /news/thefaplacebanonnon-leaguefootballersplacingbetsonworldwidefootballmatches 1 13778 0 0 /news/maidstoneunited2-2worthing-wehavetoimprovesaysfrustratedstonesbossjaysaunders 1 26668 0 0 /news/gillsports260415 1 25082 0 0 /news/hillsborough 1 10194 0 0 /news/holmesdale200720 1 11322 0 0 /news/epsom&ewellstatement111020 1 12220 0 0 /news/551bc99b560b5 1 3437 0 0 /news/itsnotgoingtobeawalkintheparkagainstchipsteadwarnsmaidstoneunitedbossjaysaunders 1 12662 0 0 /news/thisisachanceformyplayerstoshowwhattheycandosaysjackparkinson 1 12845 0 0 /news/kentfabeginsearchforanewcharitypartner 1 28229 0 0 /news/wingate230405.html 1 0 0 0 /news/551bc5db459a6 3 27014 0 0 /news/kentleaguestepupplansfornewdivision 1 13682 0 0 /news/551a92503b556 2 17946 0 0 /news/welllew080818 1 35317 0 0 /news/robbinsaddsmorenutsboltstohissquad-exclusive 1 14507 0 0 /news/wecanonlyprogressbyreturninghomeinsistsfisherchairman 1 30750 0 0 /news/drmartens/premier/welling/8thaug04.html 1 0 0 0 /news/kentleaguemanagersdemandcuprethink-exclusiveinterviews 1 19359 0 0 /news/fcelmstead180915 1 15648 0 0 /news/dulwichhamlet020323 2 27136 0 0 /news/iwillbedisapointedifwerenotplayingsoutherncountieseastfootballnextseasonsaysmacneil 1 17207 0 0 /news/ramsgateteenagestrikerlockyerimpressesonpalacetrial 1 13141 0 0 /news/551a95b36a063 2 14191 0 0 /news/551bc99b6c156 1 6563 0 0 /news/soccershortsmargatesfuturelooksbleak 1 22040 0 0 /news/wevegotnothingtolosesayserithtownbossmarktompkins 1 17227 0 0 /news/bearchat250122 5 112106 0 0 /news/sheringhamintalkswithwingsrivals 1 11969 0 0 /news/vcdathletic301020 2 26143 0 0 /news/wivenhoe271104.html 1 0 0 0 /news/werehappywiththewaythingsaregoingsaysholmesdalecoach 1 14480 0 0 /news/drmartens/premier/dover/21stoct04.html 1 0 0 0 /news/greeniesfridaypreview 2 25867 0 0 /news/conference/margate/17thjuly03.html 2 0 0 0 /news/bromley030920 1 13892 0 0 /news/drmartens/premier/dover/7thsept04.html 1 0 0 0 /news/5thdec05.html 1 0 0 0 /news/551bc99dbe7a4/drmartens/premier/welling/conference/margate/24thjune03.html 2 15653 0 0 /news/551bc99dbe7a4/drmartens/eastern/dartford/ryman/bromley/bromvashfordfac160903.html 2 15653 0 0 /news/cugleywantstowinramsbattle 1 20967 0 0 /news/3rdoct05.html 1 0 0 0 /news/rusthall050918 1 14336 0 0 /news/metrolewath200415 1 26399 0 0 /news/bromley4-2favershamtown-leaguehasbeenaneyeopeneradmitsfavershamtownbosskevindoyle 1 26576 0 0 /news/wemustwintokeepourseasonalivesayslovell-exclusive 1 16911 0 0 /news/27thaug03.html 1 0 0 0 /news/bromley150616 2 19273 0 0 /news/wp-content/plugins/cache/css.php 1 0 0 0 /southern-counties-east-football-league/12 1 20354 0 0 /news/expectanttonbridgesettogatecrashstoneshomecomingparty 1 15141 0 0 /news/kentleague/greenwich/7thjuly03.html 1 0 0 0 /news/551a97b23c140 1 13199 0 0 /news/chalwhit280919 3 65793 0 0 /news/551bc99ce9a3d 2 20721 0 0 /news/injuriestokeydefendersgivesopportunitiestoothers 1 13239 0 0 /news/hernebay130219 2 33602 0 0 /news/bromgill100718 2 35613 0 0 /news/551bc99dbe7a4/kentleague/cray/kentleague/thamesmead/18thsept03.html 2 15653 0 0 /news/sykochallengechriskinnearsreds1clivewalkersblues3-kentstarstributes 1 22448 0 0 /news/localrivalssharenewleaseoflifeexclusiveinterview 1 12770 0 0 /news/FAStatement290920 2 15721 0 0 /news/551a956b8c532 1 3217 0 0 /news/tonbridgeangels2-1ashfordtown-allmaniscommittedtoashfordinsiststhorogood-exclusive 1 20205 0 0 /news/nationalleague090618 1 11659 0 0 /news/ryman/bromley/bromleyvlewes190803.html 1 0 0 0 /news/itsimportanttogetpeoplethroughthegatesaysabbott 1 16001 0 0 /news/porterhasgottotakethisopportunitysaysorientbossslade 1 16682 0 0 /news/551bc5e3729b1 1 20802 0 0 /news/banburyvsitt111003.html 1 0 0 0 /news/sevenoakstownfc.co.uk 1 0 0 0 /news/corinthian310818 1 12949 0 0 /news/551bc99dbe7a4/kentleague/ramsgate/kentleague/lordswood/23rdjuly03.html 2 15653 0 0 /news/isthmian.co.uk 1 0 0 0 /news/tonbridgeangels1-1borehamwood-wereaimingashighaswecansayspositivetommywarrilow 1 21984 0 0 /news/551a9cf4e5b03 2 18540 0 0 /news/ramsgate180915 2 25074 0 0 /news/vcdathleticphernebaypmatchpostponed-waterloggedpitch 1 10399 0 0 /news/lewes0-0bromley-theresnowayweshouldbegoinghomedrawingblankssaysbird 1 22641 0 0 /news/551bc99dbe7a4/kentleague/thamesmead/ryman/bromley/25thsept03.html 2 15653 0 0 /news/551bc5e30b732 1 21405 0 0 /news/vcdathletic3-0erithtown 1 15708 0 0 /news/erithbelvedere2-2folkestoneinvicta-alfiemaydeservesalltheplauditssaysmattlonghurst 2 42049 0 0 /news/seveayle151019 2 62414 0 0 /national-league/27 2 23747 0 0 /news/idontwanttheclubtostandstillsaystonbridgeangelsbosstommywarrilow 1 15911 0 0 /news/551a956c61d5a 1 5554 0 0 /news/princesparkspecialexplosiveentrancemademyhairsonthebackofmyneckstandup 1 14193 0 0 /news/othernews/youthleaguetables.html 1 0 0 0 /news/resultsaugust2019 2 76254 0 0 /news/chathamtown0-2sittingbourne-obrienwerenotinfreefallitsanabsolutedownpour 1 21211 0 0 /news/fisher010819 1 12788 0 0 /news/drmartens/premier/welling/welling.html 2 0 0 0 /news/resultsmarch2014 1 76168 0 0 /news/gillingham1-2queensparkrangers-idgivethepunterstheirmoneybacksaysjamesmarrs 1 23643 0 0 /news/551a9718cb054 2 15939 0 0 /news/ebbsfleetunited1-0woking-daishpraiseshiswinningcrewe 1 19806 0 0 /news/soccershorts230616 2 34990 0 0 /news/phoenixsports021023 2 24703 0 0 /news/551a97994de72 1 6267 0 0 /news/551bc5e0c1f55 1 15322 0 0 /news/551a9c0e6062a 2 14869 0 0 /news/kentleague/cray/crayvsporting160803.html 1 0 0 0 /news/beckenhamtown2-0erithtown-bitterrivalsclashoverjamalyorksselection 1 38032 0 0 /news/cugleydisappointedwithlatepostponementbynegativereferee-exclusive 1 14069 0 0 /news/fleetcouldfacecutsif19000membersdontrenewsubscriptions 1 15106 0 0 /news/T&Mvbrom060304.html 1 0 0 0 /news/wingatefinchley1-0thamesmeadtown-weneedtogetourselvesadecentgoalscorersaysmcmahon 1 29470 0 0 /news/drmartens/eastern/erith&belvedere/8thsept04.html 1 0 0 0 /news/doverchairmancallsforasupportersclub 1 13692 0 0 /news/whitstabletown2-0harrowborough-onourdaywefearno-onesayswhitstablebossjustinluchford 1 19552 0 0 /news/dartfordsprincesparkshowcasestopinternationalyouthfootball 2 16532 0 0 /news/sevecray090422 2 68475 0 0 /news/doverathletic240421 1 13244 0 0 /news/hugolangton250218 1 14273 0 0 /news/eritroch090817 1 11290 0 0 /news/551bc99dbe7a4/kentleague/cray/drmartens/eastern/folkestone/folkvstam221103.html 2 15653 0 0 /news/EnglandSchoolboys211221 3 31964 0 0 /news/seagerexplainskingabsence-exclusiveinterview 1 11307 0 0 /news/weknowitsgoingtobedifficultforusadmitsthamesmeadtownbosskeithmcmahon 1 18325 0 0 /news/corby130805.html 2 0 0 0 /news/xmrlpc.php 1 0 0 0 /news/kentleague/sladegreen/3rdsept03.html 2 0 0 0 /news/lewes140717 2 25118 0 0 /news/thanettussleisagreatoccasionforthefanssaysward-exclusive 1 17558 0 0 /news/preseason2020 2 67407 0 0 /news/11thaug05.html 2 0 0 0 /news/ebbsfleet240817 1 12131 0 0 /news/551bc5e629c30 1 14609 0 0 /news/cablestakenfromculverdenstadium 1 12833 0 0 /news/bromvdulwlsc030204.html 1 0 0 0 /news/favershamtown1-2beckenhamtown-theresnopressureonmyladssaysluchford 1 23262 0 0 /news/26thjuly05.html 2 0 0 0 /news/soccershortswewanttoreturntotherymanleagueasquicklyaspossiblesaywhyteleafe 1 20741 0 0 /news/hernebay4-0erithtown-danlawrencehasgothishungerbacksayshernebaybosssimonhalsey 1 34087 0 0 /news/ryman/bromley/hampvbrom210204.html 2 0 0 0 /news/30thjune05.html 1 0 0 0 /news/ijustwanttofinishashighaswecansaystonbridgeangelsbosstommywarrilow 1 15217 0 0 /news/551bc99dbe7a4/ryman/drmartens/eastern/dartford/11thaug03.html 2 15653 0 0 /news/wellbren090419 1 24203 0 0 /news/ryman/bromley/bromvwhyt280204.html 1 0 0 0 /news/eduseirepayswarrilowforkeepingthefaith-exclusive 1 16715 0 0 /news/bromley230705.html 1 0 0 0 /news/january2011results 1 76579 0 0 /news/merielth120116 1 30920 0 0 /news/banburyunited1-2tonbridgeangels-dolbyhailsvaluablewin-exclusive 1 19084 0 0 /news/tonbridgeladies151015 3 39022 0 0 /news/wecantwaitforthefirstwhistlesaysseager 1 12447 0 0 /news/conference/margate/26thjuly04.html 1 0 0 0 /news/eritherith261117 1 30189 0 0 /news/favehern110220 3 84991 0 0 /news/bromley230518 2 20203 0 0 /news/sct171116 1 12074 0 0 /news/ebbsbrom170215 1 28964 0 0 /news/beckenhamtown120822 3 36610 0 0 /news/croywhit040418 1 29055 0 0 /news/welltaketonbridgetoanotherlevelinsistsskipperaris-exclusive 1 16893 0 0 /news/16thjune04.html 2 0 0 0 /news/kingstoniansignsouthafricanpotterillfrombromley 1 11007 0 0 /news/sittingbourne1-0corinthian-casuals-itsagoldenopportunityforouryoungsters-abbott 1 17279 0 0 /news/theroadtowembleyfleetaimingtoendturbulenthistoryagainstexeter 1 13272 0 0 /kent-invicta-league/32 3 27997 1 1 /news/weregoingtowembleyfleetconfidenttheycanbreaktrophyfinalcrowdrecord 1 14131 0 0 /news/beckenhamtown1leatherhead2 2 17892 0 0 /news/browndelightedwithdebollasigning 1 11779 0 0 /news/borehamwood0-2bromley-wevegotateamthatshoulddobetterintheleagueadmitsneilsmith 1 24653 0 0 /news/elmsspor170118 1 76666 0 0 /news/sheppey260720 1 13121 0 0 /news/extrafansgivesboxingdaygamesaddedspicesayswarrilow 1 18487 0 0 /archive-2006-2014/294 3 33323 0 0 /news/wemustkeeptherungoingsaysjenkins 1 12557 0 0 /news/crayshep220423 4 157730 0 0 /news/othernews/SECWFL010204.html 1 0 0 0 /news/drmartens/eastern/folkestone/folkvtonb160304.html 1 0 0 0 /archive-2006-2014/167 1 19503 0 0 /news/551bc5de7f259 1 11485 0 0 /news/metrogas290416 1 11148 0 0 /news/matchreports-2 1 35230 0 0 /drmartens/eastern/ashford/ashvbromleyfac130903.html 1 9955 0 0 /news/551a956c2de9d 1 4922 0 0 /news/othernews/Foresters.html 1 0 0 0 /news/551bc99a9bf3b 1 4751 0 0 /news/maidstoneunited240323 2 31772 0 0 /news/sutton050617 1 11841 0 0 /news/551a956ba9848 1 4991 0 0 /news/wevejustgottoputanotherruntogethersaysmaidstoneunitedbossjaysaunders 1 16107 0 0 /news/wecanstillreachtheplay-offssaysdoverathleticbosschriskinnear 1 15241 0 0 /news/bromley080618 2 15162 0 0 /archive-2006-2014/277 2 23830 0 0 /news/dartfordpreparefortheirbiggesttests-exclusive 1 19151 0 0 /news/hernebaycelebrateshieldsuccessincludessaturdaysheadlines 1 19986 0 0 /news/551bc99dbe7a4/drmartens/eastern/ashford/drmartens/eastern/dartford/9thoct03.html 2 15653 0 0 /news/winchester280804.html 1 0 0 0 /news/dartford1-4forestgreenrovers-imjustabsolutelyguttedforlouiswellssaystonyburman 1 23935 0 0 /news/craywanderers2-2harlowtown-imsoconfidentweaintgoingtogetrelegatedsaysgaryabbott 2 34857 0 0 /news/551bc5e07186b 1 17841 0 0 /news/kentleague/greenwich/2nddec04.html 1 0 0 0 /news/itsimportantwegetbacktothelevelswecanplayatsayserithtownbosstonyrussell 1 15102 0 0 /news/bromley23122018 2 16098 0 0 /news/craylewe200118 3 73741 0 0 /news/snodlandtown040619 1 11758 0 0 /news/21stjuly03.html 1 0 0 0 /news/551a97984f136 1 4779 0 0 /news/tabletoppingdoverfaceselectionheadache 1 12644 0 0 /news/551bc99dae254 2 26552 0 0 /news/551bc99d75f81 2 35947 0 0 /news/whitstabletownvacancygeneratesinterestfromfarandwide 1 12778 0 0 /news/youdonthavetostartwelltowinthisleaguesayswalker 1 13506 0 0 /news/551bc5e6ae00d 1 16013 0 0 /southern-counties-east-football-league/63 1 18948 0 0 /news/15thsept03.html 1 0 0 0 /news/wardsealsabelloandeal-exclusive 1 13297 0 0 /news/thereareafewwellknownnamesonboardsayssevenacresidcupbosschristuley 2 18901 1 1 /news/551bc5e120bd0 1 11863 0 0 /whitstable-2003-2006/3 1 11017 0 0 /news/mysteryinvestorattonbridgeangels 1 12567 0 0 /news/weneedtokeepagoodrungoingsaysthamesmeadtownbosskeithmcmahon 1 15212 0 0 /news/seagerwillbeatopmanagersaysfatherfiguresampson-exclusive 1 17143 0 0 /news/bromleyontheorientthankyouforyourfantasticsupportsaysdannywaldren 1 16785 0 0 /news/snodlandtown010819 1 14047 0 0 /news/hythetown021122 4 30835 1 1 /news/youliketobetheunderdogssometimesbecauseitgivesyoualiftsaysdartfordbosstonyburman 1 16144 0 0 /news/craymet030517 1 35892 0 0 /news/favershamsdestinyinhandsofleaguefixturesecretary 1 14048 0 0 /news/bromley270817 2 16830 0 0 /news/whittoot070315 2 51567 0 0 /news/haveyoujoinedthecenturyclub 1 10107 0 0 /news/551bc99dbe7a4/drmartens/eastern/dartford/ryman/bromley/bromvwalton060903.html 2 15653 0 0 /isthmian-league/3 5 81666 0 0 /news/folkestoneinvicta2-1crawleydowngatwick-wemightsneakbackintoplay-offssaysneilcugley 1 25875 0 0 /news/551a9bafda2af 4 29610 1 1 /news/drmartens/premier/dover/12jan04.html 1 0 0 0 /news/greenwich061218 2 30523 0 0 /news/551bc5dd6efe2 2 17206 0 0 /news/warrilowbutthebottomlineisstillthatthemostimportanttargetistogetoutofthisleague 1 14936 0 0 /news/wekeepshootingourselvesinthefootsaysfrustratedseager 1 12127 0 0 /news/ryman/bromley/fisher270704.html 1 0 0 0 /news/551bc5e637b72 1 15075 0 0 /news/bromvcroyath240204.html 1 0 0 0 /news/551bc5db772d3 4 55012 0 0 /news/bromleystrikeitluckywithnewsignings 2 14670 0 0 /whitstable-2003-2006 13 171098 0 1 /news/wevegotgreatexpectationstobringthecuphomesaysaddicksbossstuartweston 1 17795 0 0 /news/wereclosinginonleaguetitlesayshessenthaler 1 13274 0 0 /news/bromley120618 2 21039 0 0 /news/allsystemsgoforwhyteleafesstate-of-the-art3gpitchatchruchroad 2 16008 0 0 /news/LondonFAStatement050321 3 34150 0 0 /news/551bc99cf2670 2 23904 0 0 /news/farnieaimingforplaceinlast32offavase-exclusive 1 14832 0 0 /news/beckenhamtownpulloffsheringhamsigning 1 13873 0 0 /news/croydon3-2horleytown-ineedfinancialhelpbigtimesayscroydonchairmandicksongill 2 39529 1 1 /news/551a95b37e11a 3 37548 0 0 /news/9thjan05.html 1 0 0 0 /news/imdelightedwehavehernebayfirst-itsagreatopenersaysbeckenhamtownbossjasonhuntley 1 13479 0 0 /news/facarlsbergvasefourthrounddraw 1 11828 0 0 /news/welling030317 1 12459 0 0 /news/LondonFAStatement090420 2 14591 0 0 /news/fisher010816 1 14845 0 0 /news/fordpleasedwithwingscharacter 1 11394 0 0 /news/551bc5df952a3 1 14473 0 0 /news/drmartens/eastern/tonbridge/3rdnov04.html 2 0 0 0 /news/werenotoverthewhitelineyetsayshernebaybosssimonhalsey 1 13934 0 0 /news/footballerslaunchappealtoraise100000forseriouslyillgoalkeepergeorgehoward 1 13267 0 0 /news/551bc5dc8e414 3 32424 0 0 /news/refereesmustberespected-kcfa 1 14724 0 0 /news/dulwichhamlet160320 1 12388 0 0 /news/clivewalkerreturnstochathamtown 1 10678 0 0 /news/sodjeendshisshorttramrideintimeforall-kentcupshowdown 1 15505 0 0 /news/hopefullywecandotheislandproudandbringbacktheglorydayssayssheppeybosskevinhake 1 16928 0 0 /news/tunbridgewells3-4erithtown-goodsidesfindwaysofwinningsaystonyrussell 1 39491 0 0 /news/croydon190305.html 1 0 0 0 /news/kentsenfinal300415 1 16959 0 0 /news/ashfvbrom250803.html 1 0 0 0 /news/mittenlossesracetofaceymcaincupclash 1 17050 0 0 /news/ireallywanttogetourseasongoingsaystonbridgeangelsbosstommywarrilow 1 18050 0 0 /news/ivegonetoaclubthatibelieivewillbechallengingforhonoursagainsaysandyconstable 1 19440 0 0 /news/27thfeb05.html 1 0 0 0 /news/wp-content/themes/finley/min.php 1 0 0 0 /news/tunbridgewells2-2thamesmeadtownaetweshouldhavebeatenthemadmitsfarnie-exclusive 1 22326 0 0 /news/sittingbourne0-0fleettown 1 13950 0 0 /news/workbrom030218 1 28144 0 0 /news/16thjan05.html 1 0 0 0 /news/apmcontrast290116 2 15912 0 0 /news/millwallstatement061220 2 25527 0 0 /archive-2006-2014/143 1 19623 0 0 /news/551bc99cb5351 2 28114 0 0 /news/whitstable140804A.html 1 0 0 0 /news/bearsted050817 1 13354 0 0 /news/favershamfaceautomaticfineof150 1 19305 0 0 /news/greenthankyouforyourmessagesofsupport-iwillbeback 1 24396 0 0 /isthmian-league/30 3 45153 0 0 /news/chatham170117 5 40464 2 2 /news/kentrivalsbothconfidentofwinningdog-fight-exclusiveinterviews 1 16708 0 0 /news/ryman/bromley/29thfeb04A.html 1 0 0 0 /news/551a97988b767 2 21485 0 0 /tonbridge-2003-2006/3 2 29134 0 0 /news/ryman/12thaug03.html 1 0 0 0 //chosen.php 1 3578 1 1 /news/welljusthavetopromotefromwithinsayscash-strappedfolkestonebossneilcugley 1 19050 0 0 /news/tonbridgeangels1-2leiston-wevecomeupalittlebitshorttonightadmitsstevemckimm 2 32594 0 0 /news/551a931dd8b42 1 13002 0 0 /news/fisher1-2canterburycity-wevemadehistoryfortheclubsaysproudbosssimonaustin 1 29889 0 0 /news/551a9b4827118 4 38647 0 0 /news/drmartens/eastern/dartford/23rdsept03.html 2 0 0 0 /news/ksports250322 1 12328 0 0 /news/corinthian0-6holmesdale-itwasmenagainstboysadmitssitford 1 18224 0 0 /news/ryman/bromley/fisheru18vbromu18070304.html 2 0 0 0 /news/fisher2-3greenwichborough-itsobviouslynicetowinheresaysgerrycox 1 26278 0 0 /news/551bc99c21b5e 2 22059 0 0 /news/gravesendnorthfleet2canveyisland0 1 16400 0 0 /news/kentleague/sevenoaks/21stjuly03.html 1 0 0 0 /news/tunvseven240404A.html 1 0 0 0 /news/drmartens/eastern/ashford/30thDec2003.html 1 0 0 0 /news/delightedmcmahonunveilsnorthwoodsigning 1 12042 0 0 /news/whitstabletown2-2horsham-werenotfinishingteamsoffsayswhitstablebossjustinluchford 3 61405 1 2 /news/551bc5dc15fb6 2 19243 0 0 /news/whitstabletownbossmarklanegetshistroopsfitandraringtogo 1 17929 0 0 /news/charltonathletic211021 2 16170 0 0 /news/piscinaholdsshowdowntalkswithdolbytonight-exclusiveinterview 1 17202 0 0 /news/bromley090318 1 17641 0 0 /news/lewisham010916 1 13183 0 0 /news/551a956b7b94e 1 3176 0 0 /news/ramsarun070919 2 53484 0 0 /news/eastdulw020516 2 50583 0 0 /news/croydon150422 2 17374 0 0 /isthmian-league/8 5 82593 0 0 /news/551bc5df195c3 1 15045 0 0 /news/551a97b0b185c 1 11023 0 0 /news/551bc5e7afdf8 1 11958 0 0 /news/sittvbash061203.html 1 0 0 0 /news/kentleague/lordswood/7thjuly03.html 1 0 0 0 /news/wellcori101020 5 179491 0 1 /news/rusthall300523 1 12577 0 0 /news/bermondseytown090123 5 60934 1 1 /news/nowletsgoandwinthetitlesayshume-exclusiveinterview 1 13598 0 0 /news/itwouldbegoodtostartestablishingourselvesinthefatrophysaysgavinrose 1 15029 0 0 /news/551bc99dbe7a4/kentleague/maidstone/othernews/cafcladies30thdec03.html 2 15653 0 0 /news/wewanttoreallycauseanupsetsaysdartfordbosstonyburman 1 18695 0 0 /news/huntleyandmehmetarestayinghereinsistsbeckenhamsecretary 1 15306 0 0 /news/soccershortsimnotinterestedinplayerslookingformoneywarnssevenoaksbosslevett 1 33162 0 0 /news/sevenoakstown0-0vcdathletic-frostidontwantthejob-exclusive 1 21304 0 0 /news/551a9799c7174 1 5963 0 0 /news/greenwichborough0-1erithtown-letskeeptheseasonalivesayserithtownbossmarktompkins 2 37643 0 0 /news/iamnothidinginsistsdolbyafterfanscallforanewmanager 2 19143 0 0 /news/craywands240818 3 34404 0 0 /news/werestilllookingatthetargetof10winssaysholmesdalebossfabiorossi 1 14507 0 0 /news/tonbridge221216 2 33174 0 0 /news/551bc5dad6b34 4 35788 0 0 /news/kentcountyleaguestatement220320 1 12175 0 0 /news/551bc99dbe7a4/kentleague/thamesmead/ryman/bromley/slouvbrom121103.html 2 15653 0 0 /news/twokentsidesmovetorymanonenorth-exclusive 1 16092 0 0 /news/beckstoostrongforcorinthiansayshuntley 1 13855 0 0 /news/lovellresignsassittingbournemanager 1 11731 0 0 /news/551bc99acb681 2 20189 0 0 /news/551a97b0f416e 2 36002 0 0 /news/kentleague/tunbridgewells/20thsept04.html 2 0 0 0 /news/holmesdale081217 1 13317 0 0 /news/greenwichborough3-2hernebay-proudfirkinspaystributetohisunpaidheroes 1 47583 0 0 /news/26thoct04.html 1 0 0 0 /news/drmartens/eastern/folkestone/ramsgate200704.html 1 0 0 0 /news/21staug05.html 1 0 0 0 /news/metpolice290305.html 1 0 0 0 /news/551bc5e306ffd 1 13144 0 0 /news/championsdoverathletic1-0burgesshilltown-thewaitisoverfordoverathletic 1 21390 0 0 /national-league/29 2 24080 0 0 /news/wellkent311018 2 45152 0 0 /news/rochesterunited270621 1 11117 0 0 /news/chathamtown2-3metropolitanpolice-wehaventreallyhadanyluckthisyearsayspaulfoley 1 24758 0 0 /news/kentleaguelookatfavershamtownsapplication 1 13063 0 0 /news/werebothfedupwiththegameadmitsgibbons-exclusive 1 12938 0 0 /news/kselm041116 2 63347 0 0 /news/hopefullywewillsurpriseafewclubsthisyearsayswellingunitedbossjamieday 1 16411 0 0 /news/bromley100319 2 17652 0 0 /news/ebbsfleetunited2-1tonbridgeangels-westtakeshischancetoimpress 1 23057 0 0 /news/wecouldvegotsomethingfromthegamesaysmcmahon 1 17221 0 0 /news/551a924fea287 3 33548 0 0 /news/wemustremainunbeatenagainstourplay-offchallengerssayswarrilow 1 18193 0 0 /news/551bc5e277eef 1 13502 0 0 /news/margatesnapupfleetpair 1 11122 0 0 /news/fisher130815 1 14564 0 0 /news/23rdmar04.html 1 0 0 0 /kent-invicta-league/22 2 24056 0 0 /news/whitstabletownunveilpeternottastheirnewmanager 1 17981 0 0 /news/triomissingforsittingbourne 1 12331 0 0 /news/chathamtown1-2afcsudburymileswewasntattheraces-exclusiveinterview 1 17734 0 0 /news/matchreportshaltingourtrophytiewasridiculousfumesdoverchairman 1 26229 0 0 /news/imexpectingustowinbecauseramsareinalowerleaguesayscrayvalleybossstevechapman 1 14204 0 0 /news/hollkspo220120 1 29714 0 0 /national-league/9 3 41807 0 0 /news/chathamtown0-1worthing-wehaventdoneenoughtonightadmitschathamassistantpeterhawkins 2 29452 0 0 /news/drmartens/eastern/folkestone/corbyvfolk181003.html 1 0 0 0 /news/bordenvillage250920 2 15453 0 0 /isthmian-league/38 3 45461 0 0 /news/favevcd271020 4 88341 2 2 /archive-2006-2014/88 1 20821 0 0 /news/kentleague/whitstable/whitvtham251003.html 1 0 0 0 /news/rednoseday2011 1 10450 0 0 /southern-counties-east-football-league/34 1 20610 0 0 /news/countdowntoprincespark15days-latestpicturesofdartfordsnewhome 1 12716 0 0 /news/holmesdale091020 2 17146 0 0 /news/551bc99dbe7a4/kentleague/ramsgate/kentleague/thamesmead/14thnov03.html 2 15653 0 0 /news/margate041022 5 57765 0 0 /news/crayvalley3-1barkingside-itsalwaysnicetogetabigteamsayspaulgross 1 24334 0 0 /news/payeflamingo100515 2 32534 0 0 /news/13thapr04.html 1 0 0 0 /news/fisher281016 1 13735 0 0 /news/551a967786a96 2 17183 0 0 /news/thebigkickoffiwanttowinthingsthisseasonsayscloke 1 12332 0 0 /news/ithinktheresabitmoretocomefromussaysvcdathleticbossrickybennett 1 15194 0 0 /news/kentleague/hernebay/1stjuly03.html 1 0 0 0 /news/551bc99dbe7a4/drmartens/eastern/tonbridge/ryman/bromley/8thjuly03.html 2 15653 0 0 /news/551bc5e867d0f 1 12170 0 0 /news/551a979846192 1 5076 0 0 /news/soccershorts160916 2 81527 0 0 /news/thamesmead300916 2 30717 0 0 /news/551bc99dbe7a4/drmartens/eastern/tonbridge/drmartens/eastern/sittingbourne/newportvsitt261003.html 2 15653 0 0 /news/551a95b396d83 3 28962 0 0 /news/margate210417 1 13017 0 0 /news/folkestone150522 2 32257 0 0 /news/pre-seasonfriendlies 1 20605 0 0 /news/soccershortsfolkestonecoachlindseytakesupgillsyouthrole 1 27714 0 0 /news/leggeisdestinedtoturnprofessionalsayswarrilow 1 13337 0 0 /news/tonbridgeangels281020 1 12207 0 0 /news/bromleyhaveanexcitingfutureaheadsaysnewlyappointedreserveteambosskeithbird 1 13224 0 0 /news/weveunder-achievedthisseasonadmitsheaslewood 1 12659 0 0 /news/doverathletic1-2woking-fansarenotseeingusdoaswellasiknowwecanadmitshayes 1 32164 0 0 /news/crayvalley240420 3 31128 0 0 /news/resultsdec2015 3 99723 0 0 /news/margate181217 1 11479 0 0 /news/folkestonesquadbeginstotakeshape 1 14054 0 0 /news/551a967712765 2 19230 0 0 /news/551a931dce714 2 27156 0 0 /news/thefacupisallaboutenjoymentsaystable-toppingluchford 1 15378 0 0 /news/sittingbourne300118 2 22883 0 0 /news/doverathletic1-0horshamymca-ourworstperformanceoftheseasonadmitshessenthaler 1 15761 0 0 /news/margate010620 3 35323 0 0 /news/craymissoutonkentderbyaftertrophyexit 1 11244 0 0 /news/creditcrunchthefashouldhelpnon-leagueclubsmoresaysdartschairman 1 16416 0 0 /news/551bc5e4389dd 1 2837 0 0 /news/brombore171120 6 122268 0 0 /news/wemustnotbecasualinfrontofgoalsaysburman 1 12952 0 0 /news/woking2-0maidstoneunited-imimmenselyproudofmyplayers-hume 1 27303 0 0 /news/drmartens/eastern/fisher/15thmar04.html 1 0 0 0 /news/bromley010820 3 26705 1 1 /news/soccershorts120619 2 41565 0 0 /news/soccershortssheppeyunitedsettolightupholmpark 1 30996 0 0 /news/551a967744148 2 26086 0 0 /news/551a97b096a6d 1 12043 0 0 /news/hollandsandblair240123 1 11948 0 0 /news/vickersgroundreadyforaugustfriendlies 1 12154 0 0 /news/10thnov03.html 1 0 0 0 /drmartens/eastern/chatham/margate300705.html 1 9955 0 0 /news/ryancooperhasjoinedustocompeteforhonourssayshythetownbossscottporter 1 12212 0 0 /news/sheppey010916 1 12628 0 0 /news/hythe041215 2 25756 0 0 /news/hythehast170316 2 52515 0 0 /news/lordswood031117 1 12590 0 0 /news/corinthian091020 1 14611 0 0 /news/551a925045078 4 37103 0 0 /news/nationalleaguesouth010621 2 18196 0 0 /news/sittvbanb130304.html 1 0 0 0 /news/551a97b0e1952 2 34836 0 0 /news/wereunderachievingattheminuteadmitscraywanderersbossianjenkins 1 13629 0 0 /news/tottenhamhotspur200421 1 12344 0 0 /news/551bc5e34bcb7 1 14722 0 0 /news/29thjuly05.html 1 0 0 0 /news/morganwemustgetbacktobusinessafterourfacupexploits 1 12884 0 0 /news/greenwichborough1-2hungerfordtown-sendingoffcontroversymarsborovaseexit 1 20248 0 0 /news/windsoreton0-1folkestoneinvicta-invictacontinuetheirimpressiveawayform 1 15753 0 0 /news/thanetshowdownwillmakeorbreakourseason-yorath 1 11887 0 0 /news/551a931e04599 1 12303 0 0 /news/551bc5e16406e 5 30442 2 2 /news/drmartens/eastern/sittingbourne/burgesshill061104.html 1 0 0 0 /news/551a95b44d16e 2 19661 0 0 /news/dartsletkidsinforfreeforprincesparksfourthanniversary 1 14055 0 0 /news/itsnotgoingtobeeasyjustbecausewereathomewarnswellingunitedbossjamieday 1 13167 0 0 /news/7thjan06.html 1 0 0 0 /news/hopefullywecandoourselvesjusticesayswellingunitedbossjamieday 1 16670 0 0 /news/551a9250a2c19 2 17281 0 0 /news/conference/gravesend/28thaug03.html 1 0 0 0 /news/sladegreen1-1tunbridgewells-wehadenoughchancestoseethemoffadmitsrobbins 1 14193 0 0 /news/bromley240318 1 15104 0 0 /news/tonbridgeangels020422 1 13501 0 0 /news/551a97b093202 2 33058 0 0 /news/iamveryproudthattunbridgewellsareplayingatwembleysayskentleaguechairdeniserichmond 1 14187 0 0 /news/othernews/KYLFIX010304.html 1 0 0 0 /news/wellingtown290419 2 18077 0 0 /news/ryman070216 2 25394 0 0 /news/9thoct03.html 1 0 0 0 /news/erithandbelvedere200220 1 14130 0 0 /news/551a9250bc63e 4 30827 0 0 /news/551a9c0edef2e 4 44218 0 0 /news/drmartens/eastern/erith&belvedere/15thaug04.html 1 0 0 0 /news/workontraininggroundpaysdividendsforin-formashford 1 13480 0 0 /news/beckchat301122 3 26069 0 0 /news/ashfordunited120422 3 28001 0 0 /news/theeagleshavelandedexclusiveinterview 1 11978 0 0 /news/concord040618 2 17106 0 0 /news/thamesmeadtown0-4ramsgate-ramsnegotiatetoextendturnersloanspell 1 19540 0 0 /news/canterbury290419 2 20560 0 0 /news/wedonotwantneilcugleytoleavesaysfolkestoneinvictachairmanmarkjenner 1 13139 0 0 /news/phoenixgroundgrading100415 1 13930 0 0 /news/gwr190305.html 1 0 0 0 /news/FACupDraws030820 2 18318 0 0 /drmartens/eastern/folkestone/maidstone030804.html 1 9955 0 0 /news/dartford2-1maidstoneunited 1 19014 0 0 /news/holmtwells021215 2 70656 0 0 /news/551bc5e6729d8 1 14978 0 0 /news/551a956c4ca55 3 21101 0 1 /news/wellwell060717 1 29860 0 0 /news/bromley200320 2 15725 0 0 /southern-counties-east-football-league/2 3 47022 0 0 /news/ashfordunitedfc.com 1 0 0 0 /news/551bc5e8962a5 1 10827 0 0 /news/hastashf290419 2 55557 0 0 /news/tonbridgeangelspartcompanywithdolby-exclusiveinterviews 1 22038 0 0 /news/551a956c36bee 1 3492 0 0 /news/551a956c1e9f1 1 5561 0 0 /news/idlovetogoupsayslyddtownbossdavesmith 1 15726 0 0 /news/edboydenphotos.co.uk 1 0 0 0 /news/grayswell251015 1 24302 0 0 /news/helpusbecomeanestablishedrymanleaguesidesayschathambossmiles-exclusive 1 15934 0 0 /news/harewantstokeepupimpressivehomeform 1 15448 0 0 /news/551bc5e20d538 1 14193 0 0 /news/lordswood201218 1 13135 0 0 /news/fisktellshistable-toppingsidetocopewiththepressure 1 15536 0 0 /news/thamesmeadtown3-1threebridges-itsbeenatoughfewweeksforusadmitskeithmcmahon 1 30545 0 0 /news/folkestonemaketheirpointtoleagueleaders 1 16611 0 0 /news/marfixtures03-04.html 1 0 0 0 /news/hessenthaleriwantmoredesirefrommyplayers 1 13231 0 0 /news/551a956bb49a8 1 4304 0 0 /news/daishtiesupsevenofhispromotedsquad 1 11575 0 0 /news/551bc5e2292af 1 14412 0 0 /news/drmartens/eastern/tonbridge/22ndoct04.html 1 0 0 0 /news/lordswood241221 5 61531 0 0 /news/551bc5e5b4459 1 12314 0 0 /news/25thjuly03.html 1 0 0 0 /news/maidstoneunited070221 1 11462 0 0 /news/dealtown041220 1 14397 0 0 /news/sporting061104.html 1 0 0 0 /archive-2006-2014/11 3 45274 0 0 /news/drmartens/eastern/tonbridge/3rdfeb04.html 1 0 0 0 /news/stoneschairmannextsevendaysareimportantforclub 1 15305 0 0 /news/margate1-1bognorregistown-wewentintothegamewithpoormentalfocusadmitsoconnell 1 31782 0 0 /news/551bc5deb735b 1 13472 0 0 /news/dulwichhamletaimtosecureasustainablefutureatchampionhill 1 14293 0 0 /news/morganhasassembledourbesteverteamsayshernebaychairman 1 14847 0 0 /news/drmartens/premier/dover/6thaug03.html 1 0 0 0 /news/meridian1-3charltonathleticcommunity-wewillsurpriseyouwarns23submeridianboss 1 21958 0 0 /kent-county-league 29 257153 3 6 /news/abbotthashighhopesforbradbrook-exclusive 1 12629 0 0 /news/jonnealreadytoanswermarklanesemergencycall 1 16019 0 0 /news/551a9718c7c4a 3 29093 0 0 /news/crowlitt181022 1 28309 0 0 /news/ashfordsambitionsmatchminesayslovell-exclusive 1 18542 0 0 /news/551a9c9197648 2 17178 0 0 /news/youwontseeanyonerunawaywithitthisyearsaysbeckenhamtownbossjasonhuntley 1 15535 0 0 /news/porterenduresinjurynightmare 1 12782 0 0 /news/erithbelvedere0-2lancing-weveletourselvesdowntodaysaysdisappointedmickycollins 1 31652 0 0 /news/drmartens/1stnov03.html 1 0 0 0 /news/margate031117 2 25280 0 0 /news/greenwich120118 2 31147 0 0 /news/lordswood060418 1 11985 0 0 /news/lovellstartsnewbuildingjobatashfordtown 1 18316 0 0 /news/drmartens/premier/dover/26thfeb04.html 1 0 0 0 /news/dulwichhamlet6-1sittingbourne-abbottinsistschangeswillbemadeassittingbournecrash 1 23324 0 0 /tunbridge-wells-2003-2006 14 186343 0 1 /news/cugleystrikersneedtoscorethegoals 1 15604 0 0 /news/whitstable090316 2 25694 0 0 /news/551a96dc49b55 3 32181 0 0 /news/sladegreenaimfortoptenfinish-exclusive 1 15274 0 0 /news/drmartens/eastern/folkestone/burnvfolk140204.html 1 0 0 0 /news/erithtown.co.uk 1 0 0 0 /news/drmartens/eastern/tonbridge/eastbourne011104.html 1 0 0 0 /news/551bc5d97869a 4 45320 0 0 /news/551bc5df00896 1 14168 0 0 /news/maidstoneunited3-0chipstead-wevenotbeenatourbestadmitstable-toppingjaysaunders 1 18313 0 0 /news/newportvsitt261003.html 1 0 0 0 /news/sittingbourne0-1ramsgate-weregoingintherightdirectionsayssittingbournebossjimward 1 29683 0 0 /news/hollands010219 1 14468 0 0 /news/551a9cf5891e9 3 39640 0 0 /news/31stjan04.html 1 0 0 0 /news/seethefleetforfreeinplayoffpush 1 19979 0 0 /news/NLSStatement120221 3 26855 0 0 /news/jepsonbringshisfirstteamstarstodoverathletic 1 11710 0 0 /news/551a956c91291 3 25919 0 0 /deal-2003-2006/2 3 28682 0 0 /news/thisisagoodtimeinmycareertomoveintofull-timefootballadmitsminshull 1 24911 0 0 /news/sittingbourne2-3stainestown-fumingabbotttherefereehadanabsolutenightmare 1 30937 0 0 /news/illgetdoverbacktowheretheyshouldbevowshessenthaler 1 16307 0 0 /news/maidstone110619 1 12457 0 0 /news/bromley070320 2 20828 0 0 /news/wevesetourselvesalittlechallengeandwevegottocrackonnowsayspaulchambers 1 12999 0 0 /news/551bc99a7be53 1 3656 0 0 /news/takalooreturnstomaidstone 1 12376 0 0 /news/emilysawyer240320 2 24079 0 0 /news/punjab110817 1 13090 0 0 /news/551bc5de78c29 2 19036 0 0 /news/chinoreturnstosladegreen-exclusive 1 10796 0 0 /news/pottmarg110122 2 34197 0 0 /news/551bc5dd2979c 3 36768 0 0 /news/punjab310818 1 12406 0 0 /news/holmesdale020518 1 11774 0 0 /news/turnerwantsaglamoroustrophytrip 1 19606 0 0 /news/hollandsandblair031121 1 11195 0 0 /news/dartchel070517 2 37872 0 0 /archive-2006-2014/86 1 20576 0 0 /news/551bc99e13b42 2 25035 0 0 /news/551a97b24a2e0 1 15448 0 0 /news/dovergrantwalkersickleave 1 12410 0 0 /news/afcwimbledon261105.html 1 0 0 0 /news/kentleague/beckenham/westwickham271104.html 1 0 0 0 /news/afccroydonathleticwillbeabigtestforusbecausewereascalpsaysfisherbossstevefirkins 1 13997 0 0 /news/theplayersaredesperatetoshowtheirgratitudetoawelcomingtruegentlemansaysmattlonghurst 1 17236 0 0 /news/itwasaveryharddecisiontoleavecrayvalleysaysjoeford 1 16680 0 0 /news/conference/margate/10thjuly03.html 1 0 0 0 /national-league/37 2 23864 0 0 /news/itsabigseasonforusabigchangeandwewanttodoitjusticesaysfisherbossstevefirkins 1 15150 0 0 /news/johnguestpleasedwithdefensivequalitiesagainstfellowstrugglersholmesdale 1 15374 0 0 /news/weneedtoputteamstotheswordsaysfleetbossliamdaish 1 18849 0 0 /news/preseasonresults2019 2 72557 0 0 /news/vcdathletictakeuphastily-arrangedfriendlywithcharltonathletic 1 11587 0 0 /news/kennington010819 1 12201 0 0 /news/beckenham260320 1 13406 0 0 /news/lewisham040518 1 12905 0 0 /news/iwillcontrolournewfrenchdefendersaggression-daish 1 15148 0 0 /news/ramsgate2-3chathamtown-improudofmyboyswinninginjimsbackyard-obrien 1 36727 0 0 /news/maidstone150619 1 13061 0 0 /news/551a931e17f68 1 14250 0 0 /news/bromslabber010615 4 26708 1 1 /news/551a97985f8aa 2 18816 0 0 /news/hollands&blair040920 1 12953 0 0 /news/folkcugley010515 2 34018 0 0 /news/vcdathletic280119 2 25198 0 0 /news/ryman/bromley/bromvthurrockfac111003.html 1 0 0 0 /news/lewiswellgetusedtooneanother 1 15352 0 0 /news/lordvramsfav181003.html 1 0 0 0 /news/coribeck180220 4 76838 1 2 /news/551bc99dbe7a4/kentcounty/othernews/12oct03.html 2 15653 0 0 /news/othernews/PSF0405.html 1 0 0 0 /news/seagerhitsbackatfansabuse 1 12732 0 0 /news/facupsecondqualifyingrounddraw 1 15334 0 0 /news/resultsdecember2017 4 109230 1 0 /news/playersgavemeeverythingpraiseswakeling-exclusiveinterview 1 15688 0 0 /news/hessenthalertellsdrydentoshapeup 1 16220 0 0 /news/wewillnotusetheweatherbreakasanexcusesayshernebaybosssamdenly 1 14271 0 0 /news/551a979a4c026 1 4536 0 0 /news/dartford3-3oxfordcity-angryburmanslamsunacceptabledefendingfromset-pieces 1 20205 0 0 /news/itsgreattoseemyplayersaretakingthebullbythehornssayshernebaybosssimonhalsey 1 17175 0 0 /news/sct150620 1 15074 0 0 /news/hernebaybreakthebanktore-signking 1 13794 0 0 /news/leatherhead2-0sittingbourne 2 18162 0 0 /news/othernews/facup3.html 1 0 0 0 /news/551a931de166d 1 11770 0 0 /news/hessenthalerclosesinondeals 1 12042 0 0 /news/thebudgetsenoughtochallengeagainforpromotionagainnextseasonsaysdoverathleticchairman 1 19349 0 0 /news/kentleague/lordswood/lordvdeal191103.html 2 0 0 0 /news/rusthall110520 1 11692 0 0 /news/551bc99dbe7a4/ryman/othernews/ksc1stround.html 2 15653 0 0 /news/wellingunited1-4graysathletic-pennockimproudofmylads 1 23004 0 0 /news/carshalton160804.html 1 0 0 0 /news/soccershortsmanagersmakesigningsintimeforbigkick-off 1 32753 0 0 /news/551bc5e0873f9 1 14974 0 0 /news/dealtown070220 1 15852 0 0 /news/551a925081721 4 37972 0 0 /news/551bc5dbeb0e9 2 16095 0 0 /news/wewanttobeatlastyearsrecordsaysfisherbossgarylisney 1 14897 0 0 /news/adelayofafewweeksisnothingcomparedtofifteenyearsadmitsdisappointeddartschairman 1 13647 0 0 /news/seagerpaystributetohisbestmanatwhitstable 1 13406 0 0 /news/rustcray051023 5 197620 0 0 /news/lovellrueshisbadluckbutaimstoshakeupinjuryhitsquad 1 14285 0 0 /news/greenwich290116 1 12058 0 0 /news/derespullofffarleytransfercoup 1 13190 0 0 /news/glebe081223/home 1 4789 0 0 /news/crayvalleybosspaulgrossunveilstommyosborneashisfirstsigning 2 18506 0 0 /news/thrillingsidescomehead-to-headinpromotionshowdown 1 23062 0 0 /news/ramschat250818 2 66392 0 0 /news/sheppeyunited300819 1 15633 0 0 /news/silk090504.html 1 0 0 0 /news/sporerit180419 1 33551 0 0 /news/551a9c91f1d96 2 18835 0 0 /news/weknowwerenotgoingtowinitadmitsabbott 1 12753 0 0 /news/kentfascoopstopaward 1 12527 0 0 /news/wereprogressiveandwedontwanttostandstillsaysphoenixsportschairmanandrewmortlake 1 20802 0 0 /news/iwasntkeentodropadivisionandcrayfittedintomypersonalrequirementssaysandywalker 1 15205 0 0 /news/Salivsitt100104.html 1 0 0 0 /news/theteamwhowantsitthemostwillgettothefinalsayscorinthianbosstonysitford 1 15003 0 0 /news/fleettrusttosupportclubonweeklybasis 1 15254 0 0 /news/551a97b18626b 1 13911 0 0 /news/sittingbourne171016 2 27723 0 0 /archive-2006-2014/103 1 20576 0 0 /news/551bc99dbe7a4/drmartens/premier/dover/kentcounty/22ndjune03.html 2 15653 0 0 /news/glebe101019 1 12735 0 0 /news/news/tonbridge%20invicta%20030104.html 1 0 0 0 /news/uckfieldtown010623 2 16098 1 1 /news/othernews/30thaug03.html 1 0 0 0 /news/iamfullyawareoftheareasofthesquadthatneedsstrentheningsaysfavershambossrayturner 1 15831 0 0 /news/seagerreachingfinalisicingonthecake 1 10920 0 0 /news/sladevrams200304.html 1 0 0 0 /news/becksprepareformeetingtoregainfaacceptance 1 11378 0 0 /news/beckenhamtown3-1hythetown 1 13587 0 0 /news/casuals140904.html 1 0 0 0 /news/thefleetatwembleymywembleyexperienceschangedmylifereflectsgarystevens-exclusive 1 17537 0 0 /news/othernews/facup7thjuly03.html 1 0 0 0 /news/551a9c0f1c220 2 20013 0 0 /news/bromleytitleslabber190415 2 17938 0 0 /news/itsgoodthatweseemedtobrokenthehomejinxoflastseasonsaysbromleybossmarkgoldberg 1 15287 0 0 /news/551bc5dcc84ef 1 12396 0 0 /news/whitdeal101222 4 130146 0 0 /news/rymanleaguerejecthornetsgroundsharedealatcrawley 1 14664 0 0 /news/fanswebsiteagreesebbsfleetunitedtakeover 1 15641 0 0 /news/25thaug05.html 1 0 0 0 /news/rusthall3-2bromleygreen 1 12531 0 0 /news/sheppeyunited021123 6 75260 0 1 /news/551bc99dbe7a4/drmartens/eastern/chatham/drmartens/eastern/ashford/4thnov03.html 2 15653 0 0 /news/weremakingmistakesandgettingpunishedadmitsseager 1 13044 0 0 /news/551bc99dbe7a4/drmartens/eastern/tonbridge/kentleague/lordswood/7thjuly03.html 2 15653 0 0 /news/tunbridgewells240920 1 13569 0 0 /erith-belvedere-2003-2006/3 4 46780 0 1 /news/werealotmoreaheadofscheduleofourlong-termplansaystunbridgewellsbossmartinlarkin 1 19877 0 0 /news/whyteleafe100321 2 23817 0 0 /news/551a97b2473a7 1 12943 0 0 /news/551a97b150385 1 18411 0 0 /news/thepfa040517 1 14512 0 0 /news/551bc99dbe7a4/drmartens/eastern/sittingbourne/drmartens/eastern/ashford/21stoct03.html 2 15653 0 0 /news/lordvseve061203.html 1 0 0 0 /news/openingdaywinoverdereswasnotaflukeinsistslonghurst 1 15521 0 0 /news/greenwich140804.html 1 0 0 0 /news/croydon150522 4 46990 0 0 /news/southall051004.html 1 0 0 0 /news/wevegottobemoremotivatedandworkhardertogetresultssayscraybossianjenkins 1 16102 0 0 /news/551a99e49fcd1 2 34438 0 0 /news/webelievejamiedayistherightmantobringsuccesstoebbsfleetunitedsayspetervarney 1 15371 0 0 /news/moulespartscompanywiththeconference 1 12969 0 0 /news/erithbelvedere2-0croydon 1 14657 0 0 /news/bromley0-4doverathletic-itsthelowestpointoftheseasonadmitsbromleybossmarkgoldberg 2 39213 0 0 /news/sctglebe121216 2 44428 0 0 /news/551a96db4acb8 1 3520 0 0 /news/doverathletic2-1tonbridgeangels-losingatthisstagewillbecostlyadmitstommywarrilow 1 19633 0 0 /news/newhdeal111123 5 106682 1 1 /news/bartonoptsforredhill-exclusive 1 12126 0 0 /news/kentclubsunveilstadiumplans 2 21814 0 0 /news/canterburycityunveilmajorsponsorshipdeal 1 13254 0 0 /news/erithbelvedere1beckenhamtown1 2 18581 0 0 /news/parkwood060519 1 13992 0 0 /news/thefleetatwembleyangelsofthesouthbidforwembleyglory-exclusive 1 18867 0 0 /news/dartford2-2folkestoneinvictaaetdartfordwin5-3onpenalties 1 18332 0 0 /news/551a9798ba853 1 5152 0 0 /news/fcelmstead080917 1 11236 0 0 /news/onourdaywecanlivewiththebestsidesintheleaguesaysfavershambossrayturner 1 14615 0 0 /news/551bc5e8d5940 1 12063 0 0 /news/19thsept05.html 2 0 0 0 /news/551bc5e826825 2 22270 0 0 /news/551bc5dd40324 2 18487 0 0 /news/craywanderers0-0hendon-wevegottogetbettersayscraywanderersbossianjenkins 1 22062 0 0 /news/itstimetostartpickingupthreepointssayscugley 1 15498 0 0 /news/NationalLeague090420 2 15122 0 0 /news/glebshep180122 1 34327 0 0 /news/confidentcosgrovewarnscroydonofpasting-exclusive 1 13698 0 0 /news/551bc99b36e96 1 2981 0 0 /news/drmartens/eastern/erith&belvedere/harlowfat091004.html 1 0 0 0 /news/facarlsbergtrophysecondqualifyingrounddraw-1 1 10741 0 0 /news/wp-content/plugins/anttt/simple.php 1 0 0 0 /news/ksporlord300919 1 33335 0 0 /news/hollgree260316 1 31776 0 0 /news/fishcori120319 1 41353 0 0 /news/ryman/bromley/cpalace030804A.html 1 0 0 0 /news/kennington010620 1 12702 0 0 /news/wellingtown170721 1 11530 0 0 /news/boroughsignsouthafricanpremierleaguestar-exclusiveinterview 1 13766 0 0 /archive-2006-2014/187 1 19442 0 0 /news/ashford160217 1 16881 0 0 /news/topsixfinishwillbeclassedasasolidseasonsaysorpingtonbossbyronbeard 1 23554 0 0 /news/wellgivechipsteadrespectinsistsdartsbossburman 1 17525 0 0 /news/ashfordsearchforlocaltalent-exclusive 1 16068 0 0 /news/551a931e6fdcc 2 38540 0 0 /news/lewisham211218 1 12672 0 0 /news/thisisabigclubthatneedsabigjobdoneonitsaysfisherco-bossmartinford 1 12433 0 0 /news/sargentoptstostayputwithtanners 1 12509 0 0 /news/551bc99b9f441 2 18107 0 0 /news/wp-content/plugins/ioptimization/abruzi.php4 1 0 0 0 /news/cugleywemustscorefirstingames 1 14231 0 0 /news/aclonglebe230915 2 33283 0 0 /news/wellingunitedbossjamiedayreadytoconfirmhiseighteen-mansquadwithintendays 1 14987 0 0 /news/crayvalley220421 3 30527 0 0 /news/hythetownfc.co.uk. 1 0 0 0 /news/kissieboue241217 1 12624 0 0 /isthmian-league/11 5 83474 0 0 /news/28thapr05.html 1 0 0 0 /news/hernebay0-3favershamtown-ithinkwewillstarttogetmorerecognitionsaysrayturner 1 24196 0 0 /news/noonewantstogodown-itsnotgoodforthecvsayscraywanderersbossianjenkins 1 14972 0 0 /news/resultsdecember2019 2 89191 0 0 /news/wevenowgottoupourgametowinpromotionsaysmaidstoneunitedbossjaysaunders 1 15778 0 0 /news/charlton141116 3 28321 0 0 /news/burmanpricedoutoftransfermarket 1 13258 0 0 /news/551a97b222e35 1 13413 0 0 /news/favershamtown291122 3 33639 1 1 /news/werehopingwecanchallengetorquayallthewaysaysbromleybossmarkgoldberg 2 36827 0 0 /news/thamesmeadmanagerkeithmcmahonhailshisgoodfortnight 1 16901 0 0 /news/imguttedfortheplayersthatwerestillaroundtherelegationzone-oconnell 1 16935 0 0 /news/weneed80pointstogetaplay-offplacepredictswellingunitedbossjamieday 1 14919 0 0 /news/ashfordunited220523 2 31903 0 0 /news/tobialabi130715 2 37720 0 0 /news/sykes130405.html 1 0 0 0 /news/chathamtownlockhornswithmedwayneighbourstomark130thanniversary 1 11888 0 0 /news/kentleague/lordswood/winchester280804.html 1 0 0 0 /news/wembleyheroeshessenthalerkentfootballisonthemap-exclusive 1 15069 0 0 /news/bromley281019 2 18015 0 0 /news/maidstone020817 1 11870 0 0 /news/hollands100818 1 15250 0 0 /news/29thjune03.html 1 0 0 0 /news/soccershortschathamgoalkeeperwhitehouseputspentopaper-exclusive 1 14705 0 0 /news/newangelsstrikergreenwayoutfor2monthswithbrokenmetatarsal 1 11441 0 0 /news/knaplord100821 5 101753 0 0 /news/551a97b2587a6 1 14560 0 0 /news/fiskwemustconcentratethroughoutifweretobeatvickersagain 1 15886 0 0 /news/lifeattonbridgewillbeexcitingnextseasonsayschairman 1 14004 0 0 /news/maidstoneunited2-3bognorregistown-giftedgoalshascostusadmitsjaysaunders 1 17013 0 0 /news/wewillnotspendmoneywehaventgotsayswhitstablechairman-exclusive 1 20225 0 0 /news/kentleague/sevenoaks/tunwells170804.html 1 0 0 0 /news/margate060718 2 25443 0 0 /news/welling200217 2 17383 0 0 /news/corinthian100320 1 17233 0 0 /news/551a99e37ac42 1 15353 0 0 /news/doverbossmartinhayesexperiencesmixedfeelingsoverhissidesstart 1 17966 0 0 /news/551a979a945a5 1 4845 0 0 /news/margtonb030118 2 27987 0 0 /news/maldontown0bromley2 1 12159 0 0 /news/sittingbourne180523 2 27823 0 0 /news/551a956c50da8 1 3687 0 0 /news/ideotford030515 1 17289 0 0 /news/Grayspreview180705.html 1 0 0 0 /news/tuncray070317 1 39562 0 0 /news/erithbelvedere4-0lancing-deresanswertheircriticsintruestyle 1 15567 0 0 /news/itsasaddaytotellahonestanddecentfellowhesoutofajob-doverchairmanjimparmenter 1 12848 0 0 /news/tonbridgeangels3-2craywanderers-wemadehardworkofitadmitswarrilow 1 40429 0 0 /news/burmandelightedwithbarnescapture 1 12542 0 0 /news/wellingunitedquartetputpentopaper 1 12099 0 0 /news/craywanderers1-0maidstoneunited-wandsconfirmkinchreleasefollowingwealdstoneshocker 1 27800 0 0 /news/pre-seasonsummer2013-resultsfixtures 1 33872 0 0 /news/wellingunited2a1bromley-itsridiclouswecantbringinthekidsfumesbarryashby 1 24553 0 0 /news/meridianNHS180320 1 11296 0 0 /news/cugleywevegottoscoremoregoalsfromadvancedpositions 2 19303 0 0 /news/fansaimtoraise1000forchildrenscharity 1 12940 0 0 /news/craylord010217 1 31618 0 0 /news/551a9797e238c 1 3884 0 0 /archive-2006-2014/200 1 18849 0 0 /news/canterbury030217 1 12611 0 0 /news/551bc5e0394bd 2 30584 0 0 /news/551a9c91d639d 2 20822 0 0 /news/wereincontrolofourowndestinysaysplay-offchasingwarrilow-exclusive 1 17555 0 0 /news/othernews/27thjune03.html 1 0 0 0 /news/551bc99dbe7a4/kentleague/maidstone/kentleague/tunbridgewells/17thjuly03.html 2 15653 0 0 /news/thisisagreatdayforusaswecanannouncethatwearedebtfreesaysfolkestonechairman 2 52706 0 0 /news/ryman/bromley/10thoct03.html 1 0 0 0 /news/551a956c1b103 1 4385 0 0 /news/keisteriwantsuccessatdoverathletic 1 13555 0 0 /news/eritrust020918 1 31883 0 0 /news/craywands211217 2 18392 0 0 /news/551bc5de1062d 1 11359 0 0 /news/afcautism170820 1 11365 0 0 /news/chathamtown0-3dulwichhamlet 1 14463 0 0 /news/folkestoneinvictaunveilchriselliottsigning 1 13231 0 0 /news/holmesdale2-0craywanderers-wecantgettoocarriedawaysaysholmesdalecoachrossmitchell 1 21054 0 0 /news/ashfordtown2-3ramsgate-notwinningknockedourconfidence-ward 1 18751 0 0 /news/kentleague/maidstone/25thaug03.html 1 0 0 0 /news/551bc5e7f1be6 1 12652 0 0 /news/thefootballfoundationhavebeenfantasticforusovertheyearssayswoodstockchiefmauricedunk 1 14531 0 0 /news/whyteleafe2-0ashfordunited-theyvepushedusallthewaysayswhyteleafebossjohnfowler 1 28718 0 0 /news/idontthinktheplayerscaredenoughagainstworthingsaysfavershamtownbossrayturner 1 14371 0 0 /news/551a92510aa8b 2 19595 0 0 /news/margate221105.html 1 0 0 0 /news/eritwhit210118 1 18117 0 0 /news/councilpurchasestonebridgeroad-twothousandexpectedfordonsvisit 1 19237 0 0 /news/kentleague/maidstone/7thjuly03.html 2 0 0 0 /bromley-2003-2006/2 2 18267 0 0 /news/kentleague/deal/Sampson1.html 2 0 0 0 /news/weremakingnofigureswhereweregoingtobesaysfisherbossstevefirkins 1 13537 0 0 /news/551a97b1916f7 1 13512 0 0 /news/beck220703.html 1 0 0 0 /news/wefeelaxingbobpeetersistherightdecisionfortheclubsayscharltonchief 2 33909 0 0 /news/drmartens/premier/dover/4thaug03.html 1 0 0 0 /assets/fonts/ 1 1610 0 0 /news/erith050205.html 1 0 0 0 /news/thambrig291017 2 60220 0 0 /news/23rdaug03.html 1 0 0 0 /news/sampsonannounceshisretirementfromfootballmanagement 1 12515 0 0 /news/kentleague/whitstable/21stjuly03.html 2 0 0 0 /news/othernews/fatrophy4thround.html 2 0 0 0 /news/livecoveragefolkestoneinvicta0-0afchornchurch-survivalhopesgotolastdaystonesshootout 1 21675 0 0 /news/erithbelvedere4-1selsey-wemadehardworkofitadmitsmickycollins 1 22204 0 0 /news/1stmay04A.html 1 0 0 0 /news/foresthillpark271020 1 14015 0 0 /news/theroadtowembleyhernebayfancytheirchancesofcausingacupshock-exclusive 1 14866 0 0 /news/bromley211119A 2 23171 0 0 /news/drmartens/eastern/folkestone/fleetvfolk280204.html 1 0 0 0 /news/ramsgatedefendersubmitstransferrequest 1 10611 0 0 /archive-2006-2014/68 1 20374 0 0 /news/12thdec04.html 1 0 0 0 /news/favershamtownbeginsearchfornewmanager 1 11759 0 0 /news/wewanttogoonebettersayscorinthianbossmattlonghurst 1 18948 0 0 /news/beckerithbel101015 1 34620 0 0 /news/othernews/AEI111004.html 1 0 0 0 /news/welling221015 1 12959 0 0 /news/margaterelisheagerlyanticipateddons 1 15477 0 0 /news/garyabbottpartscompanywithsittingbourne 1 10933 0 0 /news/kentleague/cray/leatherhead170804.html 1 0 0 0 /news/lingcant140815 1 28717 0 0 /news/resultsmarch2022 3 136078 0 0 /news/ivespentallofmybudgetadmitspromotionchasingjenkins-exclusive 1 15138 0 0 /news/canterbury190216 3 20784 2 2 /news/cugleytheclubisbuzzingagain 1 18004 0 0 /news/13thaug03.html 1 0 0 0 /news/551a9677849a6 2 15702 0 0 /beckenham-2003-2006/www.heineken.co.uk/ 1 3183 0 0 /news/kentleague/ramsgate/bengal140804.html 1 0 0 0 /news/kentleague/lordswood/eastbournevlordsfac230803.html 1 0 0 0 /news/facupthirdqualifyingrounddraw 1 12464 0 0 /news/imhappywiththeplayerswevegotbutneedtostartpickinguppointssaysjimward 1 15951 0 0 /news/tonbridge100517 2 22738 0 0 /news/lyddtown211119 1 11760 0 0 /news/orpington030317 1 12707 0 0 /news/itwasfunknockingtonbridgeoutsayshadden 1 15603 0 0 /news/gillingham200517 2 23593 0 0 /news/551a92509eaab 4 30109 0 0 /news/southpark141119 2 24796 0 0 /news/thehoneymoonperiodisover-itsnowaboutresultssayssammacneil 1 13875 0 0 /news/551bc99e5b318 2 31055 0 0 /news/bathcity4-0sittingbourne 1 14073 0 0 /news/everythingatconeyhallneedstobeaddressedsaysnewdirectoroffootballchristucker 1 18214 0 0 /news/551bc5e80a5a1 2 30629 0 0 /news/folkestoneinvicta161022 2 25085 0 0 /news/sevshep060517 3 108475 0 0 /news/ashfordtown2tonbridgeangels3 2 24166 0 0 /news/dartford300320 2 18823 0 0 /news/sittingbourne3-1whyteleafe-ourpoorhomerecordhascostusadmitsabbott 1 20631 0 0 /news/551a96dbb5ebd 1 3846 0 0 /news/wp-content/plugins/ioptimization/king.php 1 0 0 0 /news/drmartens/eastern/folkestone/10thnov04.html 1 0 0 0 /hythe-2003-2006/2 3 25871 0 0 /national-league/17 2 24270 0 0 /news/doverathleticslapsix-figuretransferfeeon42-goaladambirchall 1 14352 0 0 /news/wellbefitandraringtogoagainststonesincupfinalinsistsvcdbossford-exclusive 1 14240 0 0 /news/charlton231216 3 29326 0 0 /news/hernebay160205.html 1 0 0 0 /news/formerrefereejohnsonjoinswhitstableboard 1 18146 0 0 /news/wingsexpecttolosestarstrikerkedwell 1 13516 0 0 /news/wecancompeteagainstteamsinhigherdivisionswarnshernebaybossanthonydeer 1 13040 0 0 /news/551bc99ac00b8 2 14957 0 0 /drmartens/eastern/folkestone/margate261205.html 1 9955 0 0 /news/wevegotalotofhardworktodosaysfolkestoneinvictabossneilcugley 1 13388 0 0 /news/erithtown191004.html 1 0 0 0 /news/langtonholmesdalesexpectationlevelsarerisingforeverygame 1 12575 0 0 /news/ryman/bromley/10thjuly03.html 1 0 0 0 /news/tonbridge111116 2 26861 0 0 /news/crayvalley200918 1 12241 0 0 /news/horshamymca2-1ashfordtown-ashforddefeatmarredbyracistattackonboss-exclusiveinterview 1 26885 0 0 /news/hythevslade081103.html 1 0 0 0 /news/hollands140219 1 14589 0 0 /news/theplayersneedtoembracethedaybutnotlettheoccasiongetthebetterofthemsayssamdenly 1 14623 0 0 /news/differenceofopinionforcesgormantoquit 1 15366 0 0 /news/wellingtown130117 1 11489 0 0 /news/whitstabletownbeginsearchfornewmanagerafterpartingcompanywithmarklane 1 16411 0 0 /news/eritfish251023 7 168528 3 1 /news/kentleague/hythe/erith210804.html 1 0 0 0 /news/sheppey100416 1 16188 0 0 /news/onthenightthatsudburycrackunderpressureburmansayswemustnotthrowitawaynow 1 15062 0 0 /news/bowden-brownyouthsidessuccessbodeswellforthefuture 1 13016 0 0 /news/reports 1 35046 0 0 /news/gravesendnorthfleet0tonbridgeangels4-crampillwaitformyfirstteamchance-exclusive 1 17601 0 0 /news/drmartens/eastern/tonbridge/13thaug04.html 1 0 0 0 /news/551a9677cad45 2 15735 0 0 /news/hegleyleavesstonestobecomeavicker 1 12686 0 0 /news/ourawayformjusttakescareofitselfsayscraywanderersbossianjenkins 1 11902 0 0 /news/drmartens/eastern/sittingbourne/sittvstam280204.html 2 0 0 0 /news/ramsvtham060404.html 1 0 0 0 /news/551bc5dce2ed4 1 13776 0 0 /news/sevenoaks311216 1 17120 0 0 /news/croyfish101018 2 63836 0 0 /news/thereslotsthatcouldhappenbeforewegettomondayskentseniorcupfinalsaysstevebrown 1 16486 0 0 /news/craybear270319 1 31074 0 0 /news/barking120122 3 27600 0 0 /archive-2006-2014/34 2 26138 0 0 /news/KentFAStatement060420 3 27779 0 0 /news/maidstoneunited1-3carshaltonathletic-imconfidentwecangetoutoftrouble-sayspeternott 1 22037 0 0 /news/dovercanonlygetbetterwarnshessenthaler 1 15855 0 0 /womens-football 15 211234 2 3 /news/551bc99b1a4ee 2 19095 0 0 /news/551a9c9157632 3 37884 0 0 /news/maidstone020805.html 1 0 0 0 /news/doverreceive3000fromsupporterstrust 1 12711 0 0 /news/favershamprovidelocalkidsaplatform 1 14109 0 0 /news/crowborough160717 1 12496 0 0 /news/wehavetowinatramsgateifwereseriousaboutmakingtheplay-offssaysjaysaunders 1 13929 0 0 /tonbridge-2003-2006 12 168749 0 0 /news/551a925023bdf 1 3398 0 0 /news/burmansignstwoex-captainstotoughenuphisteam-exclusive 1 12897 0 0 /news/weseemtobeingheldbackbyabitofalackofambitionsaysmetrogasbossroydavies 1 14574 0 0 /news/551a9c0e3ff5d 2 20429 0 0 /news/sevenoaks130217 1 13298 0 0 /news/ebbsfleet200718 1 15779 0 0 /news/crowborough010116 1 12597 0 0 /news/551a97997de83 1 4335 0 0 /news/otfordunited151120 1 12286 0 0 /news/22nddec05.html 1 0 0 0 /news/erithbelvedere0-4fisherathletic 1 18145 0 0 /news/ramsgatebeatstheweathertothedelightofmanagerjimward 1 16028 0 0 /news/wellingordoverhaventapproachedmesaysward-exclusiveinterview 1 13853 0 0 /news/maldon231104.html 1 0 0 0 /news/soccershortskentishfootballfamilyrallyaroundfortommysampson 1 43234 0 0 /news/ramsgate011123A 6 102573 0 0 /news/robbinsfillsmanagementplaces-exclusive 1 12239 0 0 /news/ryman/bromley/bromvtilburyfr050803.html 1 0 0 0 /news/shorts070615 2 38565 0 0 /news/canterbury201115 1 15718 0 0 /news/551a96db7bd30 2 14941 0 0 /news/dartswelcomenewboardmember 1 13142 0 0 /news/551bc99dbe7a4/kentleague/sevenoaks/othernews/12oct03.html 2 15653 0 0 /news/8thoct04.html 1 0 0 0 /news/551a92510d34b 2 23592 0 0 /news/551a956bbac27 1 3387 0 0 /news/drmartens/eastern/ashford/12thsept03.html 1 0 0 0 /news/wp-content/plugins/seoplugins/mar.php 1 0 0 0 /news/551a9c9188acb 2 16918 0 0 /news/carshaltonwillbeatoughnuttocrackadmitsmunday 1 15309 0 0 /news/theresnopointbeatingdulwichthenlosingtohailshamsayswellsskipperjasonbourne 1 18718 0 0 /news/othernews/AEI130904.html 1 0 0 0 /news/tonbridgeangels1-4dartford-ijusttoldthemtobelieveinthemselvesrevealedburman 1 40429 0 0 /news/eastbourneborough0-1dartford-whoknowswhatwecanachievenowsaysdartfordbosstonyburman 1 20539 0 0 /news/folkestoneinvicta3-2eastthurrockunited 1 14492 0 0 /news/soccershortshernebayappointhugolangtonastheirnewcoach 1 16914 0 0 /archive-2006-2014/2 3 44328 0 0 /news/craywanderers1-2doverathletic-webeleivewecanwinthetitlesaysnolan-exclusives 1 21090 0 0 /news/margateunveilworkonfive-a-sidecentrekicks-offthismonth 1 13118 0 0 /news/wereindangeroflosinggoodplayersagainthisyearwarnsdaish 1 13447 0 0 /news/fleettriocomplainaboutgruellingfixturebacklog 1 16904 0 0 /news/threepositionsupforgrabsatpromotedvcdathletic 1 10936 0 0 /news/tonbridgeangelsbringinformerhorshamskipperbenandrews 1 15707 0 0 /news/kentleague/thamesmead/9thsept04.html 1 0 0 0 /news/grafixtures03-04.html 1 0 0 0 /news/lovellseeksreinforcementstocombatcriplinginjurycrisis-exclusive 1 14641 0 0 /news/vcdbed071017 3 59088 0 0 /news/stansfeld260615 1 15399 0 0 /news/favershamenjoyeuroadventure 1 17208 0 0 /news/kentcounty/26thjune03.html 1 0 0 0 /news/margate180320 2 22099 0 0 /news/playershavetoprovethattheirworthyofwearingtheshirtsaysstonesbossjaysaunders 1 14179 0 0 /news/mybodyistellingmetohangupmybootssayscollins 1 12242 0 0 /news/eighthwonder070916 3 47533 0 0 /news/ourstandardsmustnotdropsayswellingunitedbossjamieday 1 13654 0 0 /news/visitingplayersraisetheirgameagainstusatparkviewroadsaysderesassistantjulianleigh 1 16173 0 0 /news/kentishfootballstatement 1 13077 0 0 /news/craywands311218 3 41324 0 0 /news/ashfbinf100923 2 71519 0 0 /news/drmartens/premier/dover/25thaug04.html 1 0 0 0 /news/25thsept04.html 1 0 0 0 /news/weregoingtomissretiredluckettadmitsfrancis 1 21733 0 0 /news/roarfavershamtowardsthetitle 1 13301 0 0 /news/551a9c92045d3 3 37455 0 0 /news/tonbridgeangels1-1wellingunited-wevedeservedmorethanwhatwevegotsaystommywarrilow 1 18956 0 0 /news/dealbinf100421 4 114550 0 0 /news/craywanderers0-2leytonorient-werehopingtoextendourbudgettosignplayerssaysfrancis 1 25477 0 0 /isthmian-league/31 3 45294 0 0 /news/drmartens/eastern/sittingbourne/12thsept04.html 2 0 0 0 /news/kentleague/whitstable/3rdnov03.html 1 0 0 0 /news/weholdnogrudgessayswarrilow 1 18321 0 0 /news/551bc99e0036a 2 23384 0 0 /news/551a99e36ba04 1 13609 0 0 /news/glebpunj210223 4 126026 0 0 /news/iwanttotakehytheuptotherymanleaguesaystakaloo 1 17245 0 0 /news/wellingmcentegart051215 1 13176 0 0 /drmartens/eastern/tonbridge/gravesend010205.html 1 9955 0 0 /news/551a924fe4800 2 18805 0 0 /news/margatesvisittoeastthurrockismindovermattersaystabletoppingtrott 1 13090 0 0 /news/wewillmovetheclubforwardvowsnewwhitstablebossmunday 1 11537 0 0 /news/canterburynewstadium030219 1 12769 0 0 /news/ksports220319 1 12910 0 0 /news/croydon030120 1 13403 0 0 /news/tunbridgewellsunveilfutureplans 1 17200 0 0 /news/551bc5da98614 3 34339 0 0 /news/craywands110119 3 34293 0 0 /news/erithbelvedere0-2maidstoneunited 1 12857 0 0 /news/21stjune05.html 1 0 0 0 /news/yorathwemuststartproducingthegoods 1 13423 0 0 /news/551bc99dbe7a4/ryman/conference/margate/margatevfarnborough250803.html 2 15653 0 0 /news/bashley011005.html 1 0 0 0 /news/sevenoakstown250222 2 27689 0 0 /news/stansfeld110222 1 16718 0 0 /news/dartssearchfornewtalent 1 10764 0 0 /news/GWR160805.html 1 0 0 0 /news/wp-content/plugins/wp-file-manager/lib/files/king.php 1 0 0 0 /news/backingthefleettowembleyglorywewillpullitoutthebaginsistslong 1 17043 0 0 /news/favershamtown5-3waltoncasuals-favershamtownbossrayturneritwasaremarkablenight 1 21622 0 0 /news/rochseve220316 1 33757 0 0 /news/conference/margate/11thjuly03.html 1 0 0 0 /news/mulhollandstaysforexcitingtimesatbaylissavenue 1 11859 0 0 /news/551a9250f260d/26thsept05G.html 2 6643 0 0 /news/longhurstreshuffleshispackforredhilltie 1 15330 0 0 /news/551bc5e1b2451 2 18319 0 0 /news/551a96db4d5d9 1 5232 0 0 /news/wellgoaboutourbusinessquietlysayscrayvalleybosspaulgross 1 17160 0 0 /news/ilovebeinginvolvedinbiggamessaysphoenixsportsbosssteveoboyle 1 13612 0 0 /news/4thoct04.html 2 0 0 0 /news/groombridgeplaceisatthegreen 1 12311 0 0 /archive-2006-2014/25 2 25869 0 0 /news/bromley010316 2 15886 0 0 /news/kentleague/sporting/20thjuly03.html 1 0 0 0 /news/wemustraisethebarsayspromotionchasingfrancis 1 14898 0 0 /news/nationalleague110318 1 12714 0 0 /news/itsvitalwemaketherightdecisionsaysdoverathleticchairman 1 11683 0 0 /news/borehamwood221005.html 1 0 0 0 /news/wereatthebeginningofthejourneyheresayserithbelvederebossmattlonghurst 1 15160 0 0 /news/551bc5e117117 1 16589 0 0 /news/erithshepp210216 2 36882 0 0 /news/maidstoneunited1-3kingstonian-imnotgoingtocrucifyturnersayshume 1 34216 0 0 /news/drmartens/premier/dover/15thjuly04.html 1 0 0 0 /news/obrienwillbeasuccessinsistsbinks 1 16470 0 0 /news/rustcray071118 1 34576 0 0 /news/weneedtosortoutourbudgetfornextyearsaysfolkestoneinvictabossneilcugley 1 13907 0 0 /news/TonbMcKimm080415 3 29488 0 0 /news/seagersheroessecurerymanleaguestatus 1 12930 0 0 /news/stansfeld190822 4 51486 0 0 /news/pottersbartown1-2whitstabletown-theresabitofgoldattheendoftherainbow-southall 1 24182 0 0 /news/bromley250517 1 13259 0 0 /news/551a979a08d3c 2 10029 0 0 /news/birchall060716 2 17688 0 0 /news/thereslotstobuildonsayslane 1 17208 0 0 /news/dontunderestimateusramswarnpremierleaguerivals-exclusiveinterview 2 20933 0 0 /news/othernews/britishenergykentcountyleaguetables280304.html 1 0 0 0 /news/551bc99dbe7a4/kentleague/ramsgate/drmartens/eastern/dartford/11thaug03.html 2 15653 0 0 /news/iwanttoseeafootballingsidewinthekentleaguetitlesaysfishersassistantbillywalton 1 21194 0 0 /news/councilunveilsiteforcanterburycitysnewstadium 1 11994 0 0 /news/weareallfullycommittedtothecauseinsistspatterson 1 21493 0 0 /news/littlehampton280804.html 1 0 0 0 /news/lordswood130123 5 31850 2 2 /news/551bc99dbe7a4/kentleague/sladegreen/drmartens/eastern/dartford/27thnov03.html 2 15653 0 0 /news/551bc99dbe7a4/drmartens/eastern/chatham/ryman/bromley/wortvbrom081103.html 2 15653 0 0 /news/beckbren250919 1 30678 0 0 /news/dealtown030120 1 12265 0 0 /news/ashfcray090417 1 35810 0 0 /news/LetFansIncampaign180820 3 34214 0 0 /news/moorearnoldgivesuscompetitionfornumberonespot 1 12987 0 0 /news/wedlovetohaveagoodruninthevasesayserithbelvederebossmickycollins 1 13901 0 0 /news/551bc5e8eb4a2 1 16714 0 0 /news/tuesdaynightsresults 1 14696 0 0 /news/gravesendreleasesixplayers 1 12093 0 0 /news/dockershavekeeperconcernsaheadofvaseclash 1 14639 0 0 /news/TheFAStatement300523 2 28714 0 0 /news/coneyhallmanagershotdeadbeforetrainingsession 1 15555 0 0 /news/folkestoneinvicta0-0thamesmeadtown-wevegotagreatchanceathomenowsayskeithmcmahon 1 29114 0 0 /news/eritgleb091121 5 183647 0 0 /news/welling061115 1 14030 0 0 /news/weseemtoperformbetterawayfromhomeadmitsdoverathleticbossnickyforster 1 13932 0 0 /news/551a92504ddfe 1 3484 0 0 /news/hernebaybosssimonhalseyadmitswevewonnothingyet 1 19061 0 0 /archive-2006-2014/199 1 18798 0 0 /news/bogdul010517 3 72772 0 0 /news/wellingtown290721 1 12871 0 0 /news/bromley2-1wellingunited-thepotentialatbromleyisenormoussaystable-toppingmarkgoldberg 1 37074 0 0 /news/bridonropes230918 2 16973 0 0 /news/isthmianleague030920 2 24759 0 0 /news/hessenthalerbringsinsecondbarnetyoungsteronloan 1 13939 0 0 /news/ijustfeltatthistimeofmycareerthatsevenoakstownwasmoreofachallenge-darrenanslow 1 17395 0 0 /news/bromley280519 2 16359 0 0 /news/ramswelcomedonswithopenarms-exclusive 1 17172 0 0 /news/keisterletslookforwardnotback 1 13947 0 0 /news/551bc99d09e19 2 21165 0 0 /news/551bc99dbe7a4/kentleague/erithtown/ryman/bromley/15thaug03.html 2 15653 0 0 /news/piscinascontributionhasbeenhugeforussaysmoore 1 12284 0 0 /news/551a967719a92 2 17469 0 0 /news/551a956bf4215 1 3730 0 0 /news/wellkeepatightshipatsittingbournesaysjoint-bossjimward 1 14033 0 0 /news/conneallypaystributetoinspirationalrogers-exclusiveinterviews 1 15219 0 0 /news/hastingsleftinthedarkasdartsbidforplay-offs 1 14348 0 0 /news/wevegotamountaintoclimbbutmountainsdogetclimbedsaysdartfordbosstonyburman 1 16438 0 0 /news/551a97b055a93 1 10847 0 0 /news/iwantustopushupthatleaguenowsaystonbridgeangelsbossstevemckimm 1 14251 0 0 /news/ourtargetispromotionsaysdoverathleticbossnickyforster 1 15299 0 0 /news/551bc5e60f203 1 12526 0 0 /news/istillwanttobehereintenyearssaysphoenixsportsmanagersteveoboyle 1 14267 0 0 /news/sittingbourne0-1leatherhead-wejustcantstopmakingstupidmistakessaysdannyward 1 19641 0 0 /news/charltonathletic180619 3 28265 0 0 /news/stonesunveilthesigningofirishstopperharrylee 1 12699 0 0 /news/theclubcannotcontinuewithoutpeopletorunitwarnsfolkestoneinvictadirectormarkjenner 1 14357 0 0 /news/vcdathletic030921 2 26105 0 0 /news/wewontbetakinghernebaylightlysaystonbridgeangelsbossstevemckimm 1 15536 0 0 /news/werelookingtogetasmanypointsontheboardearlyonsayshernebaybosssamdenly 2 15920 0 0 /news/borehamwood260205.html 1 0 0 0 /news/ryman/bromley/windsor050804.html 1 0 0 0 /news/551bc99b1f3b2 2 21696 0 0 /news/kingstonian1-1margate3-2pens-jamieturnermadethebestsaveiveeverseensaysoconnell 1 26008 0 0 /news/corinthian100818 1 12107 0 0 /news/holmesdale2-4craywanderers-jenkinswantsmorecashtokeepnewfaces 1 20863 0 0 /news/fleetladiesitisourintentiontocontinuetoriseashighaspossible 1 12915 0 0 /news/551bc99c9843d 2 28847 0 0 /news/westronglybelievethatyouthisthefutureofanyclubsayssevenacrebossleehill 1 14171 0 0 /news/551a931e59554 1 13012 0 0 /news/craywort131116 5 87632 2 2 /news/wecantkeepthrowingpointsawaysaystonbridgeangelsbosstommywarrilow 1 13936 0 0 /news/crayrams291117 2 45284 0 0 /news/hopefullywellmakesittingbourneamajorforcesaysnewcoachwillgraham 1 13955 0 0 /news/dorkfav260416 2 53412 0 0 /news/551a979a97d90 1 4882 0 0 /news/ifeelmyteamarestillfindingtheirfeetsaysramsgatebosstimdixon 1 13960 0 0 /news/theweekaheadwc27thmarch2006 1 19668 0 0 /news/rymanleaguetransfernewsbarnesonthemoveagain-cugleyreaches500thgamemilestone 1 18265 0 0 /isthmian-league/10 5 83261 0 0 /news/551a931e62689 1 13216 0 0 /news/dagedove260319 2 27722 0 0 /news/551bc5dfa22d2 1 13751 0 0 /news/iwanttostayatmargatesaystrott 1 15066 0 0 /news/ashfvcd190419 3 82004 0 0 /news/tonbridge150615 3 27345 0 0 /news/kentleaguetitledualitswhitstablestolosenowsaysfrost-exclusive 1 15807 0 0 /news/wakelingifeltiwasatafuneralexclusive 1 14522 0 0 /news/spillerpensone-yeardealforfolkestone 1 14866 0 0 /news/ashford090417 1 18858 0 0 /news/chatham210917 2 14694 1 1 /news/chathamtownvleatherhead 1 14027 0 0 /news/551a979aa16f1 1 5542 0 0 /news/wehavetogiveourselvesachancesayshessenthaler 1 22668 0 0 /news/dulwich050317 4 37148 2 2 /news/bathebbsfleet050221 2 19189 0 0 /news/weneed3gpitchestobeattheweathersaysstrugglingashfordchairman 1 25434 0 0 /news/therehavebeenencouragingpositivesfromgametogamesaysdealtownbossdavejohncock 1 13417 0 0 /news/kentleague/tunbridgewells/7thjuly03.html 1 0 0 0 /news/gillsdefenderbryantendsinvictaloanspell 1 14336 0 0 /news/wellingunited3-1havantwaterlooville-ihopeourremaininggamesarentdramaticasthis-day 1 21134 0 0 /news/fisher160804.html 1 0 0 0 /news/vcd260305.html 1 0 0 0 /news/wokinghavewontheleagueadmitswellingunitedbossjamieday 1 14787 0 0 /news/ebbsfleetunited1-0eastbourneborough-wevegotagoodchanceofgettingpromotionsaysbrown 1 28225 0 0 /news/551bc99dbe7a4/kentyouth/nationwide/gillingham/3rdjuly03.html 2 15653 0 0 /news/kingstonian2ashfordtown4 1 10986 0 0 /news/punjabunited030823 1 13217 0 0 /conference-2003-2006/ 1 2462 1 0 /news/551a96dc2a751 3 47231 0 0 /news/drmartens/eastern/folkestone/staines041204.html 1 0 0 0 /news/wemustntgetleft-backinplay-offhuntsaysward-exclusive 1 12901 0 0 /news/craywands270716 3 38574 0 0 /archive-2006-2014/30 2 26047 0 0 /drmartens/eastern/dartford/12thdec05.html 2 12477 0 0 /news/othernews/AEI270904.html 1 0 0 0 /news/551a96dc0ce76 2 19565 0 0 /news/icametotheclubtogetthisteamtothekentleaguesayshollandsblairbosspaulpiggott 1 13089 0 0 /news/wp-content/plugins/apikey/a57bze8931.php 1 0 0 0 /news/wellingreleasefour 1 10115 0 0 /news/yiadompenscontracttocurbderesinterest 2 17039 1 1 /news/fisher1-10barnet-mybiggerandbetterplayersdidntshowuptonightadmitsperryhanifan 1 25136 0 0 /news/deanharrison090320 1 13214 0 0 /news/PMStatement230320 3 37058 0 0 /news/ashford310821 1 3703 0 0 /news/signingpursgloveshowshowambitiouswearesaysoboyle 1 13203 0 0 /news/theroadtowembleyfacarlsbergvasesecondrounddraw 1 11900 0 0 /news/sevethre130822 5 140350 0 0 /news/wearereallyexcitedaboutthecrowdsizefordartfordsaysbromleyco-chairmanashleyreading 1 15171 0 0 /news/551a956cde53f 1 4664 0 0 /news/suttonathletic230922 1 12684 0 0 /news/wellingtown010218 1 13190 0 0 /news/kentleague/VCD/31stjan04.html 1 0 0 0 /news/everyonehastopitchintoopenupthetitleracesayswellsbossmartinlarkin 1 15965 0 0 /news/wingsontheroadagaininlastsixteen 1 11052 0 0 /news/12thnov04.html 1 0 0 0 /news/dulwphoe050916 2 59209 0 0 /news/erithandbelvedere250419 1 13051 0 0 /news/wellmaybegiveitagoodgonextyearsayssuttonathleticbossjamescollins 1 15073 0 0 /news/tunbridgewells0-1stivestown-wegaveeverythingbuttheygotluckysaysmartinlarkin 1 23574 0 0 /news/hernebay0-2erithbelvedere 1 14480 0 0 /news/wellgivelarkhallathleticplentyofrespectsayshernebaybosssimonhalsey 1 15783 0 0 /news/doverchairmanurgesfanstoraisethevolume 1 12939 0 0 /news/itsbeenagreatjourneyanditsnowtimetoleavethebussaysdartfordco-chairmanbillarcher 1 13796 0 0 /news/aveley191105.html 1 0 0 0 /news/sevenoaks311218 2 27346 0 0 /news/kentleague/sladegreen/6thaug04.html 1 0 0 0 /news/pitchero.com/clubs/favershamtownfc 1 0 0 0 /news/551bc5de26471 1 11945 0 0 /news/tonbridgeangels180120 1 13113 0 0 /news/dartford070719 2 19551 0 0 /news/tonbridgeangels240620 1 11282 0 0 /news/eastbourneisadifficultplacetogoandgetaresultwarnsdartfordbosstonyburman 1 12060 0 0 /news/chathamlookforcapitalgains-exclusiveinterview 1 13377 0 0 /news/551a97b086b86 1 19151 0 0 /news/551bc99e3e57a 2 21542 0 0 /news/martinfordstatement190520 3 27635 0 0 /news/drmartens/eastern/folkestone/braintree271104.html 1 0 0 0 /news/weareinittotryandwinitsayserithtownbosstonyrussell 1 17017 0 0 /news/croydon100818 1 12541 0 0 /news/margate240717 1 13947 0 0 /news/551bc99dbe7a4/kentleague/ramsgate/drmartens/eastern/sittingbourne/sittingbournevwhyteleafe130903.html 2 15653 0 0 /news/faversham100818 3 29060 0 0 /news/oxfordunited0-0tonbridgeangels-tonbridgechairmanhailshismagnificentangels 1 20219 0 0 /news/grantwantstocasthisspellatfirstteamlevel-exclusiveinterviews 1 17355 0 0 /news/itwasaprivilegetocometomaidstonetohelpraisemoneyforsuchagoodcause-davebeasant 1 19554 0 0 /news/14thjuly05.html 1 0 0 0 /news/theclubisnotgoingtobebuiltovernightsayscrockenhillbosscraigclark 2 16638 0 0 /news/langton070116 1 12839 0 0 /news/winningcupwillbeicingonthecakesaysdolby-exclusiveinterview 1 13693 0 0 /news/corinthian-casuals1-2bridonropes-ifanciedustoturnitroundsaysdanielfrost 4 73536 1 1 /news/chathamtown3-2waltoncasuals-onegameatatimeforsurvivaldreamssayscaretakerbosswatson 1 19459 0 0 /news/bridonropes070923 3 36351 0 0 /news/SASSCT060616 3 18347 1 1 /news/rusthoun060817 1 25956 0 0 /news/robbinslookingforwardtomassivegameagainstdalers 1 12687 0 0 /news/othernews/FixNov2004.html 1 0 0 0 /news/kentleague/beckenham/8thaug03.html 1 0 0 0 /news/nomadswell170516 1 29533 0 0 /news/dulwpeter08072015 2 53186 0 0 /news/ramsgate050521 4 33435 1 1 /news/chatham070716 3 29363 0 0 /news/othernews/5thnov04.html 1 0 0 0 /southern-counties-east-football-league/57 1 19768 0 0 /news/folkestoneinvicta2harrowborough1 1 15049 0 0 /news/551bc5da85df8 4 35110 0 0 /news/december2009fixtures15december2009-2january2010 1 44855 0 0 /news/551bc5dc69eaf 3 36823 0 0 /news/greenafcc090416 2 44395 1 1 /news/551bc99e199b8 2 20833 0 0 /news/kentleague/beckenham/6thjuly03.html 1 0 0 0 /news/551a9677f406c 2 19287 0 0 /isthmian-league/18 3 43355 0 0 /news/bromleiansfc.co.uk 3 0 0 0 /news/thamesmead080615 3 32356 0 0 /news/sittingbourneingroundsharetalkswithnortonsports-revealsabbott 1 17683 0 0 /news/ifwehaveambitionstogetintotheplay-offswemustwinourhomegamessayskeithmcmahon 1 20219 0 0 /news/welling270517 2 14421 0 0 /news/burmanreasonablyhappywithstart 1 12790 0 0 /news/ramsgate140917 2 31667 0 0 /news/drmartens/premier/welling/30thjune03.html 1 0 0 0 /news/ashbyplaysthewaitinggame 1 12103 0 0 /news/551a95b3a8883 2 18584 0 0 /news/thefleetatwembleybringthetrophybacktokentsaysthree-timewembleywinnerhyde-exclusive 1 17844 0 0 /news/bromleyagreeten-yeardealforcrystalpalaceladiessidetoplayathayeslane 2 16887 0 0 /news/dartford280122 6 60810 1 1 /news/othernews/youthleaguetables020204.html 1 0 0 0 /news/blyspartans1-1hollandsblair-itsgoingtobeverytoughtowinthisleaguesaysmatthume 1 23230 0 0 /news/trottsettomakemargatedebut 1 13528 0 0 /news/dartford0-0grimsbytown-thedamagewasdoneineightminutesofmadnesslastweeksaysburman 1 24400 0 0 /news/kingstonian0-3maidstoneunited-illbesurprisedifwerenotallowedtogoup-jaysaunders 1 28521 0 0 /news/langtonquitsrusthalltocoachdale 1 12891 0 0 /news/wardhaswordsofcomfortformunday 1 21481 0 0 /news/lordsvgreen280204.html 1 0 0 0 /news/551a9c0ea02da 4 38901 0 0 /news/ashfordtown1-2metpolice 2 25406 0 0 /news/bridon201017 2 17105 0 0 /news/lukeblewden191019 2 22711 0 0 /news/iwantpeopletothinkaboutwhatwedoallthetimesayssevenoakstownbosssimonjones 1 15367 0 0 /news/551a9798a1e3b 2 28450 0 0 /news/551a97b189dcd 1 15610 0 0 /news/winning23trophiesoverthelastsixyearsisremarkablereallysaysstonescoachjackparkinson 1 19774 0 0 /news/greenwichboroughbringintwofromdartfordsacademy 1 14998 0 0 /news/551a97987bd64 2 19455 0 0 /news/sevenoakstown3vcdathletic3fordimproudofmyyoungsters-exclusive 2 21327 0 0 /news/551a9250184b7 2 23855 0 0 /news/551bc5e271525 1 12482 0 0 /news/chairmanregainscontroloverteamaffairsascroydonneedtotakeanewdirection 1 14324 0 0 /news/sponsorpullsthenetfromunderneathhernebay 1 12390 0 0 /news/wevemissedtheboatadmitswestwickhammanagerkeithdurso 1 21381 0 0 /news/wehavetomakereachfieldsalittlebitmoreofafortresssayshythetownbossscottporter 1 13006 0 0 /news/FAStatement090420 3 47285 0 0 /archive-2006-2014/66 1 20460 0 0 /news/wp-admin/css/colors/coffee/index.php 1 0 0 0 /news/551bc5e56ad0e 2 26567 0 0 /news/25thjan04.html 1 0 0 0 /news/maidstone250517 1 11437 0 0 /news/maidstoneunited4vcdathletic0stroutsplatformforstonesfootballleaguereturn 1 16464 0 0 /news/drmartens/premier/dover/8thoct04.html 1 0 0 0 /news/hopefullywecancomeawaywithalionsshareofthepointsoverthechristmasperiod-hayes 1 18443 0 0 /news/leebrowning100516 2 33343 0 0 /news/stonescoachwehavethesquadtopushforthetitle 1 11809 0 0 /news/bromley030617 1 12755 0 0 /news/yorathitwasembarrassing 1 15581 0 0 /news/551bc5e8bbd7d 1 11731 0 0 /news/drmartens/premier/welling/3rdnov04.html 2 0 0 0 /southern-counties-east-football-league/62 1 18663 0 0 /news/barkmarg261019 3 79421 0 0 /news/iwantmyplayerstoshowmewhattheyremadeoffsaysbutler 1 17466 0 0 /news/maidstone211205.html 1 0 0 0 /news/margate4-5folkestoneinvicta-cugleyhasfaithinyoungstersforgreatescape 1 20987 0 0 /news/drmartens/eastern/sittingbourne/bhtvsitt140204.html 2 0 0 0 /news/metrstan300419 1 27609 0 0 /news/bermondseytown020322 3 29572 0 0 /news/drmartens/eastern/tonbridge/15thjuly03.html 1 0 0 0 /news/letsfinishtheseasononahigh-notesayslovell-exclusiveinterview 1 15299 0 0 /news/werenotgoingtolookforquickfixessayssuttonathleticbossjamescollins 1 14287 0 0 /news/wellgiveourwonderfulfanssomethingtocheeraboutvowslovell 1 14029 0 0 /news/551a931d9b486 1 12685 0 0 /news/lewisham220917 1 13790 0 0 /news/wevegottosticktogetherandputthingsrightsaysangelsdefenderliamharwood 1 15516 0 0 /news/thefavaseisamassiveopportunityforplayerstoputthemselvesinshopwindowsayspaulproctor 1 15307 0 0 /news/weneedtoseeareactionprettyquicklysaystunbridgewellsbossmartinlarkin 1 25575 0 0 /news/craywands250118 3 33792 0 0 /news/stansfeld231222 1 13747 0 0 /news/KSTSF080304.html 1 0 0 0 /news/551bc99dbe7a4/drmartens/eastern/dartford/drmartens/cupdraw.html 2 15653 0 0 /news/leistonaregoingtobeadifficultsidetobeatwarnsburman 1 16512 0 0 /news/551a979a6c067 1 5366 0 0 /news/vcdmcmahon140515 2 34423 0 0 /news/mychairmanwantsmetowinthetitlesaysward 1 18276 0 0 /archive-2006-2014/240 1 19159 0 0 /news/wevegotsomeexcitingtimestocomeatashfordtowninsiststhorogood-exclusiveinterview 1 22944 0 0 /news/tonbridgeangels0-4craywanderers-weneedtosticktogethersaysdefiantangelsboss 1 29795 0 0 /news/551a956ba4a09 1 4724 0 0 /news/ifwegetintotheplay-offsitwillbeunbelievablesaysthamesmeadtownbosskeithmcmahon 1 16406 0 0 /news/shepwals031123 7 253428 0 0 /news/soccershortssittingbournebelonginthetophalfofthetablesaysjoint-managerdannyward 1 15322 0 0 /news/soccershortscroydoncontinuesearchfornewcoach 1 16542 0 0 /news/ashfordtown0-0whyteleafe-ashfordeasetheirrelegationfears 1 12860 0 0 /news/551bc99dbe7a4/kentleague/cray/kentleague/hernebay/1stjuly03.html 2 15653 0 0 /news/551a931e0e599 1 15230 0 0 /news/ivelearntalotmoreaboutmyplayerssaysbutler 1 15249 0 0 /news/itsgoingtobeafree-scoringthrillerpredictsmcmahon-exclusiveinterview 1 18366 0 0 /news/croydon011220 2 19495 0 0 /news/barking011105.html 2 0 0 0 /news/blyspartanshasthepotentialtobeakentleagueclubsaysdepartingbossmatthume 1 15813 0 0 /news/25thjune05.html 1 0 0 0 /news/afchornchurch1-1tonbridgeangels-warrilowstroopssoclosetotheplayoffs 1 24542 0 0 /news/9thnov05.html 2 0 0 0 /news/tonbridgeangels1-1bromley-hopefullyitsnottoolittletoolatesaystommywarrilow 1 28886 0 0 /news/kentleagueawaitsladegreenresignationletter 1 16636 0 0 /news/alanjulianhasacceptedanofferhecouldntrefusesaysdartfordbosstonyburman 2 16186 0 0 /news/wemustmatchopponentsbattlingqualitiessayslovell 1 12544 0 0 /news/newlookwellingarebondingwellsaysgoalkeeperturner-exclusive 1 15706 0 0 /news/551a9c0ee4a2b 4 38140 0 1 /news/trottsearchesfortrainingbase-exclusiveinterview 1 12898 0 0 /news/clubsinvitedtonewleaguemeeting 1 20040 0 0 /news/FAStatement220221 4 29891 1 1 /news/facupfirstrounddrawtheresnoillfeelingsbetweenusandgills-doverchairman 1 14938 0 0 /news/othernews/youthleaguetables160204.html 1 0 0 0 /news/canterbury100818 1 12678 0 0 /news/ebbsfleetunitedcalltheshots-weregoingtowembley 1 9926 0 0 /news/maidstone020915 1 12305 0 0 /news/margate090717 2 30184 0 0 /news/powershownthedoorfollowinghalf-timedifferenceofopinionwithjenkins 1 15388 0 0 /news/recentresultsforthcomingfixtures30thaugust-9thseptember 1 76224 0 0 /news/15thjuly04.html 1 0 0 0 /news/ourtwocupsemi-finalsareourprioritynowsayssuttonathleticbossjamescollins 1 16439 0 0 /news/551bc99dbe7a4/drmartens/eastern/sittingbourne/kentleague/ramsgate/ramsgatevdeal071003.html 2 15653 0 0 /news/images/alfa-rex.php7 1 0 0 0 /news/tunbridgewells2-2sevenoakstown-exceptionalczannerdeniesten-mansevenoaks 1 31291 0 0 /news/ihavethebackingoftheboardinsistslovell 1 20423 0 0 /news/wevegottostartputtingourchancesawaysayswarrilow 1 18648 0 0 /news/lovellreleasespairtoplaymoregames 1 11361 0 0 /news/werehappywithourseasonsofarsayshollandsblairbosspaulpiggott 1 14597 0 0 /news/tonbridge050317 2 28785 0 0 /news/wevegottolookfortopthreesayscrayvalleybossstevechapman 1 15760 0 0 /news/youllbefoolishtowriteusoffwarnstonbridgeangelsbosstommywarrilow 1 18236 0 0 /news/Bromleycrystalpalace250715 2 20683 0 0 /news/6thoct05.html 1 0 0 0 /news/kentleague/VCD/4thsept03.html 1 0 0 0 /news/hessenthalerrelishingspicydartfordreturn 1 14957 0 0 /news/kentcounty/30thjune.html 1 0 0 0 /news/551a96dba6dec 3 30752 0 0 /news/thisdecisionisanotherimportantoneforenglishfootballsaysmaidstoneco-owneroliverash 1 17096 0 0 /news/dulwmetp210215 2 44491 0 0 /news/supportersclubchairmanpredictsbetterfutureforinvicta 1 13463 0 0 /news/5thoct05G.html 1 0 0 0 /news/551bc5ddb6fe1 1 11813 0 0 /news/whitstable020120 2 27742 0 0 /news/folkcugley270415 2 32132 0 0 /news/chatwhit141117 1 34904 0 0 /news/everyoneispullingtogetherforgeorgehoward 1 18842 0 0 /news/fishmill120719 2 34421 0 0 /news/whitstablecountthecostoftheft 1 14333 0 0 /news/mcmahonmakesroystonhisfirstbignamesigning 1 13023 0 0 /news/551bc5db4d2b6 3 40335 0 0 /news/551a967908594 3 43812 0 0 /news/itsbeenagreatyearsaysfavershamtownmanagerjustinluchford 1 20763 0 0 /news/glebe230422 4 57490 0 0 /news/walkerplaysdowncoxquitclaims 1 11157 0 0 /news/winningtreblewasafantasticachievementadmitsmcmahon 1 10949 0 0 /news/dartford1-0ebbsfleetunited-wevegivenitourbestshotover180minutessaysstevebrown 2 38198 0 0 /news/551bc99a84eeb 2 16342 0 0 /news/folkestoneinvicta2-4ashfordtownaet 1 16910 0 0 /news/cumberbatchfeelsfrustratedoverpostponements-exclusiveinterview 1 13627 0 0 /news/sct14062020 1 11911 0 0 /news/folkestone260320 2 24707 0 0 /news/wellwinifweplaywellatwaltoncasualssaysfavershamassistantclivewalker 1 12638 0 0 /isthmian-league/22 3 45083 0 0 /news/erithtown090516 1 10948 0 0 /news/hytheheroeswearereadytocreatehistorysaysscottporter 1 25923 0 0 /news/soccershortstrophywinningskipperstayswiththefleet 1 14889 0 0 /news/551bc99a56f3f 1 10926 0 0 /news/551a99e4302ef 1 11837 0 0 /news/youngstrikerfightsback 1 14940 0 0 /news/tonbridge250915 2 24603 0 0 /news/dartford4-2bostonunited-jacoberskinewillimprovewithussaysdartfordbosstonyburman 1 24259 0 0 /news/bromvleat240104.html 1 0 0 0 /news/tonbridgeangels1-1canveyisland-ourperformanceisntacceptable-warrilow 1 20752 0 0 /news/imsuretheleaguewillbeevenharderthanlastseasonwarnsdulwichhamletbossgavinrose 1 17089 0 0 /news/hernebay190417 2 22330 0 0 /news/thamesmead090317 2 44016 0 0 /news/4thdec04.html 1 0 0 0 /news/hawkingetown141021 1 11772 0 0 /news/551a931e0624d 1 11332 0 0 /news/551a96db91064 4 44761 0 0 /news/kentcoachcrossestheborder-exclusiveinterview 1 13228 0 0 /news/folkestone040416 2 25604 0 0 /southern-counties-east-football-league/24 1 20669 0 0 /news/sittingbourne1-1leatherhead 1 18007 0 0 /southern-counties-east-football-league/31 1 20563 0 0 /news/hernebay190821 2 32792 0 0 /news/phoenixsports1-2hollandsblair-wewanteditalittlebitmoresayspaulpiggott 1 29667 0 0 /news/toomanyplayersareplayingonreputationsandhavenotgottheheartfumesnott 1 14820 0 0 /news/kentleague/beckenham/whitres040904.html 1 0 0 0 /news/551bc5e7e4e88 1 14867 0 0 /news/wp-content/themes/gaukingo/db.php 1 0 0 0 /news/vcdathletic0beckenhamtown2 1 13236 0 0 /news/chathamtown1-0maidstoneunited-weredeadlyseriouswhatweredoinghereinsistsobrien 1 29083 0 0 /news/551bc5e347afd 1 14405 0 0 /news/551bc5e24e9e3 1 11178 0 0 /news/EMC070520 3 32208 0 0 /news/wevegottomakesurethatwekeepprogressingsayssuttonathleticbossjamescollins 1 16144 0 0 /news/specialofferadvertiseforjust10permonth 1 11661 0 0 /news/551bc99dbe7a4/kentleague/sevenoaks/drmartens/eastern/folkestone/havantvfolkfat291103.html 2 15653 0 0 /news/emcacademy070823 2 19904 0 0 /news/ashfordtownp-pwhitstabletown-kentderbyfails4pmpitchinspection 1 10149 0 0 /news/drmartens/eastern/folkestone/hastvfolklgecup281003.html 1 0 0 0 /news/bromley160318 1 15023 0 0 /news/boroughmaketriplesigning 1 11190 0 0 /news/hawkinsfacesuptolifebeingasemi-pro 1 14050 0 0 /news/wp-content/wp-22.php 1 0 0 0 /news/sheppeyunited210122 1 13633 0 0 /news/fishdeal140323 4 145038 0 0 /news/551a95b3d1ab4 2 15482 0 0 /news/551a931ec658d 2 34086 0 0 /news/thishasbeenaveryharddecisiontoleavehernebayforhastingssayshugolangton 1 14097 0 0 /news/milessearchesforlowerleaguetalentashetargetsconsolidation-exclusive 1 16198 0 0 /news/greenwich190216 1 11829 0 0 /news/therespeopleattheclubwiththeirownagendasaysdarrenanslow 1 16205 0 0 /news/doverathletic4-2dartford-unstoppabledovergo13pointsclearattop 1 20343 0 0 /news/othernews/18thjuly04.html 1 0 0 0 /news/favasefinalpreview190518 1 17063 0 0 /news/dulwichhamlet2-0margate-wehadtoworkreallyhardtogetthepointssaysgavinrose 1 28587 0 0 /news/soccershortsbosseslookforwardtooakleyroadvaseshowdown 1 29247 0 0 /news/favershamtown1-1hernebay-halseyfumesplayingreserveswasawasteoftime 1 36738 0 0 /news/thisseasonhasjustbeenalittlebittoolongformyplayerssaysdartfordbosstonyburman 1 12074 0 0 /news/551a9c0f10d7c 2 21426 0 0 /news/551a9c9238758 3 38300 0 0 /news/wellingtown101217 1 13943 0 0 /news/551bc99dbe7a4/kentleague/cray/kentleague/sladegreen/23rdjuly03.html 2 15653 0 0 /news/551bc5e856ce0 1 15473 0 0 /news/resultsnovember2021 3 152391 0 0 /news/patchedupangelsconfidentofcausingupset-exclusive 1 15164 0 0 /news/imlookingforagoodresponseaswewerepooragainstmersthamsayswhitstablebosspeternott 1 15125 0 0 /news/carrollreplacessilkasterrorscoach 1 11417 0 0 /news/551bc99dbe7a4/drmartens/eastern/ashford/kentleague/sporting/20thjuly03.html 2 15653 0 0 /news/easthythe171015 2 64363 0 0 /news/theclubisreallypleasedthatsammotthasgotanenglandccall-upsayswellingbossjamieday 1 15202 0 0 /news/551bc5e5e3cc5 1 13583 0 0 /news/crayvtham291003.html 1 0 0 0 /news/peckhamtown150620 1 12594 0 0 /news/inpossiblytwoyearstimewecouldbeaforcetobereckonedwith-corinthianbosstonysitford 1 20936 0 0 /news/leaguemerger180216 1 16410 0 0 /news/23rdjune04A.html 1 0 0 0 /news/whyteleafe030905.html 1 0 0 0 /news/beckenhamtown3-5corinthian-weredelightedtogetthroughsayscorinthianbossjamescollins 2 51003 0 0 /news/iamreallyexcitedaboutwhatthefutureholdsformeathernebaysaysgoalkeeperjackdelo 1 11925 0 0 /news/soccershortslillisstaysatthebay 1 16499 0 0 /news/bromley060821 3 28954 1 0 /news/dulwich010516 2 26274 0 0 /news/551bc99dbe7a4/ryman/bromley/drmartens/eastern/sittingbourne/corbvsitt131203.html 2 15653 0 0 /news/551bc99dbe7a4/drmartens/eastern/tonbridge/drmartens/premier/welling/7thjuly03.html 2 15653 0 0 /news/ramsgateiswhereienjoyedmyhappiesttimesinfootballsayswillgraham 1 13450 0 0 /news/ramsbosswardtargetsmaximumfestivehaul 1 12463 0 0 /news/bromcpal020816 2 34512 0 0 /news/551a9c9284535 3 42161 0 0 /news/beckroch151117 1 33424 0 0 /news/sittingbourne080123 2 26021 0 0 /news/551bc5e69bafe 1 15750 0 0 /news/bromleysmostfamouspartofhayeslanedisappeartomeetconferencepremiergroundgrading 2 19937 0 0 /news/sevewhit010923 5 146795 0 0 /news/551bc5df28bb8 1 16583 0 0 /news/unfortunatelytherehasbeenabridgethatcantbemendedsaysnickdavis 1 16211 0 0 /news/afccroydonathletic240818 1 13162 0 0 /news/ramsassistantwarnsthanetfoesmargateweregoingtogivesomeoneaheavydefeat-exclusive 1 17744 0 0 /news/551a9c92a2889 2 24445 0 0 /news/dealtown220319 1 11856 0 0 /news/551a979898cea 2 23365 0 0 /news/dolbyforcedtodelveintoreserves-exclusiveinterview 1 13398 0 0 /news/thethoughtofplayingintheplay-offfinalisbrilliantsaysdovermidfielderchriskinnear 1 16860 0 0 /news/ramsgate311219 3 31111 0 0 /news/bromley061120 6 56162 0 1 /news/20thjuly05.html 1 0 0 0 /news/maidstoneunited090123 1 13826 0 0 /news/fordthingscanonlygetbetter 1 17822 0 0 /news/glebe260317 1 12634 0 0 /news/fishcant201118 1 25737 0 0 /news/wellingunited110522 1 10994 0 0 /news/soccershortsgreenwichboroughapproachdutchsuperstaredgardavidstosignforclub 1 19003 0 0 /news/tonbridgeangels050420 1 14504 0 0 /news/551bc5e3c666f 1 13474 0 0 /news/ashford070618 3 27301 0 0 /news/myoldsidewanttostickoneonmesaysbutler 1 16041 0 0 /news/551bc5e86a518 1 11869 0 0 /news/stonevowstoreturnfromhorrendouslegbreak 1 14827 0 0 /news/10thjune04.html 1 0 0 0 /news/invictamidfielderreachesmilestone 1 21618 0 0 /news/othernews/coneyhall160304.html 1 0 0 0 /news/hessenthalerplansforexcitingtimes 1 12505 0 0 /news/19thnov03.html 1 0 0 0 /news/rusthall090819 1 12317 0 0 /news/rustkspo290921 4 128066 0 0 /news/dulwich010116 2 24340 0 0 /news/wemustgetstadiumapplicationrightsaysstoneschairman 1 11720 0 0 /news/ramsgate2-3tonbridgeangels-angelsflyingatthetopofthetable 1 17035 0 0 /news/collegepaintingchathamtownredblackandwhite 2 14058 0 0 /news/551a96dc7fd8d 2 91078 0 0 /news/drmartens/eastern/sittingbourne/sittvchar170704.html 1 0 0 0 /news/18thaug03.html 1 0 0 0 /news/tonbridgeangels2-3carshaltonathletic-warrilowmylowestfeelinginfootball 1 26516 0 0 /news/wehavetobeontopofourgametosinkswanssaysward-exclusive 1 13986 0 0 /news/collinslarkin120515 1 14689 0 0 /news/adamsbidstoendcrockenhillssaddemise 1 14078 0 0 /news/tonbridgeextendgloziersloanspell 1 10750 0 0 /news/ashford010418 3 27613 0 0 /news/erithandbelvedere270919 1 12181 0 0 /news/dartschairmanforgetaboutthepastandenjoytheocassion-exclusiveinterview 1 15782 0 0 /news/551a95b36bcf0 2 14558 0 0 /news/soccershortsealhamdecidestoretire 1 27350 0 0 /news/NationalLeague310320 2 14019 0 0 /news/wefindithardtokeepholdofourplayerssaysebbsfleetunitedbossliamdaish 1 13980 0 0 /southern-counties-east-football-league/54 1 20213 0 0 /news/favershamtownbossrayturnerpaystributetodepartingstrikerlukeharvey 1 17355 0 0 /news/551bc5e5aa931 1 20396 0 0 /news/deresjoint-bosstellsfansmysidewillentertainyou-exclusive 1 18538 0 0 /news/tonbridge201215 2 29525 0 0 /news/551bc99dbe7a4/drmartens/eastern/sittingbourne/drmartens/premier/welling/7thjuly03.html 2 15653 0 0 /news/fewellsheroicsbreakwestwickhamshearts-exclusiveinterview 1 20650 0 0 /news/sittingbourne030219 2 28180 0 0 /news/gillsfanswillgivehessawarmreceptionatdoversaystaylor 1 15676 0 0 /news/kentleague/beckenham/12thdec04.html 1 0 0 0 /news/werebackintheplay-offracesaysabbott 1 15264 0 0 /news/iwillnotpayovertheoddsforplayersinsistslovell 1 16002 0 0 /news/551bc5e5225b2 1 11530 0 0 /news/ithinkwevemadevirtually10000onstuartkinginsideamatterofmonthssaysneilcugley 1 17289 0 0 /news/rochesterunited160323 2 25682 0 0 /news/ksports060418 1 14079 0 0 /news/margate0-1tonbridgeangels-mymargatesidelackedpassionfumesbossiainoconnell 1 25402 0 0 /news/hythetown051023 5 80480 0 0 /news/wellingunited2-2dartford-wejusthavetogetoutofthisrutsaysdartfordbosstonyburman 1 29675 0 0 /news/nortonsportswelcomedintokentleague 1 11298 0 0 /news/wp-content/plugins/ioptimization/abruzi.php 1 0 0 0 /news/doverathleticchairmanjimparmenterissuesfansrallyingcry 1 12722 0 0 /news/551a99e4b3d8b 2 35648 0 0 /news/sevelord110818 2 68262 0 0 /kent-county-league/3 3 41420 0 0 /news/wehavetogotothreebridgesanddoaprofessionaljobsayshythetownbossscottporter 1 13786 0 0 /news/thamesmead250916 2 25990 0 0 /news/dockerssearchforfriendlymatches 2 13190 0 0 /news/ambitiousclubbegintheirclimbupthepyramid-exclusive 1 12801 0 0 /news/charlieslocombe020819 3 27356 0 0 /news/wevelaidthefoundationsandwewanttobuildsaysburman-exclusiveinterview 1 17031 0 0 /news/fcelmstead080319 1 12938 0 0 /news/551a9c0eabd86 4 35743 0 0 /news/othernews/8thJan04.html 1 0 0 0 /news/551bc99ddfaae 2 21565 0 0 /news/551bc99ab4174 2 28391 0 0 /news/551bc99e1c7fd 2 22050 0 0 /news/100000debtalmostwipedoutdulwichhamlet 2 17657 0 0 /news/itsgoodthatotherpeoplearenoticingourprogresssaysabbott 1 16873 0 0 /news/theclubmeansbusinessandwewanttomakeaswiftreturnsayscraywanderersbosskeithbird 1 12448 0 0 /news/sportingclubthamesmead280719 1 12663 0 0 /news/ksports010218 1 12278 0 0 /news/551bc99dbe7a4/drmartens/eastern/folkestone/ryman/bromley/11thjuly03.html 2 15653 0 0 /news/whitstabletown1-3afcsudbury-iwasembarrassedbytheperformanceadmitsjimward 1 27388 0 0 /news/551bc5e3ebc36 1 15822 0 0 /news/wealdstone3-2ramsgate-theygaveusafootballlessonadmitsramsgatebosstimdixon 1 25597 0 0 /news/holmesdale2-2rusthall 1 17546 0 0 /news/fleetlaunchthecrossbarchallenge 1 13700 0 0 /archive-2006-2014/247 1 19373 0 0 /news/newwingsbosssmithrelishinghischance 1 12732 0 0 /news/folkestoneinvicta0-0sloughtown 1 14467 0 0 /news/kentfootballunited240822 1 15053 0 0 /news/kspocrow170122 5 163807 0 0 /home/ 2 27523 0 1 /news/glebhanw201121 4 131086 0 0 /news/wereinvolvedinfootballforgameslikethesesaysmichaelmarks 1 14643 0 0 /news/dulwichhamlet6-1sittingbourne-brickiesshockerendsplay-offhopes 1 18567 0 0 /news/22ndmay04.html 1 0 0 0 /news/legendhessenthalerileavedoverathleticwithaheavyheart 1 13566 0 0 /news/phoenixsports070220 2 25648 0 0 /news/biggunsreturnforvcd-exclusiveinterview 1 16145 0 0 /news/bromleyacademyachievesuccessonandoffthepitch 1 15094 0 0 /news/thamesmead270615 2 30067 0 0 /news/551bc5dcdc6d4 1 13304 0 0 /news/dealtown090717 1 12578 0 0 /news/weattempttobouncebackatthefirstattemptsaysthamesmeadtownbosskeithmcmahon 1 12582 0 0 /news/brommaid100218 2 46054 0 0 /news/dartford5-0kingstonian-itsburnsnightforscintilatingdarts 1 35558 0 0 /news/551bc5e731abf 1 17644 0 0 /news/walkerunveilssignificantpoutonsigning 1 12611 0 0 /news/westwickham271104.html 1 0 0 0 /news/sheppey070418 1 14585 0 0 /news/tonbhamp270216 2 56721 0 0 /news/ifitgoesokimayaskthechairmanificanhavethejobsaysjoedowley 1 15380 0 0 /news/cugleydemandsimprovementagainsturchins 1 19285 0 0 /news/551a96775fe0e 2 20375 0 0 /news/improudofmyachievementsonandofftheparkatorpingtonsaysformerbossseanglover 1 17021 0 0 /news/foresthillpark220219 1 14159 0 0 /slade-green-2003-2006/2 1 14687 0 0 /news/beforechristmaswewerebeatingthesidesaroundthetopsaysmeadbosskeithmcmahon 1 16800 0 0 /archive-2006-2014/173 1 19210 0 0 /news/wereexpectingatoughgameagainsteastprestonwarnsfisherbossstevefirkins 1 13719 0 0 /news/glebe110222 1 17306 0 0 /news/apmcontrast3-3farnborougholdboysguild-thefuturelooksgoodsaysfobgbossdarrenburkett 1 27759 0 0 /news/sportphoe040518 1 28490 0 0 /news/rosethestandardofkentleaguefootballishighexclusiveinterviews 1 17667 0 0 /news/wingsmournthelossofstalwart 1 11240 0 0 /news/wellbepreparedforwarlinghamsaystunbridgewellsbossmartinlarkin 1 15887 0 0 /news/551bc99dbe7a4/kentleague/lordswood/othernews/fat1stnov.html 2 15653 0 0 /news/wellingtown250920 1 13686 0 0 /news/tonbascot060916 2 54768 0 0 /news/corinthian070918 1 13010 0 0 /news/angelsoncoursetobouncebackatfirstattempt 2 17693 0 0 /archive-2006-2014/263 1 19228 0 0 /news/sittingbourne190216 2 25464 0 0 /news/tunwells140917 1 12716 0 0 /news/holmesdale020523 1 13408 0 0 /news/beatingtitlefavouriteseastleighwasabigresultforussaysdoverathleticbossnickyforster 1 14174 0 0 /news/thammarg070921 2 61539 0 0 /news/wellingownersseekfanshelptopaycrippling85000taxbill 1 24160 0 0 /news/weregoinguptooxfordtofinishoffthejobvowsosborne 1 15825 0 0 /news/kentleague/cray/chatham081204.html 1 0 0 0 /news/suttonathleticgiventhegreenlighttodeveloptheirlowerroadground 1 12729 0 0 /news/ashfordunited271118 3 34062 0 0 /news/ebbsfleetunited3-0borehamwood-wouldntitbenicetodreamaboutthethirdround-daish 1 23805 0 0 /news/dontgetbulliedbyborgsboys 1 15604 0 0 /news/countdowntoprincespark12days-burmanexpectsaverytoughtestagainsttanners 1 12858 0 0 /news/eritwhit310118 1 32196 0 0 /news/sittcor190116 2 22943 0 0 /news/soccershortsboardroomchangesattunbridgewells 1 19240 0 0 /news/551bc5df62be0 1 16193 0 0 /news/dartfordfacebromleyinlastsixteenoffatrophy 1 12515 0 0 /news/thamesmeadbosskeithmcmahonsignsstrikerdannycrouchondualregistrationfromdartford 1 18667 0 0 /news/craywanderers1-2leatherhead-ifeelivebeenletdownbymyteamtodaysaysianjenkins 1 25226 0 0 /news/551a95b3712a0 4 35368 0 0 /news/conference/gravesend/12thsept03.html 1 0 0 0 /news/milestargetstenpointsforsafety-exclusiveinterview 1 25920 0 0 /news/lovellwantstoendcampaignonastrongnote-exclusive 1 13980 0 0 /news/erith050305.html 1 0 0 0 /news/sambewickisthethirdoffoursigningsiwantedtomakethissummersaysscottporter 2 16043 0 0 /news/youmustreadthis 1 11500 0 0 /national-league/36 2 23095 0 0 /news/wevegottomakeournexttwohomegamescountsaysbutler 1 14590 0 0 /news/garlandblastsbengalblackout-exclusiveinterviews 1 17098 0 0 /news/leightonfat091004.html 1 0 0 0 /news/westwickhamsplitoverleaguefuture 1 15877 0 0 /news/thamesmeadtown0-4sittingbourne-lovellkeepshisfeetontheground-exclusive 1 19188 0 0 /news/551a99e447b4e 1 11574 0 0 /news/ramsgate1-0stainestownwardhailscrowdpleaseredusei-exclusiveinterview 1 16010 0 0 /news/tonbvfolk131203.html 1 0 0 0 /news/551bc5e2a40d9 1 12573 0 0 /news/folkestoneinvicta260523 2 27427 0 0 /news/ebbsfleetunited3-2chester-werenotmanyroundsawayfromwembleynowsaysliamdaish 1 19953 0 0 /news/iwanttocontinuethegoodworksetoutbyrobpalmersaysconeyhallbosschristucker 1 14576 0 0 /news/sevenerith191016 1 29202 0 0 /news/rymanshockdecisionnewlypromotedwhitstablesupportdartfordsbid-exclusive 1 13654 0 0 /archive-2006-2014/235 1 19338 0 0 /news/whitstable121115 2 25130 0 0 /news/dulwichhamlet1-4millwall-ivegotnoproblemswithmillwallsapproachatallsaysgavinrose 1 29704 0 0 /news/twokentclubschasedrydenasstrikerturnsdowndovercontract 1 13001 0 0 /news/thebigproblemwevegotiswehaventscoredenoughgoalssaysmargatebosssimonosborn 1 13794 0 0 /news/metrogas220415 1 12883 0 0 /news/dockerrelishingcupshowdownwithrivalstonbridge 1 16504 0 0 /news/dolbystrivesforautomaticpromotion 2 20041 0 0 /news/werenotexpectedtogetanythingfrommaidstoneandfolkestonesaysjustinluchford 1 14320 0 0 /news/551a9798d1c00 1 5976 0 0 /news/drmartens/eastern/folkestone/folkvdart130304.html 1 0 0 0 /news/soccershorts130523 4 67509 1 0 /news/551bc5dfa6c3b 1 12462 0 0 /news/lordswood250920 4 51546 0 0 /news/tootbags111220 1 31963 0 0 /news/551bc99c5638b 2 27886 0 0 /news/sheppeysheernessunited7-0erith147sports-itsafantasticdayfortheclubsayskevinhake 1 35132 0 0 /news/itsbeenalongtimemaybetoolongforfacupsuccesssaysbromleycoachhugolangton 1 20112 0 0 /news/wewanttohaveagoodpositiveendtotheseasonsayschathamtownassistantmanagerkeithlevett 1 16977 0 0 /news/holmesdale101019 1 13218 0 0 /news/gillingham090704.html 1 0 0 0 /news/drmartens/eastern/erith&belvedere/9thdec04.html 1 0 0 0 /news/afchornchurch0-0dartford-burmansatisfiedwithboredraw-exclusive 1 18030 0 0 /news/551bc99dbe7a4/ryman/drmartens/eastern/sittingbourne/13thaug03.html 2 15653 0 0 /news/maidstone310717 1 15594 0 0 /news/551a9c931a3fc 3 43812 0 0 /news/weregoingfortheplay-offssayswhitstabletownjoint-bossjimward 2 32110 0 0 /news/thamesmeadtown1-2graysathletic-wecouldvegotsomethingoutofitsayskeithmcmahon 1 29165 0 0 /news/othernews/24thjuly03.html 1 0 0 0 /news/551bc5de1d25f 1 11187 0 0 /news/551a956cf0ddb 1 5694 0 0 /news/30thjune03.html 1 0 0 0 /news/uxbridge291005.html 1 0 0 0 /news/551bc5e5017da 1 11030 0 0 /news/glebbeck210818 1 26687 0 0 /news/franciswaryofopeningdayshock 1 14046 0 0 /news/tunbridgewells0-3thamesmeadtown 1 13057 0 0 /news/backingthefleettowembleygloryiwontbottleitwhenputonthespotinsistsmoore 1 15297 0 0 /news/sheppey091020 1 16168 0 0 /news/greenholl290316 1 19020 0 0 /news/waitisalmostoverforkentleagueclubs 2 14196 0 0 /news/drmartens/premier/dover/calaisreport.html 1 0 0 0 /news/sheppeyunited190821 1 13994 0 0 /news/wellbelookingtofinishtheseasonstroglysayssittingbournemanagerjoedowley 1 14705 0 0 /news/meridian221119 1 11456 0 0 /news/margeast020917 2 59892 0 0 /news/werestayingupandwerestayingputsaysarelievedstoneschairman 1 16045 0 0 /news/itwasmenagainstboysadmitsbaldacchino-exclusive 1 12562 0 0 /news/othernews/charvdonc210304.html 1 0 0 0 /news/doverathletic0-0woking-itgetstougherandtoughereachyearadmitsretiringhessenthaler 1 26173 0 0 /news/sindensmoveisnotmoneymotivatedinsistsluchford 1 17997 0 0 /news/fcelmshep080119 1 32018 0 0 /news/551bc99dbe7a4/drmartens/eastern/sittingbourne/kentleague/sladegreen/25thjuly03.html 2 15653 0 0 /news/wereaspiringtodobetterthanlastseasonvowsnewsevenoaksboss 1 17566 0 0 /news/bromvstai041103.html 1 0 0 0 /news/lashingsownerpullsoutofstonestakeoverbid 1 14350 0 0 /news/folkestoneinvicta061223 42 213444 2 21 /news/551bc5dcf0c0d 1 15918 0 0 /news/sittingbourne161020 2 28351 0 0 /news/551a956c56c51 3 23098 0 0 /news/baratami310518 3 45111 0 0 /news/551bc99dbe7a4/kentleague/hernebay/drmartens/eastern/ashford/11thaug03.html 2 15653 0 0 /news/551bc5dba624e 3 33558 0 0 /news/551bc99dbe7a4/drmartens/eastern/erith&belvedere/drmartens/eastern/folkestone/8thjuly03.html 2 15653 0 0 /news/ashfordunited251118 3 28143 0 0 /news/beckenhamtown3-3whitstabletown 1 19558 0 0 /hythe-2003-2006 16 190503 3 3 /news/551bc5dccfbbe 1 17614 0 0 /news/tiptreeunited3-2beckenhamtown-beckschiefsruetheirmissedchanceofvaseglory 1 41814 0 0 /news/nationalleague051018 1 13019 0 0 /news/ashfordfansbenefitfromnewsponsorshipdeal 1 12355 0 0 /news/551bc5e726ad0 1 15191 0 0 /news/sladegreensigndartfordquartet 1 16546 0 0 /news/sctjoeford310319 1 11587 0 0 /news/551a95b46dbe7 2 19963 0 0 /archive-2006-2014/283 2 23103 0 0 /news/551bc5de86312 1 12232 0 0 /news/wellingunited0-1doverathletic-werenotquitereadytogetintoplay-offsadmitsday 1 19193 0 0 /news/binkstakespositivesfromspiritedmidweekdisplay-exclusive 1 13420 0 0 /news/pre-seasonfriendlies2009 1 22234 0 0 /news/dorkingwanderers270820 1 11231 0 0 /news/toomanywrongdecisionsweremadeatthestartoftheseasonsaysdaish 1 11776 0 0 /news/preseason2022 6 201867 0 0 /news/tonbridgeangels2-3doverathletic-bothsetsoffansgottheirmoneysworth-nickyforster 1 28289 0 0 /news/fleetforcedtomakebudgetcuts 1 15287 0 0 /news/hernebay0-3charltonathletic-wejustcouldntlivewiththemadmitssimonhalsey 1 22437 0 0 /news/wellingunited131219 1 13103 0 0 /news/holmesdale040617 2 20438 1 1 /news/dulwichhamletcanhurtyouonthebreakwayswarnsfolkestoneinvictabossneilcugley 1 15193 0 0 /news/garydaviesquitsasholmesdaleboss 1 12328 0 0 /news/greenwich080116 1 12828 0 0 /news/favershambosscopleyunveilseightnewsignings 1 14316 0 0 /news/wevegotnothingtoproveinsistsholmesdalecoachrossmitchell 1 19289 0 0 /news/punjab201218 1 12784 0 0 /news/551bc5d9ef9b0 4 32904 0 0 /news/chathamtown1-2folkestoneinvicta-wecouldntrunabathatthemomentbemoansobrien 1 21984 0 0 /news/aveley0-3margate-yorathpleasedwithdefensivequalities 1 15486 0 0 /news/kentleague/greenwich/whitstable141204.html 1 0 0 0 /news/rusthlord261116 2 42398 1 1 /news/551a956c71203 1 3335 0 0 /news/rustcray050919 2 82055 0 0 /archive-2006-2014/207 1 20235 0 0 /news/chathamtownbosspaulfoleyquizzesfaoverconcernsoverplayerssafety 1 14591 0 0 /news/ebbsfleetunited1-6lutontown-itsmyworstresultinfiveyears-andithurtsadmitsdaish 1 24083 0 0 /news/551a97b1dc6b2 1 14260 0 0 /news/551bc99dbe7a4/kentyouth/ryman/bromley/bromvthurrockfac111003.html 2 15653 0 0 /news/cumberbatchsurplustorequirements 2 16512 0 0 /news/10thsept05.html 1 0 0 0 /news/dolbyseeksunbeatenspelltoboostpromotionpush 2 17425 0 0 /news/wellingtown240921 1 12888 0 0 /news/othernews/SECWFL080204.html 1 0 0 0 /news/thanksforyoursupport 1 12717 0 0 /news/551bc5e8dea7d 1 15385 0 0 /news/wevegotaplatformtobuildonsaysthamesmeadtownbosskeithmcmahon 1 13230 0 0 /news/charliesheringhampenstwo-yearcontractwithebbsfleetunited 2 21350 0 0 /news/iwanttomaintainthemomentumwevehadinthelastcoupleofseasons-favershambossrayturner 1 12144 0 0 /news/551a97b25076e 1 13419 0 0 /news/551a97b1ba0bb 1 15133 0 0 /news/burmanbringsnormantoforwardthinkingdarts-exclusiveinterview 1 13347 0 0 /news/hollandsblairfaceobstaclestogetstarmeadowuptoscratchtohostkentleaguefootball 1 22284 0 0 /news/chatfav211116 3 58789 0 0 /news/13jan04.html 1 0 0 0 /news/551a956c6894f 1 6087 0 0 /news/sittingbourne0a0chipstead-pairturndownmoveawayfrombournepark 1 15651 0 0 /news/punjdeal160423 3 71272 0 0 /news/551a956c59fab 1 3414 0 0 /news/resultsnovember2023 8 317633 0 0 /news/whitstablepartybeforetheyconcentrateontheirnewchapter-exclusive 1 11929 0 0 /news/resultsfebruary2020 2 107451 0 0 /news/AshfordRefereesCharityRun240121 2 14748 0 0 /news/rymanpremplayoffs260415 3 36957 0 0 /news/merrychristmaseverybody 1 9748 0 0 /news/hythetown251120 2 23963 0 0 /news/551bc5e8cd5d3 1 16583 0 0 /news/stonesdefenderontrialwithpremierleaguemiddlesbrough-exclusive 1 14245 0 0 /news/itwouldbeniceifthosetwo-and-a-half-thousandfansreturnsaysdoverathleticchairman 1 13415 0 0 /news/favershamtown2-1hollandsblair-luchfordimpressedwithvaliantblair 1 21612 0 0 /news/sittingbourne040522 2 22923 0 0 /news/fleetwoodtown3-0bromley-ithinkwevecomeoffthepitchwithregretadmitsneilsmith 1 25813 0 0 /news/matatasignsforhisthirdkentclub 1 12102 0 0 /news/dockerssparkconfusionoveron-offcuptie 1 12061 0 0 /news/erithandbelvedere180620 1 13370 0 0 /news/longdiggins020615 2 18465 0 0 /news/lewishamborough1-6sevenoakstown-wewasashamblesadmitslewishambosskevinharris 1 31844 0 0 /news/socershorts250521 2 37581 0 0 /news/ashfordtownappointealhamasyouthteammanager 1 11152 0 0 /news/favershamtownunveiltheirnewmanagementteam 1 12855 0 0 /news/phoecor301217 2 55282 0 0 /news/bromvtonb270104.html 1 0 0 0 /news/milesrelishesnewrole-exclusiveinterview 2 20648 0 0 /news/soccershorts180622 2 34815 0 0 /news/welling050805.html 1 0 0 0 /news/fatrophyspecialramsgatetositdownwithbromleytodiscussmaysfuture 1 14634 0 0 /news/craywandererstoreachouttosixmilliontelevisionviewersinthefareast 2 16847 0 0 /news/551a925084716 4 42538 0 0 /news/mycurrentpriorityistofindahomeforcraywandererssayschairmangaryhillman 1 13364 0 0 /news/551bc99d86ce9 2 22184 0 0 /news/ashford260518 3 29657 0 0 /news/greenwichborough2-1harefieldunited-boroughstarhubbardwantsanall-kentwembleyfinal 1 20572 0 0 /news/sevehayw070120 2 36833 0 0 /news/ashfordtown2-1godalmingtown 1 13579 0 0 /news/crayhast130917 3 64641 0 0 /news/seagerpraiseshisplayersversatility 1 12419 0 0 /news/551a956cd23c9 1 4279 0 0 /news/formerdoverbosswalkerunveiledasnewashfordtownmanager 1 14930 0 0 /news/oldbroms260317 1 18082 0 0 /news/werekeepingourfeetonthegroundsayssmissen-exclusive 1 13453 0 0 /news/551bc99dbe7a4/ryman/bromley/kentleague/cray/crayvpaghamfac310803.html 2 15653 0 0 /kent-invicta-league 36 364419 5 8 /news/crayvalley1-4vcdathletic-welookeddevoidofideasadmitsfrustratedtonyrussell 2 43964 0 0 /news/thamesmeadbosskeithmcmahonunveilsdannypennycapture 1 11944 0 0 /news/farngreen090517 2 35993 0 0 /news/551a97b056df2 1 13816 0 0 /news/weneedtostepitupifweregoingtomakeaseriouschallengesaysfisherbossstevefirkins 1 14427 0 0 /news/dartfordhavehighhopesfortheirpaseside-exclusive 1 15287 0 0 /news/jamiedaygivestrialiststhechancetoimpressagainsthernebay 1 11871 0 0 /news/mileswevetakentheclubasfaraswefeltitcouldgoexclusive 1 19608 0 0 /drmartens/eastern/ashford/11thnov03.html 1 9955 0 0 /news/weshoulddefinatelybesittinginthetopfivesayslordswoodbossjasonlillis 1 13047 0 0 /news/margateadmittheyoverspentastheytriedtoreclaimconferenceplace 1 12194 0 0 /news/whitstabletown230921 2 23665 0 0 /news/7thnov04.html 1 0 0 0 /news/fisher0-5vcdathletic-wellpileonthepressureandcarryonwinningsaysraypowell 1 31619 0 0 /news/someonewilltakeahugebeatingfromuswarnsobrien 1 15022 0 0 /news/iamextremelyproudofmyachievementsatlewishamboroughsaysdarrellqueeley 1 12920 0 0 /news/kentclubsandfiveplayerspickupaccoladesatconferenceawardsnight 1 14961 0 0 /news/wingsreleasevines 1 12685 0 0 /news/twelvekentclubsinrymanleaguenextseason 1 13098 0 0 /news/bstortfordreplay150305.html 1 0 0 0 /news/wivenhoetown1chathamtown0 1 13486 0 0 /news/tooting260805.html 1 0 0 0 /news/resultsmarchaprilmay2021 2 59571 0 0 /news/551a931e34343 1 13701 0 0 /news/551a9c0e6828a 2 15098 0 0 /news/vcd311218 2 26838 0 0 /news/tunbridgewellspartcompanywithfarnie-exclusive 1 10407 0 0 /news/stanbads211121 4 100538 0 0 /news/pre-seasonresults2014 3 95855 2 1 /news/sittingbourne3-1whyteleafe 1 12713 0 0 /news/hessunveilshisassistantmanageratdoverathletic 1 11982 0 0 /news/tunwells101205.html 1 0 0 0 /news/sheppeyunited051121 1 14418 0 0 /news/551a9677f1195 2 19393 0 0 /news/551a99e434fe1 1 11825 0 0 /kent-county-league/2 2 22809 0 0 /news/drmartens/eastern/ashford/24thoct03.html 1 0 0 0 /news/thurrock0-1maidstoneunited-ahwanscreamergetsstonesofftowinningstart 1 11902 0 0 /news/551a97b239509 1 12861 0 0 /news/drmartens/eastern/sittingbourne/sittvbanb130304.html 1 0 0 0 /news/11thjuly05.html 1 0 0 0 /news/crayvsandhurstfac130903.html 1 0 0 0 /news/21stoct04.html 1 0 0 0 /news/2ndaug05.html 1 0 0 0 /news/wp-content/plugins/apikey/xo.php 1 0 0 0 /news/craywands190118 3 39271 0 0 /news/favershamtownbossrayturnertiesdownjackharris 1 17206 0 0 /news/dealtown010116 1 12026 0 0 /news/551bc5e498895 1 10933 0 0 /news/551bc99bc0799 2 17409 0 0 /news/werenotinvolvedinarelegationbattleinsistswarrilow 1 17243 0 0 /news/southhern050418 2 59483 0 0 /news/ryman/bromley/16thnov03.html 1 0 0 0 /news/kentleague/erithtown/erithvlords081103.html 1 0 0 0 /news/wevegotamassiveweekendsaysphoenixsportsbossscottsaunders 1 15795 0 0 /news/12thfeb05.html 1 0 0 0 /news/551bc5e1a705e 2 24276 0 0 /news/551bc5e2c2938 1 11685 0 0 /news/dover311016 1 15076 0 0 /news/managersrelishkentleagueopeningday 2 38987 0 0 /news/oboylewantsbesteverseason 1 12131 0 0 /news/crayvalacre190715 2 43686 0 0 /news/matataturnsdownreturntodover 1 10860 0 0 /news/eritashf130823 5 139260 0 0 /news/glebe081223/southern-counties-east-football-league 1 4789 0 0 /news/dartford230920 3 19095 1 1 /news/sittingbournebordenvillage300520 3 30112 1 1 /news/ivefoundaclubwhereicansettledownsaysmuch-travelledstrikerjacoberskine 1 17380 0 0 /news/551a97b1222ca 1 18998 0 0 /news/dartford2-0southendunited-ivegotsomebigdecisionstomakesaysburman 1 31194 0 0 /news/folkestoneinvictachairmanpaystributetoretiringjimmyjackson 1 12667 0 0 /news/ashfordcancelwhybournesigning 1 11310 0 0 /news/ivegotabitofafavaseexpectationtoliveuptosaysvcdathleticbossrickybennett 1 12738 0 0 /news/hessenthalerhailschairmansfreefootballgesture 1 16417 0 0 /news/ramsaddanotherlocalladtotheirsquad 1 12093 0 0 /news/sladegreenlaunchnewwebsite 1 10043 0 0 /archive-2006-2014/225 1 18876 0 0 /news/punjab300819 1 12740 0 0 /womens-football/2 2 27742 0 0 /news/margate110122 2 31117 0 0 /news/kentleague/lordswood/lordvbeng130304.html 1 0 0 0 /news/ithinknowwedowanttoprogressasfaraswecansaysotfordunitedbossjimgillan 1 14248 0 0 /news/wellingunited200119 1 12102 0 0 /news/thelocalsshouldcometowatchoursuperbqualityoffootballsayscraywanderersstarjoevines 1 12252 0 0 /news/thamesmeadtownbosskeithmcmahonhailsashleyprobetssigning 1 12522 0 0 /news/folkestone091117 2 26774 0 0 /news/wereinafantasticpositionbutwehaventreallystartedyetsaidbromleyherodannywaldren 1 13167 0 0 /news/eritgleb041022 4 160790 0 0 /news/gillsatwembleyroycesettobowoutonanall-timehigh 1 14402 0 0 /news/shorts061115 2 53335 0 0 /news/therewillbetroubleifwedontshowpassioninsistslangton 1 19108 0 0 /news/doverathletic280320 1 14236 0 0 /news/holmesdale230916 1 13415 0 0 /news/dartford121115 3 29182 0 0 /news/CEStatement170320 3 43142 0 0 /news/thegapbetweentheinvictaleagueandkentleagueisgettingsmallersaysrusthallspaulmcdonagh 1 13135 0 0 /news/ryman/bromley/stainvbrom090304.html 1 0 0 0 /news/iwantambitiousplayersthatarenotinitforthemoneysaysdoverathleticbosschriskinnear 1 15303 0 0 /news/eritcroy220821 4 114622 0 0 /news/wellingunited150619 1 13269 0 0 /news/tunbridgewellsstrivingtowardsconferencesouthfootball-exclusiveinterviews 1 22341 0 0 /news/iwantaleaderoutonthepitchsaysseager 1 13005 0 0 /news/otfordkenn310318 1 27914 0 0 /news/551a96dbbaa2b 1 6354 0 0 /news/nationwide/gillingham/10thjuly03.html 2 0 0 0 /news/chathamtown2-1craywanderers 1 11889 0 0 /news/iwanttobefiringonallcylinderssaysnewdoverathleticstrikergeorgepurcell 1 13510 0 0 /news/fisherathletic3-1maidstoneunited-friendlyfinishesasanine-a-sidefarce 1 16872 0 0 /news/imconfidentwewillgetbetterandbettersayscrockenhillbosscraigclark 1 12273 0 0 /news/longhurstplaysdownhissideschances 1 15646 0 0 /news/fisher090619 1 12485 0 0 /news/551bc99c93e61 2 23709 0 0 /news/folkestoneinvicta0-1hitchintown-wepayourstrikerstoscoregoals-cugley 1 26493 0 0 /news/fishcori220419 1 33665 0 0 /news/shepcroy050817 1 31140 0 0 /news/ramsgateunveilsamgoresigning 1 12179 0 0 /news/binkswantsmaxiumumpointsbeforetrophytriptoharrow 1 14408 0 0 /news/matchreportswaitfinallyendsforstroutsandluchford 1 20371 0 0 /news/meridian231218 1 11556 0 0 /news/defendermattturnsdownbourne-exclusive 1 14609 0 0 /news/milesdelvesintotransfermarket 1 10728 0 0 /news/551a97b27e5e2 1 16531 0 0 /news/551a925074b83 1 3177 0 0 /news/wevegottobeupforthebattlesayslane 1 13756 0 0 /news/kentleague/sladegreen/sladevhyth130304.html 1 0 0 0 /news/kentleague/cray/13jan04.html 1 0 0 0 /news/NationalLeague240920 2 14941 0 0 /news/551a95b373843 2 18964 0 0 /news/corishep060419 1 37248 0 0 /news/fisher1-2millwall-werenotgoingtochangeourstyleofplaysaysfisherbossstevefirkins 1 20292 0 0 /news/cash-strappedabbottfacesfighttokeepreevesatbournepark 1 19488 0 0 /news/awards250417 3 20111 1 1 /news/551bc5e71b4a6 1 16543 0 0 /news/soccershorts210621 2 45991 0 0 /news/kentleague/sladegreen/lordswood021004.html 1 0 0 0 /news/sloughdart011016 1 31140 0 0 /news/wevegotplayerswhocanperformonthebigstagesayswarrilow 1 15611 0 0 /news/bromtorq120917 1 30185 0 0 /news/ineedbigbuckstobringin20-goalstrikersayshuntley 1 15292 0 0 /news/fleetmanagerlefttoruedefeat 2 14376 0 0 /news/imreallypleasedwiththewaythingsaregoingsaystonbridgeangelsbosstommywarrilow 1 18935 0 0 /news/551bc5ddb38bf 1 15366 0 0 /news/tonbridge021015 3 30454 0 0 /news/chelmsfordclashwillshowuswherewestandsaysmartinhayes 1 14366 0 0 /news/soccershortsmargateconfirmbromleybidforhockton 1 20408 0 0 /news/sittvstam280204.html 1 0 0 0 /news/corinhors080918 1 32001 0 0 /news/bromley070615 3 23289 0 0 /news/belvedere060420 2 14320 0 0 /news/pennockdelightedwithtriplesigning 1 12319 0 0 /news/waltoncasuals1-2maidstoneunited-thestonesaregoingup 1 18781 0 0 /news/thefestiveprogramme 1 16984 0 0 /news/wemustgetchelmsfordoutofoursystemsaystrott-exclusive 1 18938 0 0 /news/soccershortsgledhillaimstoarrestinvictasslide 1 27551 0 0 /news/bromley040318 1 17460 0 0 /news/matchreports 1 34685 0 0 /news/folkestoneinvictabossneilcugleywantstheedgeoverhisstrugglingrivals 1 25624 0 0 /news/lovelladdsallmantohissquad 1 10794 0 0 /news/hampdart051119 2 42423 1 1 /news/kspolord060219 1 24972 0 0 /news/sheppeyunited191121 1 13659 0 0 /news/cablebrothersarestayingputinsistsmcmahon 1 11773 0 0 /news/lordswood260118 1 12562 0 0 /news/kentleague/whitstable/27thoct04.html 1 0 0 0 /news/vcd080818 2 28031 0 0 /news/551a931e3696a 3 28448 0 0 /news/soccershortsweunderstandhoggacceptingashfordsoffer-sittingbourne 1 23464 0 0 /news/croydon280721 1 12200 0 0 /news/deresdropfivepointsoverholidayprogramme 1 26039 0 0 /news/551a979961deb 1 4908 0 0 /news/othernews/30thjune03.html 2 0 0 0 /news/551bc99dbe7a4/kentleague/lordswood/kentleague/tunbridgewells/17thjuly03.html 2 15653 0 0 /news/foleyspatienceisrewardedasbartonfinallysigns 1 13417 0 0 /news/bromsutt010119 2 40150 0 0 /news/551a97991cb1b 1 5668 0 0 /news/hernhayw260422 5 193020 0 0 /news/ashfordtown1-4fleettown-lovelltakespositivesfromfleetfootballlesson 1 29387 0 0 /news/bromley300519 3 18785 1 1 /news/holmesdale020118 1 11940 0 0 /news/551bc99b4e121 2 22875 0 0 /news/phoefave121119 3 76004 0 0 /news/wesfoderinghamisatopmanandanexcellentyoungprofessionalsayshaydenbird 1 16286 0 0 /news/oldbrom211217 1 12191 0 0 /news/expectationsarentashighastheywereinthepastsayscash-strappedianjenkins 1 18551 0 0 /news/healthmatters070915 2 28640 0 0 /news/551a9c9176d01 2 16340 0 0 /news/favershamtown120822 2 29283 0 0 /news/itstimetomoveonsaysdoverdirectorknight 1 17204 0 0 /news/31stoct04.html 1 0 0 0 /news/lyddtown020416 1 13689 0 0 /news/drmartens/eastern/folkestone/10thjuly03.html 1 0 0 0 /news/18thapr04.html 1 0 0 0 /news/dealvlord230304.html 1 0 0 0 /news/ourproblemsarebeingresolvedrevealsupbeatcugley 1 15952 0 0 /news/werenotsplashingthecashanymoresaysburnettt-exclusive 1 14696 0 0 /news/playersattitudeissecondtononesayslangton 1 15297 0 0 /news/thelocalcommunitywantthewandstocomehomeinsistscraychairmanhillman 1 24270 0 0 /news/551a931eb4d02 2 28506 0 0 /news/margate011017 2 26215 0 0 /news/corinthian260222 3 32037 0 0 /news/resultsaugust2018 2 76771 0 0 /news/wp-includes/dropdown.php 1 0 0 0 /news/ournewstrikerwillcauseproblemsinsistsdaish 1 11361 0 0 /news/whithyth280423 10 139710 2 3 /news/wecantgiveupwecangetourselvesoutofdropzoneinsistspinnock 1 15256 0 0 /archive-2006-2014/37 2 25589 0 0 /news/iwanttorepaythefaithshowninmebymakingderessuccessfulsayscollins 1 18005 0 0 /news/551bc99b51b02 2 16591 0 0 /news/heathaimsforthreeoutofthree-exclusiveinterviews 2 24638 0 0 /news/holmesdaleunveildanmorrisastheirnewmanager 1 13196 0 0 /news/wehavetomakesurewestayinthisleaguesaysblade 1 22021 0 0 /news/porter30takesthereignsatreachfields 1 15070 0 0 /news/ryman/bromley/8thoct04.html 1 0 0 0 /news/dartfordstrikerpoisedtosignfornorwich 1 11946 0 0 /news/backingkenttowembleyvickersprepareforvaseshowdown-exclusive 1 16404 0 0 /news/daviespleasedwithlifeatlingfield 1 16449 0 0 /news/beckenhamtown2-1carterton-beckenhamstartdreamingaboutadayoutatwembley 1 37880 0 0 /news/billericaytownfc.co.uk. 1 0 0 0 /news/bromleyneilsmith130518 1 19327 0 0 /news/illjustbelookingtoprogresstheclubfurtherforwardsaysmillersbosspaulgross 1 16335 0 0 /news/itsreallygoodtoseegreenwichborobacktowheretheyshouldbesaysrivalbosstonyrussell 1 14754 0 0 /news/heinekenbuy-outforcesbulmerscidertopulloutofkentleaguesponsorship 1 12015 0 0 /news/ididnotswearattherefinsistshume 1 16151 0 0 /news/551bc5dbb1167 3 30832 0 0 /news/westaucklandtown2-1hernebay-imdisappointedthatwerenotgoingtoplayatwembley-halsey 2 52525 0 0 /news/iknowitwillbereallytough-italwaysisatramsgatesayssittingbournebossnickdavis 1 17151 0 0 /news/stansfeld270722 1 13429 0 0 /news/canterburycity201219 1 12279 0 0 /news/juniordian080715 3 43048 0 0 /news/february2008resultsfixtures 1 23917 0 0 /news/hessenthalerhastrioinjuredforopeningtest 1 11131 0 0 /news/greenwichborough1-0redhill-wereputtingtheclubonthemapsayspaulblade 1 25284 0 0 /news/fisher290116 1 12195 0 0 /news/17thmay04.html 1 0 0 0 /news/stepup010717 2 31802 0 0 /news/551bc99dbe7a4/nationwide/gillingham/drmartens/eastern/sittingbourne/hastvsitt201203.html 2 15653 0 0 /news/kingstonian201205.html 1 0 0 0 /news/dealtown100217 1 13769 0 0 /news/fishmill170718 1 25760 0 0 /news/margatevaldershot120803.html 1 0 0 0 /news/3rdfeb04.html 1 0 0 0 /news/drmartens/premier/dover/leyton301104.html 1 0 0 0 /southern-counties-east-football-league/48 1 20203 0 0 /news/551bc99dbe7a4/conference/margate/kentleague/sladegreen/3rdsept03.html 2 15653 0 0 /news/hythe19102015 2 23784 0 0 /news/hopefullywecanmakealittlebitmorehistorysayswhitstabletownbossnickysouthall 1 20113 0 0 /news/soccershortsjonesrueselliottsdeparturetoredhill 1 31241 0 0 /news/sittmers281017 2 61329 0 0 /news/wealdart030819 2 39435 1 1 /news/wewontgiveuptryingtocatchwokinginsisthighflyingkentrivals 1 14783 0 0 /news/551bc5deba18d 1 13265 0 0 /news/kentfootballunited161118 1 15162 0 0 /news/folkestonechairmanweneedmorefundsforstrongerleague 1 15935 0 0 /news/drmartens/premier/dover/18thjuly03.html 1 0 0 0 /news/kentleague/sevenoaks/26thsept04.html 1 0 0 0 /news/hernebay220620 2 25379 0 0 /news/balldeparturemarksendofaneraadmitsward 1 15487 0 0 /news/chipstead190616 1 13217 0 0 /news/sittingbourne110920 2 32185 0 0 /news/aldershottown010121 2 14564 0 0 /news/formereaglenathanielpinneydropsinattonbridgeangels 1 13617 0 0 /news/28thoct03.html 1 0 0 0 /news/wp-content/admin.php 1 0 0 0 /news/werepunchingaboveourweightadmitsfleetskimble-exclusiveinterview 1 14226 0 0 /news/doverathletic050123 2 16573 0 0 /news/horshdeal310815 1 30024 0 0 /news/551bc99dbe7a4/kentleague/hernebay/drmartens/eastern/chatham/11thaug03.html 2 15653 0 0 /news/weresittinginanicepositionsaysdoverbossmartinhayes 1 17384 0 0 /news/551a931dc66b8 1 13224 0 0 /news/3x.php 1 0 0 0 /isthmian-league/52 3 43634 0 0 /news/wevegotverylittletoloseagainsthungerfordtownsaysfolkestoneinvictabossneilcugley 1 13538 0 0 /news/drmartens/eastern/erith&belvedere/10thsept04.html 1 0 0 0 /news/frustratedmilescallsformoreconsistency-exclusiveinterview 1 15792 0 0 /news/551a9cf4d10f1 2 22688 0 0 /news/shorts290515 2 19134 0 0 /news/freefootballsaturdaywasasuccesssaysdelightedbournechairman 1 17869 0 0 /news/KentCountyLeagueStatement311220 2 16428 0 0 /news/drmartens/eastern/sittingbourne/dartvsitt160304.html 1 0 0 0 /news/wewillprovethebookieswronginsistsobrien 1 19277 0 0 /news/afchornchurch1-2maidstoneunited-kidsemergencehasgivenmefoodforthoughtadmitshume 1 20383 0 0 /news/wewillhelpplayersachievetheirfullpotentialsaysfavershamstrikeforcemanagergaryaxford 1 14486 0 0 /news/cugleypraiseshisyoungfabbackfour 1 20270 0 0 /news/551bc5e475001 1 11915 0 0 /news/wehavetobeatourbesttogetresultssayscraywanderersbossianjenkins 1 16755 0 0 /news/margate221217 1 13992 0 0 /news/wehavetomakeadentinourneighboursaspirationssaysramsgatebossjimward 1 12076 0 0 /news/crayhorn151023 5 95235 0 0 /news/wehavenothitformyetandthereismoretocomesaysdoverathleticbossnickyforster 1 15734 0 0 /news/wewanttostayinthefatrophyforaslongaspossiblesaystonbridgeangelsbosstommywarrilow 1 13064 0 0 /archive-2006-2014/51 1 20537 0 0 /news/thamesmead041215 2 24755 0 0 /news/rymanpreviewsburmandoesnotwantcasualattitude 1 16452 0 0 /news/551bc5e2ddc5f 1 14165 0 0 /news/croydonathleticsplayerswanttoputoneovermeadmitscraybossianjenkins 1 19197 0 0 /news/wellingunited2-0eastthurrockunited-icantgetmyheadaroundbeingsoflat-ford 1 22673 0 0 /news/brisbrom101119 2 38739 0 0 /news/15thaug04.html 2 0 0 0 /news/wevejustbrokenrecordafterrecordthisyearforcertainthingssayslordswoodbossjasonlillis 1 14985 0 0 /news/551bc99dbe7a4/drmartens/premier/dover/kentleague/sladegreen/chessingtonvsladefr260703.html 2 15653 0 0 /news/dealtownhasagreathistoryandiamproudtobemanagersaysalbiebarker 2 26177 0 0 /news/dartford1-1harlowtown-maysreturnisabigbonusforussaysburman 1 15451 0 0 /news/crayvsevenoaks200903.html 1 0 0 0 /news/theleagueisourpriorityinssistswhitstablebosspeternott 1 15657 0 0 /news/kentleague/hythe/8thaug04.html 1 0 0 0 /news/sittingbourne1-0horshamymca-hichamakhazzangotusoutofjailadmitsgaryabbott 1 24082 0 0 /news/vickershavesetthebenchmarksayswellsbossrobbins 1 14287 0 0 /news/repeater.php 2 0 0 0 /news/folkestoneheadtoleytonatfullstrength 1 19134 0 0 /news/551a9c0e5db24 2 17907 0 0 /news/stonessearchforfreshmanagerialblood 1 13412 0 0 /archive-2006-2014/180 1 19311 0 0 /news/ryman/bromley/dulwichvbromu18210304.html 1 0 0 0 /news/551a9c0e32df0 2 14911 0 0 /news/margatebossoconnelltargetssigere 1 17082 0 0 /news/angelsvisittoswanshangsinthebalance 1 13290 0 0 /news/ramsgate031120 5 68250 0 0 /news/wingsarrangefourmidweekgamesatneighbouringclubs 1 10730 0 0 /news/greendeal160415 1 30569 0 0 /news/551a97b0a7c27 1 11642 0 0 /news/wewontstandincableswaysaysmcmahon-exclusive 1 13954 0 0 /news/551bc5dfaef19 1 10952 0 0 /news/payingoverduetaxbillhastakentheweightofmyplayersshoulderssaysjamieday 1 28017 0 0 /news/thefacupsecondqualifyingrounddraw 1 14817 0 0 /news/saturdaysfacuptieatdartfordisamassivedayforbromleyfootballclubsaysmarkgoldberg 1 14305 0 0 /news/waltonford010420 1 10963 0 0 /news/ournewstrikepartnershipwereexcellenttogethersaysmargatebossiainoconnell 1 16051 0 0 /news/wehaventachievedanythingyetsaysbromleybossmarkgoldberg 1 14700 0 0 /news/phoenixsports241123 6 64286 1 0 /news/551a97b167754 1 16601 0 0 /news/wellingunited1-2lutontown-improudoftheboyssayswingsbossjamieday 1 20163 0 0 /news/551bc99dbe7a4/drmartens/eastern/tonbridge/kentleague/thamesmead/10thoct03.html 2 15653 0 0 /news/20thJan04.html 1 0 0 0 /news/iwantanothercrackplayingrymanleaguefootballsaysnorthwood-exclusiveinterview 1 13801 0 0 /news/soccershorts290519 2 31727 0 0 /news/ebbsfleetunited1-1kidderminsterharriers-daishtakeshispoint 1 18924 0 0 /news/551bc5e668789 1 16498 0 0 /news/sittingbourne0-0horshamymca-itwasafrustratinggameforusadmitsabbott 1 29638 0 0 /news/551a96dbac679 2 14348 0 0 /news/551a9c0ec2981 4 37852 1 1 /news/maidstoneunited4-2godalmingtown-weveshowngoodcharactertocomebacksayssaunders 1 20890 0 0 /news/ramsgateextendscoachingtoyoungerladies 1 11581 0 0 /news/hopefullynextseasonwellbeplayingbackatidehillsaysmanagerkeithmcginn 1 18020 0 0 /news/refereeshavetoearnrespectfumescugley 1 20475 0 0 /news/551a9c933f5e3 3 34981 0 0 /news/27thnov04.html 1 0 0 0 /news/551a9c0edbed9 4 59714 1 0 /news/hastingsunited101121 3 31578 0 0 /news/welooktogofurtherinthefavasethisyearvowsbeckenhambossjasonhuntley 1 15424 0 0 /news/strikerboostforgillsaheadofvillaclash 1 12698 0 0 /news/resultsfebruary2012 1 43294 0 0 /news/551bc99dbe7a4/kentleague/erithtown/kentleague/lordswood/lordvdeal191103.html 2 15653 0 0 /news/itstimetoendourblipsaysdoverathleticbossnickyforster 1 13759 0 0 /news/charltonathletic280823 2 14821 1 1 /news/sittvsali240404.html 1 0 0 0 /news/stansbradley080515 1 13939 0 0 /news/wp-content/plugins/seoo/wsoyanz.php 1 0 0 0 /news/pre-seasonresults2011 1 29913 0 0 /news/sittingbourne2-3whitstabletown-seagerproudofhisplayersaswhitstablestayup 1 15908 0 0 /news/551bc5e45d045 1 12191 0 0 /news/folkestonechairmanslamssaundersexit 1 16790 0 0 /news/551bc99dbe7a4/drmartens/eastern/folkestone/ryman/bromley/bromvdulw261203.html 2 15653 0 0 /news/wehaventgotthemoneytosignprovengoalscorerbemoansgibbons 1 12669 0 0 /news/yorathstransfertargetstrainwithmargate 1 15719 0 0 /news/551bc5e670a85 1 11192 0 0 /news/drmartens/eastern/folkestone/26thjune03.html 1 0 0 0 /news/ryman/bromley/thamesmead310704.html 1 0 0 0 /news/leatherheadweremyfavouritesbeforetheseasonstartedsaysfolkestoneinvictabossneilcugley 1 18814 0 0 /news/winningateastleighhastobeourturningpointsaysdartsbosstonyburman 1 18650 0 0 /news/folkestoneinvicta2-0corinthian-casuals-awinningfarewellfromdepartingstarnames 1 16488 0 0 /news/551bc5de8ee1e 1 11975 0 0 /news/glebe260720 1 11596 0 0 /news/ramsgate290915 2 25948 0 0 /news/wellhavetoseewhatthebudgetiandwhowebringinsayswellingunitedbossjamieday 1 14724 0 0 /news/sportkent220819 2 44983 0 0 /news/shockwineaseschathamsrelegationfears-exclusiveinterview 1 17192 0 0 /news/ryman/bromley/bromvslou100204A.html 1 0 0 0 /news/dartfordfancustardaimstoimpress-exclusive 1 15605 0 0 /news/thefleetatwembleyfeelthefleetprideandpassion-letsbringthattrophybackhometokent 1 10778 0 0 /news/tunbridgewells1-0vcdathletic-cableshocksthetitlefavourites 1 20120 0 0 /archive-2006-2014/221 1 19273 0 0 /news/sheppeyunited180522 2 25413 0 0 /news/26thsept04.html 1 0 0 0 /news/suttonath030617 1 11788 0 0 /news/margate070617 2 23586 0 0 /news/weremeetingthedeadlinethekentinvictaleaguehaveimposedonallclubssayslewishamchairman 1 17259 0 0 /news/551bc5dc71e10 3 40534 0 0 /news/dealtown041223 42 224849 3 22 /news/dolbyquashesstrikerspeculation 1 12356 0 0 /news/551a931db1c0d 1 13309 0 0 /news/boroughimprovetheirpublicrelations-exclusive 2 16517 0 0 /news/wellchar280317 1 33619 0 0 /news/phoechat310718 2 72016 0 0 /news/ifancyusagainstgreenwichboroughsayskeithlevett 1 20587 0 0 /news/chathamtown0-1worthing-iwantsomethingtoplayforsaysobrien 1 23305 0 0 /news/theroadtowembleywevegottostartwinningathomesayscugley-exclusive 1 13244 0 0 /news/a57bze8931.php 1 0 0 0 /news/551bc5e859e13 1 12230 0 0 /news/folkestone290805.html 1 0 0 0 /southern-counties-east-football-league/15 1 19791 0 0 /news/551bc5de5e7b2 1 11748 0 0 /news/phoenix270818 3 32096 0 0 /archive-2006-2014/292 2 21937 0 0 /news/erithbelvedere1whitstabletown0 1 12850 0 0 /news/551bc5e8859aa 1 13084 0 0 /news/letsgetintothoseplay-offsurgespennock-exclusiveinterview 1 22524 0 0 /news/551a97b227531 1 17045 0 0 /news/stoneswelcomemanagerlessfishforfacupclash 1 12584 0 0 /news/kentleague/lordswood/lordswood.html 1 0 0 0 /news/kentleague/lordswood/lordsvgreen280204.html 1 0 0 0 /news/garethsouthgate200320 2 27241 0 0 /news/ashbyaddstomargatesnew-looksquad 1 13740 0 0 /news/brentwoodtown2-2dartford-werereadyforsuffolkshowdowninsistsburman 1 16539 0 0 /news/onourdaywerecapableofwinningagainstanyteaminourleaguesaysbromleybossmarkgoldberg 2 19452 0 0 /news/lordswood141223 53 221423 2 31 /news/wehavetheplayerstoclimbthetableinsistsfrustratedbinks 1 14247 0 0 /news/wehavetoworkwithwhatwevegotsayscorinthianbosstonysitford 1 13865 0 0 /news/folkestoneapplyforpromotion 1 14569 0 0 /news/drmartens/eastern/folkestone/folkvash261203.html 1 0 0 0 /news/ramsreportbackfitandraringtogo 1 13877 0 0 /news/551bc99dbe7a4/kentleague/greenwich/drmartens/1stnov03.html 2 15653 0 0 /news/551a9718ce5b2 3 24437 0 0 /news/551a9cf532c51 3 43991 0 0 /news/standardofkentyoungstersisexcellentinsistscoach 1 13917 0 0 /kentcounty-2003-2006 16 152261 2 4 /news/dartfordunveildriveforadrivegolfday 2 14720 0 0 /news/bridcori201119 2 35964 0 0 /news/matchreportshythetownrompto8-1victoryoversorryderes 1 28029 0 0 /news/hytheheroesdontwalkoffthepitchwithanyregretssaysscottporter 1 22635 0 0 /news/beaconsfield181204.html 1 0 0 0 /news/drmartens/eastern/ashford/8thoct04.html 1 0 0 0 /news/ithinkoursisalittlebitofafalsepositionadmitsfolkestoneinvictabossneilcugley 1 16194 0 0 /news/werespectpeopleinourleaguebuttheresnotmanywefearsaysbarryashby 1 15437 0 0 /news/whytvbrom060104A.html 1 0 0 0 /advertising-rates 26 174982 6 7 /news/ithinktheyvedoneusallveryveryproudsayswhitstabletownchairmangaryjohnson 1 18506 0 0 /news/arnoldsagarumbleson 1 15754 0 0 /news/ivegotatoughawaygametostartoffwithsaysreturningsittingbournebossnickdavis 1 14141 0 0 /news/tunwells210616 2 23713 0 0 /news/551a9250709bc 3 33736 0 0 /news/hessenthalerpensnewdoverdeal 1 11810 0 0 /news/551a931e6a4ad 1 13041 0 0 /news/3rdaug05.html 1 0 0 0 /news/551a956c18dcc 1 3605 0 0 /news/drmartens/eastern/tonbridge/2ndsept04.html 1 0 0 0 /news/lewishamborough1-2sevenacresidcup-thishasbeenmymostfrustratingtime-osullivan 1 28155 0 0 /news/favks060416 2 55696 0 0 /news/gloubrom201018 1 30388 0 0 /news/newunder21leagueinthepipeline 1 11897 0 0 /news/ifweregoingtostayaroundtheplay-offswehavetolooktodoreasonablywellthismonth-day 1 22788 0 0 /news/thepressureisoffusatthemomentsaysluchford 1 17067 0 0 /news/othernews/7thjuly03.html 1 0 0 0 /news/aldertonwillhavetofightforhisplaceinsistsabbott 1 16583 0 0 /news/551bc5db6ce4e 2 14717 0 0 /news/hythetown1-2whitstabletownaet 1 12670 0 0 /news/craywands010518 3 37666 0 0 /news/fisher040621 1 12659 0 0 /news/fisher030717 1 13533 0 0 /news/551bc99dbe7a4/drmartens/eastern/ashford/drmartens/eastern/folkestone/bashvfolk081103.html 2 15653 0 0 /news/drmartens/eastern/dartford/9thoct03.html 1 0 0 0 /news/sevecori191022 5 187775 0 0 /news/cugleyrealisticabouttrophyprogress 1 15377 0 0 /news/wellingcorne051215 1 13388 0 0 /news/cupdraws2007-2008 1 16647 0 0 /news/551bc99a6c794 2 19071 0 0 /news/bromley300916 2 21842 0 0 /news/facupsecondrounddrawdoverathleticpullhomedrawagainstbeesorshots 1 16268 0 0 /news/suttonathletic220517 2 15613 1 1 /news/whyteleafesnew3gpitchfailsitsfirsttestduetodrainagesystemfailure 1 14474 0 0 /news/cantcray270419 2 44145 0 0 /news/whitstabletownappointgaryjohnsonastheirnewchairman 1 13771 0 0 /news/551bc5e0337d7 2 28307 0 0 /news/551bc99dbe7a4/ryman/bromley/othernews/24thjuly03.html 2 15653 0 0 /news/itsbeenaremarkableseasonsaysjones 1 17786 0 0 /news/greenwich050108 2 36137 0 0 /news/itsnicethattheladscanmatchthemselvesagainstleagueplayerssayswellingcoachdeanfrost 1 16348 0 0 /news/sittveastthurrockfac270903.html 1 0 0 0 /news/settledstrikeradmitshesenoyinghisfootballagain 2 24310 1 1 /news/hawkingeotford181019 1 12864 0 0 /news/afccroydonathletic290721 1 13757 0 0 /news/dealtown190218 1 12339 0 0 /news/theresnopressureonusbecausenobodygivesusachancesaysnickysouthall 1 13527 0 0 /news/551a92502fb7c 2 17288 0 0 /news/seagerreflectsonahistoricyearforwhitstabletown 1 16587 0 0 /news/551a979999e1f 1 5669 0 0 /news/dulwichhamlet3-1doverathleticwhitewecanhandlethepressuretofinishtop 1 19470 0 0 /news/551a956cd4f7b 1 4768 0 0 /news/lingdeal021223/contact 1 13054 0 0 /news/enfield191105.html 1 0 0 0 /news/afccroydonathletic310820 1 12196 0 0 /news/sladevcray100204.html 1 0 0 0 /news/dolbyrelishingdonstrophytussle-exclusiveinterview 1 12022 0 0 /news/bromalde281117 1 27336 0 0 /news/wardlooksforimprovement 1 15682 0 0 /news/eritroch100215 1 31439 0 0 /news/resultsaugust-september2014 1 76259 0 0 /news/doverathleticstrikeradambirchallcolllectstheplauditsforhisgoalscoringtalents 1 13022 0 0 /news/551bc5e28b620 1 13763 0 0 /news/ivetoldthechairmanthatwerenotreadytogetpromotedsayssittingbournebossdannyward 1 14514 0 0 /news/GWR051105.html 1 0 0 0 /news/staproch061021 1 35409 0 0 /news/wewantaruninthecupsayshernebaybosssamdenly 1 15015 0 0 /news/itstimeformyplayerstoshineandgrabthatbitofglorysaysmartinlarkin 1 19157 0 0 /news/lordsvbeckfavase200903.html 2 0 0 0 /news/cray090405.html 1 0 0 0 /news/crayvalley011119 3 29421 0 0 /news/whitstablechairmanoutlinesfive-yearplanasbelmontpassesgroundgrading 1 13072 0 0 /news/doversigntheirknightinshiningarmour 1 15713 0 0 /news/crayvdeal200304.html 1 0 0 0 /news/beckenham141019 1 13380 0 0 /news/sitthern150422 2 70115 0 0 /news/kentleague/maidstone/23thjan04.html 1 0 0 0 /news/litttunb010919 2 40454 1 1 /news/ivebeeninfootballalongtimeandiveneverseenaleaguewonorlostongoalssayshalsey 1 19815 0 0 /news/551a97b07f399 2 30722 0 0 /news/551a9cf578dfc 3 33389 0 0 /news/ashfordtown1-3tonbridgeangels-martindemandsacontractaftertwogoalssendsangelsthrough 1 16553 0 0 /news/theideaistoalwaysimprovesayschathamtownbosskevinwatson 1 13286 0 0 /news/tunbridgewells211218 1 12578 0 0 /news/bromley301019 2 22149 0 0 /news/maidstone110918 1 13500 0 0 /news/folkhythe241016 2 23521 0 0 /news/wemustavoidwoodenspoondemandsashfordchiefexecutive 1 11909 0 0 /news/soccershortsburmanshowsthedoortosixtitlewinningplayers 1 20621 0 0 /news/tonbridgeangels1-0folkestoneinvicta-wecouldhavemadelifeeasiersaystommywarrilow 1 26392 0 0 /news/foleyturningchathamgreenandwhite 1 17123 0 0 /news/hythrayn230822 5 176040 0 0 /news/invictastarssignonthedottedline 1 12603 0 0 /news/551a9678e9b23 3 49849 0 0 /news/hythe290116 2 26755 0 0 /news/werestilltryingtofindtheperfectformulasaysdoverathleticbosschriskinnear 1 13352 0 0 /news/lordswood150616 1 12617 0 0 /news/soccershortsjoetaylorleavessittingbournetosignforfarnborough 1 16909 0 0 /news/ryman/bromley/Bromvhors100104.html 1 0 0 0 /news/ashford081217 2 17750 0 0 /news/soccershortsashfordtownbossstevelovellshowshisloyaltytocrisistornclub 1 40928 0 0 /news/foresthillpark201218 1 12998 0 0 /news/paperboysreturnhome 1 11440 0 0 /news/punjab050718 1 12250 0 0 /news/keithmcmahonkeepselevenofhismeadfamilytogether 1 13133 0 0 /news/lordsvrams310304.html 2 0 0 0 /news/dartscontinueperfectseasonontheroaddespitewanderersfightback 1 20605 0 0 /news/erithtownbosstonyrussellbeginstorebuildhiscoachingstaff 1 15116 0 0 /news/tonbridge021115 2 26202 0 0 /news/itsdowntotheplayerstomakesurewefinishoffthejobsaystonybeckingham 1 13802 0 0 /news/551a9677a6096 2 19774 0 0 /news/tonbridgeistherightmoveforgeorgepurcellsaystommywarrilow 1 14609 0 0 /news/charltonathletic050121 1 12366 0 0 /news/bromley020221 2 15226 0 0 /news/wecriedwhenwemissedoutonawembleyfinalrecallsbeatensemi-finalisttommywarrilow 1 13827 0 0 /news/551a92503885c 2 18789 0 0 /news/craydulw200417 3 81561 0 0 /news/glebecant180715 1 35595 0 0 /kent-invicta-league/3 3 43154 0 0 /news/.well-known/pki-validation/ssl.php 1 0 0 0 /news/551bc99dbe7a4/othernews/drmartens/premier/dover/22nddec03.html 2 15653 0 0 /news/knaptwells211115 1 26522 0 0 /news/favaseqfpreviewA.html 1 0 0 0 /news/fazakerleyjob220415 1 13570 0 0 /news/craywands160716 4 42390 1 0 /news/rickybennettcharity300317 2 23378 0 0 //www.greywoodworks.c 1 3711 0 0 /news/meridianunveilricharddimmockasjoint-manager 2 17140 0 0 /news/harewecanhandleexpectationlevels-exclusive 1 18229 0 0 /news/itsexcitingtimesatmargatesaysskipperandacademycoachjamiestuart 1 17749 0 0 /news/551a9250b45ed 1 4111 0 0 /news/statattackaverageattendancefigures 1 11866 0 0 /news/tradtionalboxingdayfixturewillattractmoresupportsayswhitstabletownchairmangaryjohnson 1 13177 0 0 /news/suttbeck201115 1 33972 0 0 /news/wevegottocompeteandfindawayofclosingthegapbetweenusandtheprossayspaulsawyer 1 16655 0 0 /news/drmartens/eastern/ashford/28thoct04.html 1 0 0 0 /news/kentcounty/16thsept03.html 2 0 0 0 /news/injurycrisisforceshumeshand 1 15979 0 0 /news/wp-admin/wp-22.php 1 0 0 0 /news/wejusthavetotryandwingamesaswevegotnocontroloverleaderswellingsayschriskinnear 1 16217 0 0 /news/greendart080316 1 27887 0 0 /news/lackofmoneyisholdingseagerbackintransfermarket-exclusive 1 14021 0 0 /news/doverathleticunveiledharriscapture 1 10862 0 0 /news/carshaltonathletic1-1folkestoneinvicta 1 15255 0 0 /archive-2006-2014/160 1 18876 0 0 /news/bromwrex300318 1 29653 0 0 /news/2ndapr04.html 1 0 0 0 /news/hessenthalermyteamwontsufferfromawinterhibernation 1 15571 0 0 /news/thelightsareonatholmesdale 1 17208 0 0 /news/bromvmetr151103.html 1 0 0 0 /news/itsimportantthatwekeepastablebasetocompetesuccessfullysayshernebaybosssamdenly 1 13706 0 0 /news/wingmarg210120 2 64908 0 0 /news/551a9250d46d2 1 3106 0 0 /news/ramsgate150818 2 23479 0 0 /news/rusthallfc.com 1 0 0 0 /news/tonbridgeangels0-4crawleytown-weneededthegameonbecauseweneededtherevenue-warrilow 1 23088 0 0 /news/tonbridgeangels1-5gravesendnorthfleet 1 16416 0 0 /news/myobjectivesistoimproveonwhatwedidlastyearsayslisney 1 15234 0 0 /news/wecangotocroydonandbeatthemsaysmargatebossoconnell 1 17925 0 0 /archive-2006-2014/270 2 23816 0 0 /news/whitstabletownunveilantbodlesigning 1 12601 0 0 /news/doverathleticsignchelseaaceonloan 1 13673 0 0 /news/551bc99ac5ca4 2 29435 0 0 /news/rusthall240818 1 13429 0 0 /news/dartford1-0maidstoneunited-theclockistickingforbidsformcdonaldsaysburman 1 20965 0 0 /news/chathamtownnamejonathanpearceascommunityschemepatron 1 15589 0 0 /news/phoenix230916 2 23507 0 0 /news/551bc99a67dd3 1 12213 1 0 /news/551a99e5487b3 1 16255 0 0 /ashford-2003-2006/3 2 17704 0 0 /news/werereadyforpromotion-burman 1 17375 0 0 /news/sittvcorb070204.html 1 0 0 0 /news/roystonsignsforcraywanderers-exclusive 1 10108 0 0 /news/thesekidsarethefutureofourclubsayscugley 1 18036 0 0 /news/SCEFL090421 5 61117 1 0 /news/stonesunveilthesigningofsimonglover 1 14586 0 0 /news/hessenthalercallstimeatgills 1 11952 0 0 /news/itsabigseasonforuswiththelightsgoingupwithintwoweekssaysblairbosspaulpiggott 1 13918 0 0 /news/bromley310717 1 17376 0 0 /news/wevewaitedalongtimeforthisfacuptiesayscrayvalleybossstevechapman 1 12771 0 0 /news/whitvtham251003.html 1 0 0 0 /news/folkestone100517 2 23633 0 0 /news/gravesendnorthfleet1herefordunited2-daishwemusthandlethepressure 1 15668 0 0 /news/ryemakeappealtofindstand-ingoalkeeper 1 11206 0 0 /news/dovercalltheshotsitsjustoneofthosefantasticdaysandyourejustgladtobeapartofit 1 25726 0 0 /news/kentleague/hythe/hythe.html 1 0 0 0 /news/itsbeenaverychallengingtransitionperiodsayscraywanderersbosskeithbird 1 15155 0 0 /news/nortonsports1-2hernebay-itsgoingtobeahardslogwarnshernebaybosssimonhalsey 1 26837 0 0 /news/drmartens/eastern/fisher/11thsept04.html 1 0 0 0 /news/551bc99dbe7a4/drmartens/premier/welling/kentleague/VCD/20thjuly03.html 2 15653 0 0 /news/stadiumplansunveiledforebbsfleetunited 1 22855 0 0 /news/burmanpartscompanywithinfluentialskipper 1 13837 0 0 /news/551a9c91c755c 2 19385 0 0 /news/iblamelagerandwomenforourpoorformsaysotfordunitedbossdenisleigh 1 13330 0 0 /news/kentleague/sladegreen/14thjan04.html 1 0 0 0 /news/wearewherewearebecausethatswherewedeservetobesayschathamtownskeithlevett 1 14351 0 0 /news/KentFAStatement070720 2 16503 0 0 /news/kcl090817 1 12276 0 0 /news/vcdathletic3-1brentwoodtown-playerscantdealwithourmovementsaystonyrussell 2 37336 0 0 /news/phoehyth171118 2 77793 0 0 /news/9thsept05.html 1 0 0 0 /news/thamesmead131018 2 25223 0 0 /news/folkestone260618 2 25138 0 0 /news/wevegottokeepimprovingandlearnfromourmistakessaysfolkestonebossneilcugley 1 18597 0 0 /news/canterbury100616 1 12528 0 0 /news/anyonefordarts 1 12283 0 0 /news/551bc5dc03e76 2 15464 0 0 /news/greenwich050815 2 29823 0 0 /news/551bc5da32fa8 4 42522 0 0 /news/grievesimpressedwithtonbridgetalent 1 13395 0 0 /news/imwellhappytobehonestwithyousayscraywanderersbossianjenkins 1 14051 0 0 /news/kentleague/whitstable/23rdjune03.html 1 0 0 0 /news/tonightsresults21stfebruary2006 1 12405 0 0 /news/sceflpromotionrace050218 1 12386 0 0 /news/dolbypicksuphistroopsafterhamptonrichmondrobbery 1 16829 0 0 /news/wevehitrockbottomadmitsbeleaguereddaish 1 22416 0 0 /news/wp-includes/Requests/atomlib.php 1 0 0 0 /news/margate0-1maidstoneunited-stonesweremorestreetwisethanusadmitsbutler 1 30392 0 0 /news/doverathletic2-1heybridgeswifts-collininjurymarsanotherdoverwin 1 14951 0 0 /news/551a97b073d08 2 26992 0 0 /news/craybogn170822 6 153247 0 0 /news/fordlookingformoreknightsinshiningarmour 1 14287 0 0 /news/bromley101118 2 25829 0 0 /news/dartford191017 1 14776 0 0 /news/greenwichboroughbeginsearchforanewbossafterjohncumberbatchleaves 2 18869 0 0 /news/chipstead240905.html 1 0 0 0 /news/dulwich301118 1 13122 0 0 /news/itsgoingtobeatoughopeninggamesayscanterburycityplayer-bosssimonaustin 1 15991 0 0 /news/ebbsmaid070618 1 12029 0 0 /news/551a96dc43657 3 53504 0 0 /southern-counties-east-football-league/3 2 39143 0 0 /news/551bc99de5b54 2 21685 0 0 /news/margate070918 2 27253 0 0 /news/sittingbourne0-1worthing-rebelsstagesmash-and-grabraidtoleapfrogoverbrickies 1 16514 0 0 /news/crayvalleyunveilmidfieldgoalthreataaronjeffreyassecondsummersigning 2 15851 0 0 /news/sceflstatement080520 1 12700 0 0 /news/sevenoaks150218 1 14012 0 0 /archive-2006-2014/41 2 25582 0 0 /news/551bc5e55f1d8 2 28264 0 0 /news/ashfordtown0-1whitstabletown-illjustbegladwhenitsalloversayslovell 1 17230 0 0 /news/FAVasenews071220 5 81856 0 0 /news/wehavetobeatourbesttobeatmargateadmitsfolkestonebossneilcugley 1 20144 0 0 /southern-counties-east-football-league/50 1 20020 0 0 /news/551a9250f260d/15thjuly05.html 2 6643 0 0 /news/wewanttoachievewhatwemissedoutonlastyear-promotionsaysdoverbossmartinhayes 1 12737 0 0 /news/beckenham030222 5 66986 0 0 /news/551bc5e4bcdb2 1 16275 0 0 /news/professionalperformanceputsdartfordwithintouchingdistance 1 13647 0 0 /news/doverremovestainesfromtitlerace 1 11753 0 0 /news/thambrent220417 2 61955 0 0 /news/folkestoneinvicta220421 2 26875 0 0 /news/551bc5ddec3bf 1 10748 0 0 /news/craywanderersmanagementteamworktobringinfundsfortheirplayingbudget 1 25167 0 0 /news/lewes300122 5 57405 0 0 /news/cugleystillnegotiatingdealwithstrikerbremner 1 13897 0 0 /news/phoenixsports050521 2 26601 0 0 /news/folkestoneinvicta0-0afchornchurch-cugleypositiveforlast-daysurvivalbid-exclusive 1 20911 0 0 /news/heroicroystonreleasedbynewlypromotedstones 1 13807 0 0 /news/elmsbeck010817 1 27714 0 0 /news/sittvtonb221103.html 1 0 0 0 /news/kentleague/cray/kentseniortrophyqf030104.html 1 0 0 0 /news/goals020915 2 27117 0 0 /news/soccershorts080622 2 40119 0 0 /news/weallhavetopitchinsaystonbridgeangelsdefenderbenjudge 1 15609 0 0 /news/brommaid160419 2 40852 0 0 /national-league/16 2 25277 0 0 /news/kentfaaward201115 2 29431 0 0 /news/551a9cf538cf3 3 36038 0 0 /news/holldeal030317 1 13318 0 0 /news/dover071116 1 12295 0 0 /news/drmartens/eastern/folkestone/slough201004.html 2 0 0 0 /news/hamwtunb120222 4 125826 0 0 /news/sevenoaks020717 2 17197 1 1 /news/weregoingtostuffsomeonesoonwarnsdartsboss 1 19272 0 0 /news/starjacksonsignsone-yeardealtojoinfolkestoneinvicta 1 15097 0 0 /news/newportcountysofferforadambirchallwasaninsultsaysdoverathleticchairmanjimparmenter 1 11533 0 0 /news/craywanderersrelishprestigiousvisitfromgbdeafsquad 1 13286 0 0 /news/551a931e60867 2 24050 0 0 /news/weveverymuchconcentratingonwhatwevegottodosaysbromleystrikeradambirchall 1 15174 0 0 /news/fcelmstead210119 1 12490 0 0 /news/trottkeepsfaithashechasesplay-offspot 1 13629 0 0 /news/fleetflytheflaginfacarlsbergtrophylastsixteen 1 11037 0 0 /news/wehavetotrytogetawayfromthebottomofthetablesayswhitstabletownbossnickysouthall 1 15976 0 0 /news/hernebay091004.html 1 0 0 0 /news/ksports280816 1 16368 0 0 /news/commentlondonriots 1 11223 0 0 /news/thamesmead011204.html 1 0 0 0 /news/wellingunited110619 1 16065 0 0 /news/551a967917810 2 24249 0 0 /news/wp-content/plugins/superstorefinder-wp/ssf-wp-admin/pages/SSF_WP_UPLOADS_PATH/csv/import/abruzi.php 1 0 0 0 /news/551bc5db9dbe1 3 35827 0 0 /news/dayofdestiny 2 25784 0 0 /news/folkestoneinvictaappointfitnessguru 1 18287 0 0 /news/idontenvisagemichaelwestbeinganebbsfleetplayernextyearsaysbossliamdaish 1 11362 0 0 /news/551a9cf5921a4 2 18377 0 0 /news/crowboroughathletic2-3sittingbourne-miltonquitstofindregularfootball 1 14007 0 0 /news/othernews/favase3rdround.html 1 0 0 0 /news/istillbeleiveweshouldhavemorepointsthanwecurrentlyhavesaysnickysouthall 1 14032 0 0 /news/551a9678c6ccd 3 38809 0 0 /news/waltonhershamsnapupfourfamiliarfaces 1 13419 0 0 /news/26thjune05.html 1 0 0 0 //rdwd.c 1 3711 0 0 /news/16feb04.html 1 0 0 0 /news/todaysresults 1 11687 0 0 /news/9thjuly03.html 1 0 0 0 /news/dealtown020516 1 11399 0 0 /news/crockeddrydenfacesfinancialblow 1 14651 0 0 /news/551bc5e2e6c56 1 15064 0 0 /news/doverathletic0-1chelmsfordcity-hessenthalerweletdownthefans 1 28699 0 0 /news/footballassociationliftbeckenhamtownban 1 12868 0 0 /news/itwontbeeasywarnsbinks-exclusiveinterview 1 14456 0 0 /news/imlookingtotakethedereswheretheyshouldbeinsistsbrownexclusiveinterviews 1 38660 0 0 /news/551a979a8306a 1 5127 0 0 /news/dulwbrom211015 3 76745 0 0 /news/milestellshissidetostandupandbecounted-exclusiveinterview 1 13203 0 0 /news/simondavis 1 11624 0 0 /news/thanetcharitiesbenefitfromramsgatessuccess 1 11294 0 0 /news/bridcrow110117 2 49928 0 0 /news/twelvegamestogowevegottomakeitcountsaysfrancis 1 13987 0 0 /news/hernebay270521 5 65890 0 0 /news/vcdahern190222 2 58589 0 0 /news/wp-includes/certificates/about.php7 1 0 0 0 /archive-2006-2014/231 1 19177 0 0 /news/daishslamshillforbeingupcloseandpersonal 1 13742 0 0 /archive-2006-2014/104 1 20689 0 0 /news/dolbyholdscleartheairtalkswithtwokeyplayers 2 17850 0 0 /news/551a931ded838 2 32876 0 0 /news/kentfootballunited171119 1 14015 0 0 /news/KentFAStatement050620 2 21838 0 0 /news/ifeelitsadisgracehowtheclubhavebeentreatedbybromleycouncilsaysgaryhillman 1 22520 0 0 /news/551bc99dbe7a4/ryman/othernews/17thjuly03.html 2 15653 0 0 /news/kentcountyfaunveilprinciplesponsor 1 13146 0 0 /news/hastings191219 2 26026 0 0 /news/matchreportsebbsfleetearntheirspurs 2 32987 1 1 /news/sittingbourne0-2guernsey-wehaventgotenoughpointsyettostayintheleaguesaysnickdavis 1 26528 0 0 /news/hythetown040919 2 26562 0 0 /news/kentleague/cray/crayvtham291003.html 1 0 0 0 /news/kentleague/hythe/2ndaug04.html 2 0 0 0 /news/551bc5de9f3cd 1 10623 0 0 /news/leyton041005.html 1 0 0 0 /news/hernebaychairmanblamescontractorsforplayingsurface-exclusive 1 13547 0 0 /news/iwanttokeepasuccesfulsquadtogethersaysoconnell 1 17422 0 0 /news/thamrams270115 2 67785 0 0 /kent-invicta-league/2 3 43528 0 0 /news/bromvnorthleighfac300803.html 1 0 0 0 /news/dealtown130919 1 11959 0 0 /news/551a9798138d8 1 3583 0 0 /news/551bc5e259c36 1 12916 0 0 /news/drmartens/eastern/dartford/3rdnov04.html 1 0 0 0 /news/551bc5e878dc6 1 11244 0 0 /news/ryman/bromley/thurrockvbfcfac141003.html 1 0 0 0 /news/conference/margate/3rdoct04.html 1 0 0 0 /news/551a96785a7aa 2 17693 0 0 /news/craywanderers2-1carshaltonathletic-weneedaplayerlikelaurenthamici-jenkins 1 19780 0 0 /news/vcdaburg161119 2 64566 0 0 /news/dartford3-0greatwakeringrovers-weshouldhavepunishedthembymoreadmitsburman 1 20950 0 0 /news/551a97b066db3 2 30758 0 0 /news/ebbsfleet020620 1 14819 0 0 /news/551a9c92085b4 3 83207 0 0 /news/kentleague/cray/crayvsandhurstfac130903.html 1 0 0 0 /news/doverathletic170621 1 13223 0 0 /news/kentrivalsconfidentofbookingtriptoharrow 1 15322 0 0 /news/othernews/gotravelkentleaguetables140304.html 1 0 0 0 /news/glebbeck250120 1 37050 0 0 /news/ebbsfleet280619 1 12055 0 0 /news/551bc99dbe7a4/drmartens/premier/dover/kentleague/sporting/sportvtun081103.html 2 15653 0 0 /news/551bc5e567b86 2 19792 0 1 /news/551a99e3ed403 1 13981 0 0 /news/rymanshockdecisionwewantdartsinrymanonesouth 1 20576 0 0 /news/551bc99dbe7a4/drmartens/premier/dover/ryman/bromley/12thsept03.html 2 15653 0 0 /news/october2010results 1 57790 0 0 /news/gleberit040222 4 142454 0 0 /news/bromley031018 2 23019 0 0 /news/glebe030217 1 12244 0 0 /news/lordswood091020 1 12429 0 0 /news/bromleytitledolke220415 2 28418 0 0 /news/folkestone220416 2 27669 0 0 /news/othernews/18thfeb04.html 1 0 0 0 /news/fishcrow140915 1 31948 0 0 /archive-2006-2014/74 1 20896 0 0 /news/551a9cf545466 3 44491 0 0 /news/ramsbeck080423 2 78513 0 0 /news/dartford2-1basingstoketown-wewanttotakethisclubashighaswecangosaystonyburman 1 20446 0 0 /news/551bc5e16ba9e 2 16761 0 0 /news/phoenix290915 2 26918 0 0 /news/fisher0-3phoenixsports-wewillturnthingsaroundsaysfisherjoint-bossbillywalton 2 41025 0 0 /news/theclubhasbeenstarvedofsuccesssaysnewly-appointedwhitstabletownbossjimward 1 16526 0 0 /news/croydon020418 1 11344 0 0 /news/soccershortsgreenwichboroughsubmitreporttokcfatoexplainsouthparkfacupviolence 1 52123 0 0 /news/ourfanscanplaytheirpart-edwards 1 14192 0 0 /news/551bc99dbe7a4/drmartens/eastern/sittingbourne/ryman/12thaug03.html 2 15653 0 0 /news/bromley080216 2 16817 0 0 /news/22ndapr05.html 1 0 0 0 /news/angelsinheavenwewonpromotionforourfanssayscaptainscottkinch 1 17064 0 0 /archive-2006-2014/146 1 19678 0 0 /news/thamesmead251215 2 26474 0 0 /news/punjab150219 1 12828 0 0 /news/wellleyt290119 2 35777 0 0 /news/drmartens/eastern/dartford/7thjuly04.html 1 0 0 0 /news/miles100515 2 15641 0 1 /news/05thapr04.html 1 0 0 0 /news/wearecurrentlyinbudgetdiscussionsfornextyearsayssittingbournebossnickdavis 1 13975 0 0 /news/551bc5de4ea39 1 14267 0 0 /news/24thsept03.html 1 0 0 0 /news/kentleague/ramsgate/24thsept04.html 1 0 0 0 /news/punjab110119 1 12416 0 0 /news/tonbridge110817 2 27718 0 0 /news/ivgottomakesurewegetitrightathastingssayshume 1 17220 0 0 /news/wellingunited250519 2 15420 0 0 /news/fisherofferfanshalf-pricemondaynightfootball 1 13343 0 0 /news/bromfarn170315 2 35120 0 0 /news/tunbridgewells010422 1 13867 0 0 /news/lymington261105.html 1 0 0 0 /news/551a97b10d81c 2 28284 0 0 /news/bromley300417 2 15900 0 0 /news/concernsoverplayerssafetyfollowinganthonyhoggshorrorinjury 1 15707 0 0 /news/bracbrom200518 3 51598 1 1 /news/werenotgoingtositbackathome-weregoingouttowinitvowswingsbossjamieday 1 21253 0 0 /news/wemustcutoutourmistakessaysdolby 1 12854 0 0 /news/551a956ce269b 1 4196 0 0 /news/sheppeyunited280322 1 15811 0 0 /isthmian-league/43 3 44762 0 0 /news/soccershorts100717 2 44345 0 0 /news/weremotivatedtoendourcampaignwithawinoverhythesayswellsbossmartinlarkin 1 16322 0 0 /news/conferencesealtwo-yeardealwithbtsporttoscreenlivepremiergames 1 16790 0 0 /news/everitthelpsinvictamaintainimpressiveformontheroad 1 16778 0 0 /news/551a97b218dc2 1 15046 0 0 /news/garyabbotthasgotsomuchtoofferouryoungforwardssayscraybossianjenkins 1 15715 0 0 /news/herefordunited5-1hythetown-wecanwalkoffthepitchwithourheadsheldhigh-porter 2 76589 0 0 /news/deresappointbrownastheirnewmanager 2 15264 0 0 /news/19thoct05.html 1 0 0 0 /news/leightontown110904A.html 1 0 0 0 /news/whitstabletown030823 1 13765 0 0 /archive-2006-2014/90 1 20667 0 0 /news/bromley180122 2 16615 0 0 /news/551a9250bf7d0 2 15136 0 0 /news/maidstoneunited110123 1 13230 0 0 /news/ouraspirationsaretodoverywellsaysdoverathleticbosschriskinnear 1 17001 0 0 /news/dover220516 1 12437 0 0 /news/soccershorts050621 3 57500 0 0 /news/vcdathletic270715 2 30711 0 0 /news/soccershortssladegreenmustraise40000tomaintainkentleaguestatus 1 25730 0 0 /news/whoeverholdstheirnervesthelongestwillwinthegamesayshollandsblairbosspaulpiggott 1 18424 0 0 /news/551a931e83070 2 31700 0 0 /news/myhandsandlegsaretiedbringinginnewplayersadmitscash-strappedcugley 1 17698 0 0 /news/canterburycity220921 2 16613 0 0 /news/resultsjune2018 3 35784 0 0 /news/551a9c0ed8c50 4 34350 0 0 /news/551a9c91a5c1b 3 33899 0 0 /news/551a9c930bf75 3 37913 0 0 /news/walker-dontslipuponleytonbananaskin-exclusive 1 13943 0 0 /news/hessenthalerpreparesforbigleap 1 15104 0 0 /news/kennington201218 1 13963 0 0 /news/soccershorts040719 2 36593 0 0 /news/wingschairmanweneedyoursupporttoreachplay-offs 1 12093 0 0 /news/fisher280519 1 12945 0 0 /news/folkdart170522 5 154215 0 0 /news/wemustgetclosertohythesaysdalerscoachdean 1 15022 0 0 /news/9thjune04A.html 1 0 0 0 /news/smithitsgoodtotalktolocalschoolkidsaboutthefleet 1 13563 0 0 /news/vcdathletic240719 2 27876 0 0 /news/551a9c0e7c3ba 2 14205 0 0 /news/lordswood110920 1 13895 0 0 /news/wevegotamassivehurdletoovercomeadmitsdartsbosstonyburman 1 16382 0 0 /news/2ndjune04.html 1 0 0 0 /news/holmesdale0-4dulwichhamlet-weretryingtofinishhigherthanwedidlastyearsayscollier 1 29553 0 0 /news/551a97b23619c 1 13155 0 0 /news/holmes100915 1 14015 0 0 /news/gillingham051023 2 15671 0 0 /news/551a9718a5058 3 25396 0 0 /news/wevegottoseecharacteragainstbeckenhamsayssevenoaksassistantmartinbarnard 1 13180 0 0 /news/tunbridgewells110920 1 13267 0 0 /news/canterbury080416 1 12369 0 0 /news/faversham161020 5 72357 0 0 /news/hernebay231004.html 1 0 0 0 /news/walkerwillnotbesackedinsistsdoverchairman 1 12312 0 0 /news/dartfordbosstonyburmanrelishingopeninggameagainstbookiesfavourites 1 18069 0 0 /news/ryman/bromley/7thdec03.html 1 0 0 0 /news/ashfguer300319 3 73122 0 0 /news/ashford061115 1 9809 0 0 /news/thefacupcomesdowntowhichteamwantstowinthemostsaysbromleycoachhugolangton 1 19994 0 0 /news/crayvalley050216 2 18947 1 1 /news/otfordunited3-4chipstead-imnotgoingtosaywedeservedtowinadmitschipsteadboss 1 29414 0 0 /news/werenotgettingoverexcitedsaystonbridgeangelsassistantalexobrien 1 19795 0 0 /news/551bc5e319245 1 14053 0 0 /news/wehaveanumberofexcellentyoungstersatthisclubsaysstonesyouthboss-exclusive 1 17907 0 0 /news/entertainingmatchesisjustwhatweneedatthisstageofourpreparationsaysjustinluchford 1 12112 0 0 /news/idbethefirsttoadmitthatwehaventscoredenoughgoalssaysramsgatebosstimdixon 1 15594 0 0 /news/ivegottolearnonthejobadmitsnewdockersbossoboyle 1 14920 0 0 /news/12thmar04.html 1 0 0 0 /news/favershamtowntraveltochampionsleaguehopefuls 2 18704 0 0 /news/afccroy270515 3 29015 0 0 /news/eritstan280323 1 37922 0 0 /news/dealtown280722 1 12828 0 0 /news/kentleague/thamesmead/1stnov03.html 1 0 0 0 /news/fleetladieswashedout 2 14806 0 0 /news/551a9c92912ed 3 35683 0 0 /news/binkswevegotninecup-finalstoplayexclusive 2 20808 0 0 /news/551a99e4cb044 2 33930 0 0 /news/holmesdale280722 1 14315 0 0 /news/itseemsweregettingbetterandbettereachweeksaysabbott 1 24897 0 0 /news/551a9250b2b2e 2 15986 0 0 /news/croydonathleticresignfromrymanfootballleague 1 12693 0 0 /news/tunwells200117 1 12755 0 0 /news/craywanderersagreeloandealtobringstrikerlewisperkinsbacktohayeslane 1 19018 0 0 /news/hollands080516 1 14050 0 0 /news/bearsted0-1whitstabletown 1 16236 0 0 /news/fleetfansmeettoputmorebumsonseats 1 15083 0 0 /news/tunbridgewellsbossmartinlarkinhailshisfacupheroes 1 21502 0 0 /news/margatep-pwealdstone-ithoughtitwastherightdecisiontocallitoffsaysbutler 1 16528 0 0 /news/551bc99b79bb1 2 19372 0 0 /news/maidstoneunited1-0walthamforest-wehavelostalittlebeliefinattackadmitshume 1 24552 0 0 /news/iloveplayinginthebiggamessaysmcclements-exclusive 1 14585 0 0 /news/drmartens/eastern/ashford/11thdec03.html 1 0 0 0 /news/doverathletic020519 1 16485 0 0 /news/29thjan04.html 1 0 0 0 /news/battleoframsgatepastandpresentasclubhonourloyalservantbenlaslett 2 15002 0 0 /news/beckbrom270715 2 37008 0 0 /news/margate260519 2 26375 0 0 /drmartens/eastern/tonbridge/margate190705.html 1 9955 0 0 /news/resultsmarch2018 4 151529 1 1 /news/551bc5dbe45de 3 44349 0 0 /news/daishshowsnosentimenttowardscambridge 1 14922 0 0 /news/werekeepingtheleagueinformedaboutthestandsituationsaysneilcugley 1 17525 0 0 /news/551bc5dd2ffa0 3 36015 0 1 /news/cugleywemuststartfindingthebackofthenet 1 14251 0 0 /news/punjab180920 1 12496 0 0 /news/bearsted120916 1 13992 0 0 /news/itswinorbustforramsineasterscrambleforplay-offs-exclusive 1 22982 0 0 /news/bromleycaptaingillmanoptsfordoverathleticmove 1 16111 0 0 /news/abelrejectsreturnmovetofolkestoneinvicta 1 14120 0 0 /news/551bc99dbe7a4/kentleague/greenwich/kentleague/beckenham/8thaug03.html 2 15653 0 0 /news/lewkotey130515 1 11332 0 0 /news/watsontakesapaycuttosignforin-formvickers 1 13516 0 0 /news/theofferfromleatherheadcameoutofnowheresaysdarrensmith 4 32342 2 2 /news/551bc99dbe7a4/drmartens/eastern/sittingbourne/drmartens/eastern/chatham/8thdec03.html 2 15653 0 0 /news/bromleians140518 2 18450 0 0 /news/hythe220719 2 25549 0 0 /news/sheppey031117 1 12011 0 0 /news/icannolongercommittotherigoursofplayingforramsgateintherymanleaguesaysliamquinn 1 11527 0 0 /news/wp-content/plugins/ioptimizations/IOptimizes.php 1 0 0 0 /news/theweekahead-9 1 15013 0 0 /news/livecoverageedgwaretown2-1dartford-recalldartstitlewinningday 1 29595 0 0 /news/wevegottopickupleaguewinsdemandsgibbons 1 13564 0 0 /news/folkhors071219 2 66948 0 0 /news/chathamtown2-2tootingmitchamunited 1 12125 0 0 /news/margate290421 6 61402 0 0 /news/12thapr04.html 1 0 0 0 /news/romford040321 4 46310 0 0 /news/snodsutt250921 1 36650 0 0 /news/othernews/SECWFL150204.html 1 0 0 0 /news/crayvalley220319 1 12924 0 0 /news/ebbsfleet310120 2 16619 0 0 /news/pleasenoteourtechnicalissueshavenowbeensolved 1 9933 0 0 /news/wereallywanttowininthefirstroundofthefacupsaysholmesdalejoint-bossjohn-paulcollier 1 13804 0 0 /news/holmesdale050821 1 12290 0 0 /news/bromley230218 2 17393 0 0 /news/folkestone301219 3 34301 0 0 /news/bothteamswillentertainyouallsaysgorman-exclusive 1 12707 0 0 /news/ashfordtown1-3worthing-weneedlucktosurvivethedropsayslovell 1 32535 0 0 /news/craywanderers2-4concordrangers-werebeingpunishedforourmistakessayspaulblade 1 21846 0 0 /news/glebe020621 2 16863 0 0 /news/wedontwanttoliveoffwhatwedonelastyearsayshythetownbossscottporter 1 13156 0 0 /news/551a9c0e39531 2 20205 0 0 /news/eltham291216 1 14413 0 0 /news/erithtown020516 1 11849 0 0 /news/hendfolk020518 2 57072 0 0 /news/cugleyproudofawayrecord 1 15247 0 0 /news/ramsgatelloydblackman091218 2 28551 0 0 /news/hendfolk270118 2 60790 0 0 /news/kentleague/tunbridgewells/whitstable140804A.html 1 0 0 0 /news/margvnorthwich270903.html 1 0 0 0 /news/drmartens/eastern/folkestone/folkvfishlgecup111103.html 1 0 0 0 /news/dulenf270417 2 63992 0 0 /news/551a931d93abf 1 10214 0 0 /news/19thjuly04.html 1 0 0 0 /news/bromeast241015 2 36041 0 0 /news/frozenfebruarystrikesanothervictim 1 13167 0 0 /news/kentleague/sladegreen/hernebay091004.html 1 0 0 0 /news/drmartens/eastern/fisher/fishvfolk201203.html 1 0 0 0 /news/afccroydonathletic3-4erithtown-ithinkwemadehardworkofitsaysjamescollins 1 31320 0 0 /news/wewanttokeepplayersontheirtoesduringpre-seasonsayserithbelvederebossmartinford 1 16315 0 0 /news/drmartens/eastern/tonbridge/leytonorient081104.html 1 0 0 0 /news/canterburycityunveilsimonaustinastheirnewboss 1 12911 0 0 /news/bromley130919 2 22579 0 0 /news/551a979a11816 1 5569 0 0 /news/daishkeepsdebollaatfleet-wingsreceive12000forkedwell 1 11164 0 0 /news/sittingbourne110818 2 25756 0 0 /news/ibelievethaticanscoreineverygameandifidontthenimdisappointedsaysadambirchall 1 14737 0 0 /news/everyonehasaparttoplayinourpromotionpushsayswarrilow 1 16129 0 0 /news/wp-admin/style.php 1 0 0 0 /.well-known/pki-validation/ 6 2588 2 2 /news/wehaveplayerswhocanperformonthebiggerstagesaysfavershambossrayturner 1 12970 0 0 /news/welling210518 2 14625 1 1 /news/551bc5e21a88e 1 16543 0 0 /news/lionsvisitgivesfordanightmare 1 14217 0 0 /news/pauljefcoatestandsdownasramsgatechairmanaftertimdixonscontroversialdeparture 1 13885 0 0 /news/stonesplayersponderreduceddeals 1 24250 0 0 /news/theresalotoftalentinthislevelandtheyrenotreallyseenorreallyappreciatedsaysrose 2 19722 0 0 /news/corinthianA100220 1 13846 0 0 /news/551a92500eb40 4 41733 0 0 /news/29thjune05.html 1 0 0 0 /news/rochnewh100816 1 28308 0 0 /news/favershamrelishingthenewcampaign 1 15109 0 0 /news/551bc99dbe7a4/nationwide/gillingham/kentleague/maidstone/15thaug03.html 2 15653 0 0 /news/backingkenttowembleyboroughtellvickersjoinusinthelastsixteen-exclusive 1 18099 0 0 /news/drmartens/eastern/erith&belvedere/2ndsept04.html 1 0 0 0 /news/fordwelookafterourtopstrikepair-exclusiveinterview 1 12860 0 0 /news/favershamtown1-2kingstonian-wejustneedthatlittlebitoflucksaysproudluchford 1 33134 0 0 /news/stonessacksinclair-folkestonefinecarruthers-exclusivemanagerinterviews 1 51355 0 0 /news/sportingclubthamesmead141023 6 59925 2 2 /news/ryman/bromley/22nddec03.html 1 0 0 0 /news/chathamtown1-3sittingbourne 1 15902 0 0 /news/hythe311216 2 24471 0 0 /news/wehavenotbrokenanyrules 1 13877 0 0 /news/551a9718b0f22 3 30069 0 0 /news/tompkinsaddsmalintodockersmanagementteam-exclusive 1 13550 0 0 /news/551a9718c4a25 3 40001 0 0 /news/bromley020920 2 21500 0 0 /news/fisheraredesperateforfacupprizemoneysaysjoint-managerbillywalton 1 14051 0 0 /news/551bc5de3d0f8 1 14502 0 0 /news/ryman/bromley/beck220703.html 1 0 0 0 /news/cantlydn221016 1 29650 0 0 /news/dartfordexplainwhytheyhavescrappedreserveside 1 13231 0 0 /news/ourlandlordistheonlypersonholdingcrockenhillbacksayschairmanstevecullen 3 28287 2 2 /news/arsenal2-0gillingham-ourgirlsstooduptoarsenalsaysproudbossjamesmarrs 2 37947 0 0 /news/cray280816 3 38747 0 0 /news/551bc5e428f3d 1 2886 0 1 /news/551a9678e4942 3 45247 0 0 /news/wp-content/plugins/dzs-zoomsounds/xo.php 1 0 0 0 /news/551bc99dbe7a4/kentleague/sladegreen/drmartens/eastern/chatham/10thjuly03.html 2 15653 0 0 /news/kentleague/tunbridgewells/burytown111204.html 1 0 0 0 /news/uncertainsladegreenunveiltheirnewmanagerattheweekend 1 11824 0 0 /news/glebe100119 1 11097 0 0 /news/crayvalley180521 3 27696 0 0 /news/sittingbourne1walthamforest1 1 15096 0 0 /news/tonbridge260518 2 22647 0 0 /news/ramsgate1-0margate-fansturnontrottafterderbydefeat 1 16773 0 0 /news/fairplay300515 3 36046 0 0 /news/wearealwayslookingtostrengthensaysdoverathleticbossnickyforster 1 13643 0 0 /news/ramsgate071018 2 32429 0 0 /news/jimwardwillgethisguysfiredupwarnsramsgatebosstimdixon 1 15943 0 0 /news/corinthian270220 1 18545 0 0 /news/551a95b3b1171 3 36279 0 0 /news/elmstead191117 1 13090 0 0 /news/drmartens/eastern/tonbridge/7thsept04.html 1 0 0 0 /news/lawsonreplaceswingsstalwartgreen 1 10810 0 0 /news/wellpunj280322 5 196607 0 0 /news/myfacupmemorieswithhornetshavestuckwithmesaysprouddartfordstrikercarlrook 1 16179 0 0 /news/deal101105.html 1 0 0 0 /news/551a9c0f016e1 4 36662 0 0 /news/wewillsoonclimbuptheleagueifwetakeourchancessaysrusthallbosspaulmcdonagh 1 12262 0 0 /news/imlookingforwardtothechallengesaysnewwhitstabletownbossjustinluchford 1 16059 0 0 /news/formbooksgooutofthewindowinderbygamessaysdoverathleticbossmartinhayes 1 15404 0 0 /news/whitstabletriocheatdeathinfatalthanetwaycrash 1 15588 0 0 /news/becklanc281123 36 609360 8 13 /news/jasonbartonraisesfundsforbritishlungfoundationashepoundsthestreetsoflondon 1 12955 0 0 /news/bromley030118 1 16060 0 0 /news/8thapr05.html 1 0 0 0 /news/itsinthelapofthegodswhichteamswinssayscorinthianbosstonysitford 1 16824 0 0 /news/iplayfootballforthesebiggamessaysroyston-exclusiveinterview 1 25861 0 0 /news/isetthebarveryhighstandardandwerenotreachingitadmitshernebaybosssimonhalsey 1 15444 0 0 /news/weoweoursupportersoneandwemustdeliverthemthreepointssayspeternott 1 19236 0 0 /news/551a9677404e0 3 34407 0 0 /news/thefinalcountdownresultsapril2008 1 31233 0 0 /news/soccershortsashforddecidetoscraptheirreserveside 1 17332 0 0 /news/halseyendsspeculationoverstrikerking 1 14022 0 0 /news/wevecreatedafunenvironmenttobringbackabitofconfidencesaysday 1 18510 0 0 /news/551bc5db6238b 2 13673 0 0 /news/551bc5e5a269b 1 11992 0 0 /news/whitstable141204.html 1 0 0 0 /news/itshardforakentsidetogetoutofthisleaguesayshythetownbossscottporter 1 13353 0 0 /news/erithtown020518 1 12225 0 0 /news/erithtown060905.html 1 0 0 0 /news/glebe060919 3 18919 1 1 /news/meridian141216 2 16456 0 0 /news/eightypointswillgetuspromotedsaysburman 1 16022 0 0 /news/chipsteadmakeyouworkhardtogetanythingdowntheresaysstonesbossjaysaunders 1 13978 0 0 /news/conference/margate/2ndjuly03.html 1 0 0 0 /news/bromley2-0chelmsfordcity-wevegotthepotentialofatop-sixsideadmitsmarkgoldberg 1 26692 0 0 /news/craywanderers2-4kingstonian-theleaguehasntbeenlosttodaysaysfrancis 1 18881 0 0 /news/croytunb020915 2 67268 0 0 /news/tonbridgeangels301120 1 11768 0 0 /news/margate010720 2 24507 0 0 /news/26thoct05G.html 1 0 0 0 /news/beckenham121105.html 1 0 0 0 /news/wardconfidentofupsettingin-formleadersdoverathletic 1 13788 0 0 /news/sheppey210417 1 12592 0 0 /news/gillingham170817 2 22436 0 0 /news/erithandbelvedere270521 1 13147 0 0 /news/eastkentcollegebossescelebratebeingtopoftheclass 1 18262 0 0 /news/sheppey100119 1 13999 0 0 /news/croyathvbrom020304A.html 1 0 0 0 /news/wewantplayerswhowanttoplayfortheclubsaysconeyhalldirectoroffootballchristucker 1 17242 0 0 /news/drmartens/eastern/tonbridge/31stJan04.html 1 0 0 0 /news/551a92502d248 4 36419 0 0 /news/hampttonb171219 2 27006 0 0 /news/phoenixsports3-0ashfordunited-frostshouldhavegoneadmitsphoenixbossscottsaunders 1 25244 0 0 /news/erithvlords081103.html 1 0 0 0 /news/doverathletic2-1wycombewanderers-weregettingthere-sayshess 1 25770 0 0 /news/rusthall011216 1 13639 0 0 /news/thechairmanwantstogetoutofthisleaguesayshuntley 1 15094 0 0 /news/rusthall130818 1 14037 0 0 /chatham-2003-2006/www.heineken.co.uk/www.heineken.co.uk/ 1 3175 0 0 /news/elmstead230916 1 12409 0 0 /news/551bc5e03d01f 2 22059 0 0 /news/beckchic061222 6 167609 0 0 /news/brickiesandramscontinuegoodearlyform 1 22231 0 0 /news/maidstoneunited1-2favershamtown-werecompetingwithandbeatingthebestsaysrayturner 1 33274 0 0 /news/wewanttokeepthewinningmentalitygoingsayswatts 1 13815 0 0 /news/bromley1-1wellingunited-wehaventgotthedivinerighttogetthreepointssaysjamieday 1 22476 0 0 /news/bromwrex220522 5 76629 0 0 /news/croydon220920 1 13273 0 0 /news/editorsstatement 1 12307 0 0 /news/folkestonebeginsearchfornewscout 1 16598 0 0 /news/craywands120118 3 32385 0 0 /news/thepowerandtheglory 1 17487 0 0 /news/551bc99dbe7a4/kentleague/cray/othernews/facup7thjuly03.html 2 15653 0 0 /news/ashfordu18vramsgateu18.html 1 0 0 0 /news/551bc99dbe7a4/othernews/kentleague/tunbridgewells/tunvlordswood130803.html 2 15653 0 0 /news/bearsted150920 1 14309 0 0 /news/551bc5e63ee03 1 18003 0 0 /news/myfcvotesinfavouroffleetdeal 1 16232 0 0 /news/injurieshaveknockedusforsixadmitslovell 1 18335 0 0 /news/ebbsfleetunited0-6charltonathletic-new-lookfleetbroughtbackdowntoearth 1 20360 0 0 /news/kcfafindstephensonguiltyforspittingatkentfootballreferee 1 14810 0 0 /news/dartford3-0maidstoneunited-wewanttogetthingsdoneourselves-burman 1 33827 0 0 /news/maidmcdonagh310515 1 19269 0 0 /news/maidstoneunited1-1ebbsfleetunited-ialwayslooktodobetterthanlastseasonsaysliamdaish 1 18113 1 0 /news/itsprobablythebiggestweekinmymanagerialcareersofarsaysjaysaunders 1 17795 0 0 /news/mehmetrekindleshisloveaffairwithfisherathletic 1 13017 0 0 /news/NationalLeague211020 4 25021 2 2 /southern-counties-east-football-league/43 1 20201 0 0 /news/tunbcroy290920 1 30582 0 0 /news/soccershortsroystonspoordisplayslinkedtoswineflu 1 27748 0 0 /news/soccershorts060720 2 34411 0 0 /news/soccershortsineedhelptopaybeckenhamsbillssaysmanagerjasonhuntley 1 63579 0 0 /news/letshopewecanhaveasuccesfulendtoourseasonsaysbearstedbosstonycornwell 1 14528 0 0 /news/551a95b44a170 2 19526 0 0 /news/4thapr05.html 1 0 0 0 /news/glebe201017 1 12193 0 0 /news/dartbrai060518 2 43240 0 0 /news/craywanderersfilmportrayslifeofastrugglingnon-leaguefootballer 1 18253 0 0 /news/5thoct05.html 1 0 0 0 /news/othernews/favase1stround.html 1 0 0 0 /news/lewisham281217 1 13056 0 0 /news/3rddec05.html 1 0 0 0 /news/newleaguetokickoffinaugust2010 1 12773 0 0 /news/maidstone190305.html 1 0 0 0 /news/favershamstrikeforce090222 2 27309 0 0 /news/sceflstatement170820 1 11161 0 0 /news/weveblownourtitlechancesadmitsfoley-exclusiveinterview 1 16664 0 0 /news/fisherandcroydonunveilnewmanagementteams 1 19401 0 0 /news/551bc5dc1bf02 2 16173 0 0 /news/kentleague/beckenham/20thjuly03.html 1 0 0 0 /news/canterbury140815 1 16530 0 0 /news/hernebayhonourgentlemansagreementwithcanterburycitytosharewinchsfield 1 12096 0 0 /news/551a9c0eca136 4 33373 0 0 /news/margate190721 2 24361 0 0 /news/myambitionisforthestonestoplayinmaidstone-oliverash 1 19316 0 0 /news/rymanpos120515 2 23259 0 0 /news/551bc5dba1802 3 33839 0 0 /news/thebigkickoffcosgroveinsistsdereswillwinkentleaguecrown 1 19787 0 0 /news/551a931e0287f 1 12392 0 0 /news/IsthmianLeagueStatement271120 3 32902 0 0 /news/tonbridgeangels4-1dartford-wecouldntlivewithtonbridgeadmitsburman 1 20291 0 0 /news/idratherbewherewearenoworbeinmidtablewithnothingtoplayforsayssteveoboyle 1 15620 0 0 /news/thefacupprizemoneyisthemajoraspectatthemomentadmitsthamesmeadtownbosskeithmcmahon 1 14036 0 0 /news/551a9cf5ad264 2 17242 0 0 /news/doverathleticreadytoproduceanotherfacupgiant-killing 1 26349 0 0 /news/wellmaid060819 1 22237 0 0 /news/resultsaug2016 2 79532 0 0 /news/vickersmanagementteamjoinfoleyatchathamtown 1 19615 0 0 /news/fleetchairmanexplainsticketpriceincrease 1 12642 0 0 /news/maidstone281218 1 12202 0 0 /news/councilhandcontrolofprincesparktodarts 1 14633 0 0 /news/versatilelyebolstersdoversquad 1 10830 0 0 /news/resultsdidntmatchourexpectationssaysangelschairman 1 13987 0 0 /news/folkestoneinvicta1-1eastbourneborough 1 14124 0 0 /news/icantdefendtheboysafteranightlikethatfumesangelsbosstommywarrilow 1 20815 0 0 /news/crockenhill200717 2 14251 0 0 /news/cugleyvowstoleadfolkestoneinvictanextterm 1 18481 0 0 /news/ashfordunited010720 3 26276 0 0 /news/551bc5dd3a4a1 2 16992 0 0 /news/551bc5e47201d 1 12624 0 0 /news/551bc99b2b39c 2 14824 0 0 /news/mywifehastoldmetotakethewhitstablejobsayslane 1 19726 0 0 /news/doverathletic2-1afchornchurch-thewaitisalmostoversayshare 1 15687 0 0 /archive-2006-2014/293 2 22007 0 0 /news/kentfachiefpauldolanexplainsdartfordskentseniorcupwithdrawal 1 12080 0 0 /news/fcelmstead230715 1 14737 0 0 /news/bromsut261216 2 35291 0 0 /news/billtonb120417 3 76459 0 0 /news/facupteamnewslovelldespondentoverbrowningloss 1 14333 0 0 /isthmian-league/12 3 45976 0 0 /news/KentCountyLeague140517 2 24231 0 0 /news/crawleywillnotbedownforlongsaysfolkestoneinvictabossneilcugley 1 14446 0 0 /news/wecancausetonbridgeproblemssaysupbeatbutler 1 17615 0 0 /news/551bc5e1f3943 2 29649 0 0 /news/551bc99dbe7a4/conference/gravesend/kentleague/thamesmead/14thnov03.html 2 15653 0 0 /news/kennington260720 1 12038 0 0 /news/ryman/bromley/28thJan04.html 1 0 0 0 /news/bansvbrom170104.html 1 0 0 0 /archive-2006-2014/94 1 19923 0 0 /news/doverterminatedaviscontract 1 12931 0 0 /news/551a9677b6165 2 15127 0 0 /news/551bc5e3694eb 1 16865 0 0 /news/551a979887949 2 22663 0 0 /news/ramsphoe161018 3 76436 0 0 /news/greenwich071218 2 29434 0 0 /news/bromley290321 5 55353 0 0 /news/greeniesfridaypreview-willthefleetmakeitagreateight 1 18899 0 0 /news/doverathletic2-1brackleytown-hessenthalerwantsperfectiondespitepremierscalp 1 20660 0 0 /kent-invicta-league/8 3 42864 0 0 /news/ashford281119 3 31069 0 0 /news/shepcray011218 1 34189 0 0 /news/didcotvsladefac060903.html 1 0 0 0 /news/lordswood281016 1 14079 0 0 /news/doverathleticlaunchnewclubhouseappeal 1 19612 0 0 /news/afccroydon270817 1 12160 0 0 /news/erithandbelvedere110920 1 13115 0 0 /news/551a97b06ee91 1 10977 0 0 /news/551a9250dec79 3 42988 0 0 /news/551a925004f50 1 3468 0 0 /news/fiskhasdrivingambitiontoimprovehythetownsfortunes-exclusiveinterview 1 13578 0 0 /news/551a925048014 4 31088 0 0 /news/chatham210417 3 32766 0 0 /news/letsmakeitagoodfridaysayscugley 1 18109 0 0 /news/welling240517 1 12426 0 0 /news/horshamymca0-2folkestoneinvicta 1 15680 0 0 /news/chathamtown090120 1 12918 0 0 /news/551a96dc02f1f 1 4809 0 0 /news/stainestown2-2tonbridgeangels-angelsoutclassstainesinplay-offfinaldressrehersal 1 21582 0 0 /news/corinthiansagreatclubtoplayforsaysbossjamescollins 3 23064 0 0 /news/BlairKSTFinal100415 2 20938 0 0 /news/bromley250618 2 17121 0 0 /news/wevecutthebudgetasthetitleisoutofourgrasp-radbourne 1 23667 0 0 /news/starscomeoutinforcetosupportlocalkidscharity 1 18988 0 0 /news/salisburycity2-0maidstoneunited-imnotgoingtoblametherefereeforourdefeatsayshume 1 18417 0 0 /news/holmesdale230922 1 13761 0 0 /news/ihavejustfoundoutbyawebsitethatiamnolongerinvolvedblastscoachstevesallis 1 15688 0 0 /news/kentleagueunveiltwo-yearsponsorshipdeal 1 11701 0 0 /news/551a9799538d8 1 6154 0 0 /news/wp-content/plugins/formcraft/file-upload/server/php/files/abruzi.php 1 0 0 0 /news/551bc5e51fcf0 1 12258 0 0 /news/551a97995dbaa 1 4390 0 0 /news/thebigkickoffcraywandererssignchapmantohelppromotionbid-exclusive 1 16262 0 0 /news/14thaug05.html 1 0 0 0 /news/soccershortsfacuphistorymakerarrivesinkent 1 22481 0 0 /news/thebigkickoffformermargatedefenderedwardssignsfordockers-exclusive 1 17917 0 0 /news/551a9c91c0759 3 46214 0 0 /news/wellenjoythedayandcomebackwithsomegreatmemoriesfrombradfordsaystonyburman 1 16567 0 0 /news/ashfordtown1-2whyteleafe-lovellblamespitchforpoorhomerecord 1 16116 0 0 /news/551bc5e21345e 1 14182 0 0 /news/pitchero.com/clubs/dulwichhamlet 1 0 0 0 /archive-2006-2014/106 1 20547 0 0 /news/hytheleath030916 2 54248 0 0 /news/imconfidentthatwellgothroughagainstlancingsaysgreenwichboroughbossianjenkins 1 14729 0 0 /news/shepholl100422 2 51535 0 0 /news/facupreactiontosecondqualifyingrounddraw 1 49095 0 0 /archive-2006-2014/70 1 20729 0 0 /news/soccershortsplayingkentleaguefootballhastakenitstollonouryoungplayersadmitsdouglas 1 17867 0 0 /news/fleetsearchforfreshtalent 1 11264 0 0 /news/kentleague/hythe/littlehampton280804.html 1 0 0 0 /news/tonbridgeangels4-3lowestofttown-wedeservetogoupsaystommywarrilow 1 27341 0 0 /news/wellingunitedbossjamiedayunveilshisfirstsummersigning 2 17037 0 0 /news/iwantmysidetoberememberedinthefacupthisseasonsaysnortonbossbentaylor 1 19386 0 0 /news/dealsreservesrelishtrainingsessions 2 13775 0 0 /news/FAStatement260820 1 15126 0 0 /news/sendusyourmatchreports 1 10411 0 0 /news/551bc5e0e9994 1 22644 0 0 /news/istillfeelihavesomethingtooffersaysdoverathleticbossnickyforster 1 11407 0 0 /news/daishsetforsometransferwindowactivity 1 13442 0 0 /news/kentleaguechairwomanre-organisationisastepforward 1 14673 0 0 /news/beckenhamtown130919 1 12625 0 0 /news/inhindsightimdisappointednottohavesixpointssayselthampalacebossterrynaden 1 17097 0 0 /news/551a9c0e8221e 2 15885 0 0 /news/wereonlyjustgettingbackoncourseafteradifficulttimesayswhitstablechairmanjoebrownett 1 12612 0 0 /news/551bc5e0e1ccd 1 15283 0 0 /news/29thsept04.html 1 0 0 0 /news/peteroverton240817 1 14058 0 0 /news/kentleague/tunbridgewells/erithtown201104.html 1 0 0 0 /news/fishergivefansfoodforthoughtonnon-leagueday 1 15231 0 0 /news/maidstone140804.html 1 0 0 0 /news/drmartens/eastern/folkestone/welling070804.html 1 0 0 0 /news/551a979aee494 1 5264 0 0 /news/maidstoneunited1-2afcwimbledon-improudofteambutourredcardcostusadmitswalker 1 25745 0 0 /news/dover160405.html 1 0 0 0 /news/crowboroughathletic230222 1 11746 0 0 /news/wardhailsthereturnoftwyman 1 15394 0 0 /news/myambitionistobethefirstmanagertowinattheoldwembleyandthenewonevowstommysampson 1 17864 0 0 /news/tunbridgewells1-3rusthall-itmeansalottotheladssaysrusthallbosspaulmcdonagh 1 26904 0 0 /news/551bc99b44e05 2 29467 0 0 /tonbridge-2003-2006/4 2 29152 0 0 /news/itsveryimportanttogettoacupfinalsaysluchford 1 13887 0 0 /news/drmartens/eastern/folkestone/hampton140904.html 1 0 0 0 /news/halseyoptstomovetohernebay 1 17962 0 0 /news/bearrust221122 1 37055 0 0 /news/ryman/bromley/15thaug03.html 1 0 0 0 /news/drmartens/premier/dover/13thaug04.html 1 0 0 0 /news/551a9c0e95239 4 68846 0 0 /news/551a97990701a 1 4737 0 0 /news/ithinkwevehadagreatseasonsayscorinthianbossmattlonghurst 1 15994 0 0 /news/soccershortsrhyslawsonre-signsforhernebay 1 18068 0 0 /news/551bc99dbe7a4/kentleague/hernebay/kentleague/sporting/sportvtun081103.html 2 15653 0 0 /news/millwallswoopforformerdartswinger 1 11689 0 0 /news/crockenhillunveilgroundplanstoreturntokentleague 1 20056 0 0 /news/551a9c92cae46 2 25241 0 0 /news/ryman/bromley/bromvdulw261203.html 1 0 0 0 /news/551bc99abdc46 2 16954 0 0 /news/drmartens/eastern/dartford/18thjuly04.html 2 0 0 0 /news/dealtown051121 1 12973 0 0 /news/551a9b481acba 4 29287 0 0 /news/iwillbebuildingtheclubfromtoptobottomsaysnewderesbossmattlonghurst 1 14562 0 0 /news/sittingbourne070716 2 27750 0 0 /news/augustseptember2008results 1 34307 0 0 /news/forthcomingfixtureswc160106 1 14124 0 0 /news/551a924ff2c10 2 20540 0 0 /news/wellmakesurethechipsaredownvowsmorgan 1 14542 0 0 /news/kinetic120121 3 35367 0 0 /news/lordashu260823 1 34366 0 0 /news/kentleague/4thsept03.html 1 0 0 0 /news/551a95b41f7fc 4 47865 0 0 /archive-2006-2014/144 1 19471 0 0 /news/myplayersthinktheyrebetterthanwhattheyaresometimesfumeswarrilow 1 14910 0 0 /news/tonbridge150117 2 25893 0 0 /news/newportcounty2wellingunited2 1 10713 0 0 /news/sladegreen080105.html 1 0 0 0 /news/ebbsfleet081118 1 13224 0 0 /news/fisher140219 1 13178 0 0 /news/hythetownbossscottporterunveilstomparkinsonashisthirdsummersigning 1 11936 0 0 /news/551a97b06c6f2 1 12087 0 0 /news/theladscantwaittopitthemselvesagainstbetterplayersandabetterteamsaysmattlonghurst 1 18419 0 0 /news/weknowwhatwevedonewrongatstalbanssaystonbridgeangelsbosstommywarrilow 1 20161 0 0 /news/kentfallssilentat130pmtopaytributetosyko 2 18567 0 0 /news/fishlydd181117 4 94394 0 0 /news/ourtriptobournemouthhasserveditspurposeadmitsburman-exclusive 1 11932 0 0 /news/551bc99d5f53e 2 20919 0 0 /news/londonbridge040617A 2 23731 0 0 /news/doverathleticchairmanoffersbossmartinhayesanewcontract 1 13295 0 0 /news/resultsdecember2013 1 51218 0 0 /news/stonesswoopforkentleaguestardefender-exclusive 1 13829 0 0 /news/551a9cf52c047 3 52020 0 0 /news/crayfav270816 3 81902 0 0 /news/551a931dae8a1 1 10638 0 0 /news/canterburycity241222 2 16295 0 0 /news/weareallworkingtogethertobereadyforourkentleaguereturnsayscanterburycitychairman 1 13772 0 0 /news/beckmeri300719 2 38833 0 0 /news/dolbypiscinaisahellofaplayertobringoffthebench 1 14076 0 0 /news/kentleague/sladegreen/maidstone140804.html 1 0 0 0 /news/551a9678ac42a 3 49121 0 0 /news/dulwichhamlet2-0maidstoneunited-youvegottotakeyourchancesadmitsjaysaunders 1 29689 0 0 /news/chathamtown0a0folkestoneinvicta-greensuffersthreebreaksinhorrorinjury 1 17026 0 0 /news/championswinningthetitleonourhomepatchwaskeysayshessenthaler 1 14292 0 0 /news/7thjune05.html 1 0 0 0 /news/551a9678ddf13 3 30913 0 0 /news/conference/margate/15thJan04.html 1 0 0 0 /news/weredefinatelycomfortableenoughtoremainintheleaguesaysbromleyskippertutuhenriques 1 17787 0 0 /news/soccershorts190816 2 52425 0 0 /archive-2006-2014/www.heineken.co.uk/ 1 4997 0 0 /news/dartsfacedoubleinjuryblowdespitetheirriseintoplay-offpicture 1 16510 0 0 /news/FAStatement250720 3 31216 0 0 /news/doverathletic220421 2 16362 0 0 /news/wellerit130319 1 31919 0 0 /news/canterburycity121221 1 12177 0 0 /news/itsveryfrustratingknowingthatteamsfrombelowcanleapfrogoveryou-bexliansfc 1 17364 0 0 /news/fleetsscreentestcouldbringinatleast155000 1 17370 0 0 /news/craywandererschairmangaryhillmanbidsfororpingtonsite 1 13270 0 0 /news/forthcomingfixtureswc300106 1 14288 0 0 /news/551a956b990c3 3 19561 0 0 /news/delightedbridonropeschairmanunveilsgarylisneyastheirnewboss 2 17713 0 0 /archive-2006-2014/268 2 23742 0 0 /news/francisblamessuicidaldefendingforfirsthalfhorrorshow 1 15132 0 0 /news/hessenthalerrevealestrialistsidentities 1 16546 0 0 /news/erithtown240105.html 1 0 0 0 /news/erithbelvedere3-3hollandsblairaet-1-3pens-thiswasnotourcupfinalsayspiggott 1 34822 0 0 /news/awinoverconcordrangerswillliftspiritssayscraybossianjenkins 1 15469 0 0 /news/shotsconfidentofbreakingfleetshearts 1 13474 0 0 /news/crayvalleyunveilcaptureofcoachdarrenanslowandstrikeralifeharris 1 13131 0 0 /news/551a95b3998b5 2 14200 0 0 /archive-2006-2014/190 1 19398 0 0 /news/tonbridgeangels1-1wellingunited-wecancompeteagainstthetopteamssaystommywarrilow 1 19256 0 0 /news/craywands260317 3 30224 0 0 /news/sevtun101017 2 77834 0 0 /news/weveturnedthecornersayskentfootballunitedbosssammacneil 1 15620 0 0 /news/kennington250518 2 17148 0 0 /news/lordswood201016 1 13536 0 0 /news/corbvsitt131203.html 1 0 0 0 /news/wellgray271015 1 26369 0 0 /news/2nddec05.html 1 0 0 0 /news/motthall180417 1 33655 0 0 /news/jepsonresignsafterlosingfiveoutofsix 1 12287 0 0 /southern-counties-east-football-league/36 1 20217 0 0 /news/wewantalloftheboystogivetheirallsaysbromleycoachneilsmith 1 15059 0 0 /news/551bc99dbe7a4/othernews/othernews/charltonladies7thsept03.html 2 15653 0 0 /news/matatanetsoneastthurrockdebut 1 12883 0 0 /news/firstteamstarsturnoutforangelsreserves 1 10673 0 0 /news/thehardworkstartsheresaystable-toppingburman 1 14099 0 0 /news/tunbridgewells020819 1 12335 0 0 /news/weneedtoimproveifwearetogetclosetolandingthetitlesayslyddtownbossdavesmith 1 13890 0 0 /news/doverathleticunveilianhendonastheirnewmanager 1 12039 0 0 /news/itsgoingtobeareallydifficultperiodaheadwarnsbromleybossmarkgoldberg 1 18776 0 0 /news/wevegotamassivetaskaheadofussayssittingbournebossnickdavis 1 17832 0 0 /news/hendon1-2whitstabletown-thisisthebestsquadwhitstablehaseverseensaysnickysouthall 2 47303 0 0 /archive-2006-2014/178 1 19236 0 0 /news/hopefullywecangetagoodresultinfrontofagoodcrowdsaysmaidstoneunitedbossjaysaunders 1 14833 0 0 /news/leaguepositionsinakentderbydontreallymattermuchsaysramsgatebosstimdixon 1 15229 0 0 /news/tunwells220105.html 1 0 0 0 /news/obrienhasnoproblemwithchathamtownbudgetcut 1 20885 0 0 /news/barrenrundentswhitstablesconfidence 1 14072 0 0 /news/greenwich130615 2 23514 0 0 /news/wellingunited1-1woking-forustoimproveweneedmorefanscomingsayswellingbossjamieday 1 25755 0 0 /news/didvcd150915 3 74288 0 0 /news/551bc5e778e23 2 15056 0 0 /archive-2006-2014/12 2 25635 0 0 /news/harrowborough0-1tonbridgeangels-theoddswereagainstustonightsaysstevemckimm 1 27177 0 0 /news/551bc5e4939b6 1 13672 0 0 /news/551bc5e4d8cba 1 11982 0 0 /news/551a9c92232fd 4 56975 1 1 /news/551bc99d2436b 2 23222 0 0 /news/gregoryupbeatuponhisreturnhome 1 15883 0 0 /news/551bc99dbe7a4/drmartens/eastern/folkestone/drmartens/eastern/sittingbourne/sittvburn081103.html 2 15653 0 0 /news/kentleague/cray/4thmar04.html 1 0 0 0 /news/thamesmeadtownbosskeithmcmahonunveilsmarklaneasgoalkeepercoach 1 14223 0 0 /news/hernebay0vcdathletic1exclusiveinterviews 1 19608 0 0 /news/lovelladmitstobeingleftinthedark 1 15706 0 0 /news/wereataveryadvancedstageofgetting15acresoflandsaysglebechiefrockymcmillan 1 16152 0 0 /news/crayhern290317 3 65005 0 0 /news/phoenixsports3-3dealtown7-8pensitsachancetogetournameonthemapsaysdarrenanslow 1 36566 0 0 /news/margateunveilnewstriker 1 10929 0 0 /drmartens/eastern/sittingbourne/27thjuly05.html 1 9955 0 0 /margate-2003-2006/4 2 28202 0 0 /news/whyteleafe270918 2 29784 0 0 /news/whitstabletown3-2worthing-itreallyisgoingtobeadog-fighttotheendsayspeternott 1 29803 0 0 /news/wellingunitedtoldtokeeptheirtaxpaymentsuptodate 1 19610 0 0 /news/hythe200405.html 1 0 0 0 /news/beckfish171018 1 34519 0 0 /news/bromley091216 2 17022 0 0 /news/theroadtowembleyitsfolkestoneinvicta 1 10264 0 0 /news/margate1-0ramsgate-hocktonwinsoneoverollietokeepplay-offhopesalive 1 23306 0 0 /news/wemustsetoursightshigher-beckingham 1 13774 0 0 /news/thebigkickoffcountusoutofthetitleracesaysmodestfisk-exclusive 1 14787 0 0 /news/soccershortsbeckenhamtownforcedtopostponevcdclashduetoburglaryatedenparkavenue 1 36182 0 0 /news/iwouldlovetosee3g4gpitcheseverywheresaysbexleyboroughbossliamkelly 1 20928 0 0 /news/hythetown2-2hernebay-titlerivalssettleforadraw 1 39387 0 0 /news/vickerswellequippedtowinkentleaguetitlesaysfoley-exclusive 1 15624 0 0 /news/kentleaguebeginsearchforanewsponsor 1 13658 0 0 /news/drmartens/eastern/sittingbourne/sittingbournevwhyteleafe130903.html 1 0 0 0 /news/551a9797f391b 1 5897 0 0 /news/551bc5ddb9ded 1 13960 0 0 /news/ksportsebbsfleet300619 1 10592 0 0 /news/551bc5dac03cf 3 23542 0 0 /news/welling281217 1 13139 0 0 /news/gillinghampartcompanywithstimson 1 12044 0 0 /news/anynewswillfollowhere 1 10574 0 0 /news/hytheheroesiwillbringtheladsbackdowntoearthintimeforfavasetriptovcdsaysporter 1 21488 0 0 /news/deal270718 1 12962 0 0 /news/hemelhempstead091019 1 11649 0 0 /news/551bc99dbe7a4/drmartens/eastern/erith&belvedere/conference/margate/margatevexeter160803.html 2 15653 0 0 /news/margatestatement181220 2 25041 0 0 /news/crowborough230617 1 11540 0 0 /news/ashford260616 1 15367 0 0 /national-league/26 2 25529 0 0 /news/tonbridgeangels2-1maidstoneunited-wewanttokeeptheseasonalivesayswarrilow 1 37519 0 0 /news/leatvbrom181003.html 1 0 0 0 /news/youdontwanttolosetoyourtenantssaysholmesdalecoachrossmitchell 1 13519 0 0 /news/othernews/SECWFL290204.html 1 0 0 0 /news/dartslookforwardtolucrativepre-season 1 19912 0 0 /news/werestillinwithachanceoftheplay-offssaysramsgatebosstimdixon 1 17047 0 0 /news/conference/gravesend/4thaug04.html 1 0 0 0 /news/kentseniortrophyfinalbeckenhamtown0-2thamesmeadtown 1 16507 0 0 /news/waltoncasuals1-2thamesmeadtown-ithoughtwewanteditmorethanthemadmitskeithmcmahon 1 26565 0 0 /news/drmartens/premier/welling/sutton131104.html 1 0 0 0 /news/othernews/26thaug03.html 1 0 0 0 /news/billshep141023 2 61523 0 0 /drmartens/ 1 2522 0 0 /news/fordwelcomesdevoncreaminlastsixteen 1 11211 0 0 /news/managersleftfrustratedasatrociousconditionsbatterengland 1 15101 0 0 /news/wedontwanttobelookingoverourshouldersayssittingbournebossjoedowley 1 13233 0 0 /news/glebedeal220817 1 32395 0 0 /news/craywanderersreflectonaproud150yearsoffootballinghistory 1 13545 0 0 /news/hythesitt271115 2 31066 0 0 /news/ryman/bromley/bromvmarl171203.html 1 0 0 0 /news/soccershorts200519 2 32331 0 0 /news/getustoyouropeningmatch 1 10998 0 0 /news/23rddec04.html 1 0 0 0 /news/iwanttotestmyselfallthetimesaysdartfordbosstonyburman 1 15841 0 0 /news/burmangiveshisdartfordsidetopmarksatoxford 1 14172 0 0 /news/trialistssayaurevoirtoinvicta 1 16569 0 0 /news/neilbell110318 1 11098 0 0 /news/551bc5db8d330 3 53663 0 0 /archive-2006-2014/282 2 23553 0 0 /news/erithandbelvedere130323 2 23269 1 1 /news/hythetown030123 3 32072 0 0 /news/551bc5e47aa6a 1 14673 0 0 /news/thepressuresbackontheplayerstogetaresultfortheclubsaystonbridgebossstevemckimm 1 15613 0 0 /news/hythetownunveilnewsponsorshipdeal 1 14057 0 0 /news/wevegottobeatteamslikesevenoaksinsistscordice 1 15181 0 0 /news/greenwich131104.html 1 0 0 0 /news/ramsreadytoupsetmuch-fanciedtrio 1 14509 0 0 /news/faversham260117 3 36913 0 0 /news/551bc99b59b70 1 6984 0 0 /news/551bc99dbe7a4/kentleague/sevenoaks/kentleague/sladegreen/23rdjuly03.html 2 15653 0 0 /news/knightgetsnodforswansshowdown 1 13297 0 0 /news/551a99e46a5e8 1 13813 0 0 /news/wevegotourfeetonthefloorsayscrayvalleybossstevechapman 1 17474 0 0 /news/sonnymilesdecidestoleavetonbridgeangelsafter12years 1 12314 0 0 /news/551bc99c5cee2 2 25600 0 0 /news/brridon080917 2 16309 0 0 /news/hernebay201122 2 34689 0 0 /news/kentleague/sladegreen/lordswood111204.html 1 0 0 0 /news/kentleague/maidstone/maidvslade251003.html 1 0 0 0 /news/ksports270722 1 12480 0 0 /news/firstteamwasaprioritythisseasonsaystonbridgeangelsnewkeeperkylemerson 1 12883 0 0 /news/crayassistantpaulbladeexpectstoughweek 1 13526 0 0 /news/suttonathletic010522 2 25042 0 0 /news/1stsept05.html 1 0 0 0 /news/rustking191023 5 134447 0 0 /news/wevegivenourselvesachancesaysmaidstoneunitedbossjaysaunders 1 18835 0 0 /news/slysettofollowfriendoncontract 1 16480 0 0 /news/crowborough130917 1 12604 0 0 /news/rusticscaptureblundellfromneighbouringwells 1 12668 0 0 /news/fleettown0-2ramsgate-ourwork-ratewasdifferentclasssaysquinn 1 37253 0 0 /news/imtalkingtoplayerstostrengthenmysquadfornextseasonsaysotfordunitedbossjimgillan 1 14817 0 0 /news/garystevensmyplansfortunbridgewells 1 15767 0 0 /news/mcdonnellreturnisboostforbromley 1 10997 0 0 /news/kfu171116 1 12809 0 0 /news/551a99e4b8a79 2 31542 0 0 /news/orpelm060516 1 31028 0 0 /news/itsgettinghardertosurviveinthekentleaguesaysgreenwichboroughbossstevefirkins 1 14345 0 0 /news/drmartens/eastern/chatham/26thfeb04.html 2 0 0 0 /news/17thmar05.html 1 0 0 0 /news/vcdathleticsettoappealafterrymanleaguerelegation 1 18752 0 0 /news/551bc99dbe7a4/conference/gravesend/ryman/bromley/bromvtoot230903.html 2 15653 0 0 /news/thepressureisoffusatgatesheadsaysdartfordbosstonyburman 1 21884 0 0 /news/tompkinsaddsfournewdockerstohissquad 1 14135 0 0 /news/wearedelightedtohaveobtainedtheservicesofstevemckimmsaystonbridgeangelschairman 1 13764 0 0 /news/abbottwantspositivereactionassix-gameruncomestoanend-exclusive 1 13505 0 0 /news/whyshouldiwanttoresign-hessenthaler 1 12996 0 0 /news/craywanderers0-2leatherhead-imustadmitwehadkeyplayersoutsaysianjenkins 1 22625 0 0 /news/551a96dca59d1 2 18938 0 0 /news/551a95b3c8112 2 15353 0 0 /news/wellingunited3-0dartfordpennockourattitudewasspoton 1 16794 0 0 /news/gravholm180917 1 13852 0 0 /news/551a956c94111 1 4829 0 0 /news/thisisthestartofourweekfromhell-burman 1 16956 0 0 /news/shepbeck220220 1 36908 0 0 /news/doverathleticyoungstershitthebigtimeandpasswithflyingcolours 1 13740 0 0 /news/crawleytownsnapupcroydonteenager 1 13983 0 0 /news/iwanttocontinuetowinthingsatbromleysayslong-servingtutuhenriques 1 18068 0 0 /news/hythetown201123 6 67847 0 0 /news/DorkingWanderers050820 3 30281 0 0 /news/suttonathletic0-2corinthian-therearentanynegativesfromtodaysaysmattlonghurst 2 38618 0 0 /news/551a95b467628 2 19553 0 0 /news/18thmay05.html 1 0 0 0 /news/fordlookstoinstillconfidenceintohisside 1 16470 0 0 /news/crayvalley121115 1 14763 0 0 /news/resultsseptember2023 4 184989 0 0 /news/551bc99dbe7a4/drmartens/eastern/ashford/drmartens/eastern/folkestone/folkvstam221103.html 2 15653 0 0 /news/erithtown0erithbelvedere4 1 11946 0 0 /news/reallypleasedtobebacksaysnewly-appointeddealtownbossdarrenanslow 1 12669 0 0 /news/ebbsfleet010720 1 10837 0 0 /news/kingstonian2-3ashfordtown-ashfordstunleagueleaders 1 20896 0 0 /news/takalooreturnstoramsgate 1 13134 0 0 /news/werepunchingaboveourweightadmitshigh-flyingjones 1 14733 0 0 /news/favershamunveilfournewsigningstostrengthensquad 1 21844 0 0 /news/normannetsinhomecountyagain 2 27236 0 0 /news/sct230916 1 13957 0 0 /news/fixtureswc13thmarch2006 1 13914 0 0 /news/bearbans170821 2 37732 0 0 /news/ashfordtownsettounveilrecordsponsorshipdeal 1 11980 0 0 /news/hendon0folkestoneinvicta0 1 12934 0 0 /news/551bc99dbe7a4/drmartens/eastern/sittingbourne/kentleague/maidstone/10thjuly03.html 2 15653 0 0 /isthmian-league/32 3 45370 0 0 /news/551a97b0f06d7 2 31330 0 0 /news/ramsgate190205.html 1 0 0 0 /news/othernews/6thoct03.html 1 0 0 0 /news/canterburycity120419 1 13517 0 0 /news/erithholmlew221015 1 13679 0 0 /news/29thaug05.html 1 0 0 0 /news/weveshotourselvesinthefootadmitsmaidstoneunitedbossjaysaunders 1 16802 0 0 /news/iwillnotallowamanagertobehoundedoutsaysdoverchairmanjimparmenter 1 15492 0 0 /news/folkestoneinvicta1-0whitstabletown-fumingmundaywevebeenletdownbytheofficialsagain 1 23787 0 0 /news/551bc5e586c7d 1 16569 0 0 /news/551bc5e2645ce 1 13989 0 0 /news/transferembargosettosinkfish 1 12645 0 0 /news/551bc5e622e8d 1 12346 0 0 /news/lewisham060917 1 12851 0 0 /news/wellgivesomeoneahammeringsoonwarnslovell-exclusive 1 15446 0 0 /news/maidstoneunited2-2harrowborough-sloppydefendingcostusthepointsadmitshume 1 19246 0 0 /news/thebigkickoffwhitstabletown2-2eastbournetown-weunderachievedtodayadmitsseager 1 23074 0 0 /news/17thapr05.html 1 0 0 0 /news/bromley1-2dartford-wehavetowinallthreetostayupsaysbromleycoachneilsmith 1 26615 0 0 /news/wewanttofinishashighaswecansaystonbridgeangelsbosstommywarrilow 1 14185 0 0 /news/fromtheeditor 1 10197 0 0 /news/wp-includes/fonts/wp-login.php 1 0 0 0 /news/rusttunb131121 5 150045 1 1 /news/hytheheroesstainescouldntcopewithus 1 29056 0 0 /news/backingboroughtowembleyminnowsfeelhungerforwhitleybayshowdown-exclusive 1 17466 0 0 /news/craywanderers140122 3 31774 0 0 /news/hessenthalerthegoodtimesarecomingbacktodover 1 14605 0 0 /news/hythefolk271215 2 63868 0 0 /news/peckcroy240421 6 208322 0 0 /news/beckenham291120 4 52370 0 0 /news/alexobrienrelishingkingstoniantest 1 15673 0 0 /news/551bc5dcbd041 3 33299 0 0 /news/551a92507d611 1 4082 0 0 /news/harrowborough2-1tonbridgeangels-allgoodthingscometoanendadmitswarrilow-exclusive 1 19921 0 0 /news/551a96786698b 2 17562 0 0 /news/obviouslywedliketofinishhigherthantenththisseasonsaysfisherbossstevefirkins 1 16391 0 0 /news/551bc99dbe7a4/drmartens/eastern/dartford/drmartens/eastern/folkestone/folkvfishlgecup111103.html 2 15653 0 0 /news/mcshanewillnotletusdowninsistsdaish 1 12071 0 0 /news/craysitt131217 2 46915 0 0 /news/ramsgate050420 3 27584 0 0 /news/kentleague/maidstone/14thjan04.html 2 0 0 0 /news/fisher261116 1 13211 0 0 /news/dulwmarg281115 2 71121 0 0 /archive-2006-2014/249 1 19583 0 0 /news/15thsept05.html 2 0 0 0 /news/weregoingtogiveitourbestshot-oconnell 1 15569 0 0 /news/wewanttogouptotherymanleaguesayshernebaychairman 1 16864 0 0 /drmartens/premier/welling/12thmay05.html 1 9955 0 0 /news/itsgettingdarkatramsgate-exclusive 1 15088 0 0 /news/drmartens/eastern/sittingbourne/banburyvsitt111003.html 1 0 0 0 /news/tunbridgewells5-2favershamtown 1 10661 0 0 /news/tonbridge230218 2 26058 0 0 /news/whitstable280320 2 29365 0 0 /news/weoweworthingoneinsistsmaidstoneunitedbossjaysaunders 1 13588 0 0 /news/1stjuly03.html 2 0 0 0 /news/kentleaguethamesmeadreceivepositivefeedbackafterrymaninspection-exclusive 1 24046 0 0 /cray-2003-2006/2 3 32737 0 0 /news/vitalwineasespressureoffmilesandhisfamily-exclusiveinterview 1 13021 0 0 /news/binkskeepfaithsfaithwithlocalplayersintheirnewsurroundings-exclusive 1 16070 0 0 /news/burmanswoopsforfolkestoneskipperflanagan 1 16160 0 0 /news/551a97b1ee2f9 1 15376 0 0 /news/11thoct04.html 1 0 0 0 /news/werereallyworkinghardtopullourselvesupthetablesayserithtownbossenniogonnella 1 12931 0 0 /news/francisplotsrevenge 1 12490 0 0 /news/lyddtown081217 2 15435 1 1 /news/angelscompletecadeloansigning-exclusive 1 15506 0 0 /news/551bc5e128b95 1 14356 0 0 /news/21stjuly05.html 1 0 0 0 /news/itstimefortheclubandustoseekanewdirectionsayswalker 1 22113 0 0 /news/wemustimproveourhomeformsaysmartin 1 11970 0 0 /news/ramsgatevhythe120803.html 1 0 0 0 /news/551bc99dbe7a4/drmartens/eastern/erith&belvedere/kentleague/whitstable/7thnov03.html 2 15653 0 0 /news/crosbieunveilsashfordtownsvisionforthefuture 1 14437 0 0 /news/leaguesurvivalcomesbeforecupglorysaysward 1 15696 0 0 /news/starscomeoutforabbottsbenefitmatch 1 10480 0 0 /news/551a9677b31f4 3 31096 0 0 /news/drmartens/premier/welling/23rdsept03.html 1 0 0 0 /news/footballassociationringsthechanges 1 13168 0 0 /news/facupfirstrounddrawdoverathletic90minutesawayfromgillinghamshowdown 1 15583 0 0 /news/wecanattractbetterplayersifwegoupsaysfleetleisurebossleerichmond 1 15839 0 0 /news/weneedtoplaymoreofthefootballwerecapableofsaysfolkestoneinvictabossneilcugley 1 15264 0 0 /news/tunwells011216 1 13684 0 0 /news/facupspecialthisisgoingtobeouryearsaysexcitedwalker 1 16527 0 0 /news/iwanttoprogressandbuildacareerinfootballsaysjohnovard 1 11839 0 0 /news/sittingbourne250222 2 29751 0 0 /news/wevegottoputourdisappointmentbehindusvowssmith 1 13403 0 0 /news/drmartens/eastern/dartford/8thaug04.html 1 0 0 0 /news/margate060917 2 27136 0 0 /news/iwillleavenostoneunturnedtomakesurewerepreparedforknaphillsaysjasonlillis 1 12240 0 0 /news/soccershorts220516 2 39580 0 0 /news/rochester110917 1 11770 0 0 /news/eightymillionquid-ifonlywehadthatinthenon-leaguegame 1 32852 0 0 /news/kingstonian2-0craywanderers-itwillkillmeifwedontgoup-jenkins 1 20370 0 0 /news/wellingtown.co.uk 1 0 0 0 /news/fishtunw050115 1 30344 0 0 /news/ifwecaneliminatethepersonalmistakeswewillturnitaroundsaysgreenwichboroughboss 1 13320 0 0 /news/theprizemoneyisveryimportanttoallclubsatourstandardsaysramsgatebosstimdixon 1 14627 0 0 /news/greenwichboroughchosentokick-offitvsportsfacupcoverage 1 14407 0 0 /news/wedontknowwhattoexpectfromnortonadmitsluchford 1 15093 0 0 /news/lewishamboroughunveilwillieosullivanastheirnewmanager 1 12085 0 0 /news/smithiwanttotestmyselfatahigherlevel 1 13871 0 0 /news/x-2 1 10522 0 0 /news/corinthian281016 1 12429 0 0 /news/wejustneedtobealittlemoreconsistentadmitssittingbournebossnickdavis 2 18207 0 0 /news/551bc5e8a7b19 1 11423 0 0 /news/551a979b20616 1 5607 0 0 /news/551a956d028f0 1 6072 0 0 /news/wecantaffordthebignamessayshythebossfisk 1 14703 0 0 /news/folkestone310517 2 32414 0 0 /news/coneyhallsearchfornewreserveteammanager 1 11195 0 0 /news/551bc99dbe7a4/nationwide/gillingham/kentleague/greenwich/greenvslade281003.html 2 15653 0 0 /news/soccershortscorinthianunveilcoachmattlonghurstastheirnewmanager 1 29194 0 0 /news/kentleague/tunbridgewells/11thoct04.html 1 0 0 0 /news/hernebaylosepointsafterfloodlighttrophywin 1 10951 0 0 /news/wecanttakeoureyeoftheleagueafterlastyearsaysbromleycoachneilsmith 1 17272 0 0 /news/ontheairwavesdaishslamsleagueforforcingthemtoplaytwicein43hours 1 22415 0 0 /news/erithtown4-1hythetown-dockersfight-backleavesfiskspeachless 1 21743 0 0 /news/551a956cc3825 1 6415 0 0 /news/4thfeb05.html 1 0 0 0 /news/hollgleb250215 1 30719 0 0 /news/kentleaguechallengeshielddockersfacefighttolandwood 1 17181 0 0 /news/maidstoneunited1-1aveley-takeoverhascreatedabuzzaroundtheclubsayspeternott 1 27935 0 0 /news/margatedelightedtoannouncenewchairman 1 10884 0 0 /news/othernews/YL280104.html 1 0 0 0 /news/tunwells290116 1 12961 0 0 /news/sceflstatement100420 1 13020 0 0 /news/burmanrelishingstonesshowdown 1 16055 0 0 /news/letsruinplay-offchasinggodalmingsnight-obrienaschatsoffermumandmeforafiver 1 19111 0 0 /news/551bc5e6cce32 1 15207 0 0 /news/tunbridgewells2-0sevenoakstown-imveryproudofthemsayswellsbossmartinlarkin 1 24567 0 0 /news/24thoct05.html 1 0 0 0 /news/drmartens/eastern/folkestone/harrowcup1021004.html 1 0 0 0 /news/doverathletic5-0chathamtown 1 13623 0 0 /news/burmanurgesfanstoraisetheroof 1 14014 0 0 /news/afccroycor091215 1 34888 0 0 /news/sampsonretirementsampsonvowstoreturntokentfootballmanagement 1 13088 0 0 /news/sheppeyunited250321 2 18904 0 0 /news/ryman/bromley/suttonreplay201004.html 1 0 0 0 /news/vcdathletic0erithbelvedere1 1 12027 0 0 /news/551a95b378a8d 2 14799 0 0 /news/jenkinswantstoleadwandsintofirstround 1 16688 0 0 /news/folkestonebossneilcugleypleasedwithplayersfitnesslevels 1 17723 0 0 /news/snodlandtown300619 2 15038 0 0 /news/551bc5e7e7b65 1 11984 0 0 /news/551a9250cca0b 3 20708 1 1 /archive-2006-2014/209 1 19939 0 0 /news/wereworkinghardtoimproveourhomeformsaysdoverathleticbossnickyforster 1 17063 0 0 /news/thamesmeadtown5maidstoneunited2-barnesinhotdemand-exclusiveinterview 1 19385 0 0 /news/wellbuildourfoundationsaroundmcdonnellsaysgoldberg 1 12427 0 0 /news/illbeastupidpersontosaywellwinthekentleaguenextyearsayscrayvalleycoachjoeford 1 13967 0 0 /news/551a9798cee2e 1 4838 0 0 /news/sutton020218 1 13285 0 0 /news/dulwicharethefavourites-thepressureisonthemsayshythetownbossscottporter 1 14156 0 0 /news/itwontbegrimupnorthsaysbinks 1 15501 0 0 /news/wedontwanttobestrugglingagainstrelegationnextyearsayslane 1 20053 0 0 /news/kentleague/thamesmead/thamvslad210204.html 1 0 0 0 /news/lordswood3-1westwickham-robnormanisgoingtobeastarinthemakingsaysjasonlillis 1 21763 0 0 /news/itsvitalwestartpickingupsomepointssayswellingunitedbossjamieday 1 17043 0 0 /news/bromleymanagementteamquitoveruncertaintyathayeslane 1 14833 0 0 /news/in-formmargateprepareforironsvisit 1 14365 0 0 /news/1stdec03.html 1 0 0 0 /news/theresnootherkentleaguemanagerthatdoeswhatstevefirkinsdoessaysbillywalton 1 16721 0 0 /news/folkestoneinvicta261022 2 28051 0 0 /news/20thoct04.html 2 0 0 0 /news/fcelmstead140719 1 13366 0 0 /news/glebe070220 1 12660 0 0 /news/itsalwaysatoughencounteratdealsaysbeckenhamtownbossjasonhuntley 1 15470 0 0 /news/19thsept03.html 1 0 0 0 /news/chatcamb150918 1 31818 0 0 /news/play-offsemi-finalspecialwemusthandlethetensionsaysfrancis 1 19179 0 0 /news/beckheyb130922 6 172465 0 0 /news/farnieweneedmoreleaguepointsbeforetrophyfinalexclusive 1 16862 0 0 /news/dover150618 1 13656 0 0 /news/tunbridgewells2-5kennington-iwanttofollowinmybrothersfootsteps-exclusive 1 18992 0 0 /news/rusthall050821 1 13276 0 0 /southern-counties-east-football-league/52 1 20173 0 0 /news/shockassussexfootballercollapses-andlaterdies-duringmatch 1 11373 0 0 /news/normanshunsmovetodartford 1 18180 0 0 /news/theseareexcitingtimesforphoenixsportssayschairmanandymortlock 1 12615 0 0 /news/greenwichborough3-2tunbridgewells-weneedtotakeourchanceswhenwereontopsayslarkin 1 37863 0 0 /news/hythe060905.html 2 0 0 0 /news/stagingmargatewasamassivelearningcurveforpromotionchasingwhitstable-exclusive 1 19124 0 0 /news/doverathleticacceptthirdbidforstarstrikeradambirchall 1 11508 0 0 /news/rusticsentersideinkentyouthleague 1 10840 0 0 /news/551a979a1b2b5 1 5177 0 0 /news/ithinkourluckwillrunoutatsomestagewarnscugley 1 17726 0 0 /news/kentleague/whitstable/whitstablevlordswood130903.html 2 0 0 0 /news/551bc99e4fd4f 2 44297 0 0 /news/551a96dc3f653 3 44521 0 0 /news/551a9c9257f07 3 47349 0 0 /news/soccershortstheprospectsarelookinggoodsaysashfordtownbosstonyreynolds 1 25635 0 0 /news/craywands241117 2 17539 0 0 /news/sceneissetforvickersoakwoodhomecoming 1 10668 0 0 /news/wemustnotmessaboutinourplay-offquestsaysburman-exclusiveinterview 1 13984 0 0 /news/tonbridgeangelsprovethattheirdiamondgeezers 1 13961 0 0 /news/holmesdale0-5corinthian-fingerscrosseditmightbethirdtimeluckysaysmattlonghurst 1 28342 0 0 /news/551a97b2058ae 1 27715 0 0 /news/holmgrav160917 1 12335 0 0 /news/551bc5e1d6673 2 18756 0 0 /news/dealcanterbury280217 1 12464 0 0 /news/hernebay1-3wellingunited-weneedbiggatestokeepmysquadtogethersaysday 1 32918 0 0 /news/dartford070521 5 50815 0 0 /news/canterbury041215 1 12853 0 0 /news/wemustplaybettertoprogressinfacupsaysgorman 1 16532 0 0 /news/.well-known/pki-validation/css.php 1 0 0 0 /news/commentenglishfootballisinmourningoverworldcupdefeatstorussiaandqatar 1 11501 0 0 /news/abruzi.php 1 0 0 0 /news/itisveryclearforalltoseewhereourproblemsliesayswhitstabletownbossjustinluchford 1 12903 0 0 /news/thamfave190818 4 81621 2 2 /news/9thmay04.html 1 0 0 0 /news/cablebrothersreturntothamesmead 1 11402 0 0 /news/551a967789393 2 17232 0 0 /news/erithtown280222 4 47182 0 0 /news/theroadtowembleyhytherelishingreturntothebig-stage-exclusive 1 16697 0 0 /news/18thfeb05.html 1 0 0 0 /news/dorksitt221215 2 52119 0 0 /news/vickersleftinthedark 1 15533 0 0 /news/dulwich171016 2 22788 0 0 /news/ramsshep071023 3 95272 1 1 /news/erithtownbosssteveoboyleswoopsforexperiencedcampaignerlewwatts 1 18098 0 0 /news/hernebayscrackingrunhasspurredmyboysonsayslordswoodbossjasonlills 1 14503 0 0 /news/wivenhoe121105.html 1 0 0 0 /news/bearsteadu18120904.html 1 0 0 0 /news/deal290718 1 14982 0 0 /news/charlton200320 3 28899 0 0 /news/dealtown310820 1 13370 0 0 /news/tunbgleb150322 4 146606 0 0 /news/551a931e22359 1 10851 0 0 /news/burmancursinghissidesbadluck 1 17301 0 0 /news/sittingbourneenticejamiecoylebackfromwellingunited 1 12203 0 0 /news/itsatwo-yearplanandwereaheadofschedulesayssittingbournejoint-bossjimward 1 12036 0 0 /news/hernebayL260416 2 22912 0 0 /news/blyspartans0-0suttonathletic-wevenotlostthetitletodaysaysblyspartansbossmatthume 1 24391 0 0 /news/letsmakeitamemorabledayforkentfootball 1 10382 0 0 /news/fisher270716 1 12891 0 0 /news/resurgentfolkestoneannouncedealwitheurotunnel 1 15999 0 0 /news/bromley130217 2 20768 0 0 /news/lewes240421 5 65855 0 0 /news/16thnov03.html 1 0 0 0 /news/drmartens/premier/welling/4thjuly04.html 1 0 0 0 /news/wecertainlywontbegoingtoplymouthwithanyfearsayswellingunitedcoachdeanfrost 1 16532 0 0 /news/atriptoleistoncantcomequickenoughformesaysjoefrancis 1 14255 0 0 /news/wevegottogetourselvesoutoftherelegationmiresaysmunday 1 14729 0 0 /news/lovelliknowwhattoexpectfromborehamwoodtonightexclusive 1 13034 0 0 /news/tunbridgewells2-0erithtown-fullersdoublekeepswellsinline 1 13703 0 0 /news/551bc5e8aab02 1 11772 0 0 /news/arlesey140804.html 1 0 0 0 /news/charltonathletic250920 4 29669 0 0 /news/beckcamb230422 6 155358 1 1 /news/deres160705.html 1 0 0 0 /news/hollashf130116 1 27652 0 0 /news/551bc99e2629b 2 20809 0 0 /news/551bc5dc0a6e1 2 22575 0 0 /news/Harlow210804.html 1 0 0 0 /news/craywanderersp-pchipstead 1 10743 0 0 /news/erithbelvedere6-1sladegreen-theagonyandtheecstacy-exclusives 2 28404 0 1 /news/glebe080818 1 12544 0 0 /news/ramsgatemanagernominatedforprestigiousbbcsportsaward-exclusive 1 13937 0 0 /news/charalambousreturnstomargate 2 15457 0 0 /news/whitstabletown2-2leatherhead-theresalottobuildonsaysnewbosspeternott 1 31449 0 0 /news/551bc99aba30e 2 16877 0 0 /folkestone-2003-2006/www.heineken.co.uk/ 1 3215 0 0 /news/bstortford120305.html 1 0 0 0 /news/bromley201119 2 19052 0 0 /news/itsthelowestivefeltforawhilesaysdartfordbosstonyburman 1 14432 0 0 /archive-2006-2014/13 2 25979 0 0 /news/551bc5df707d7 1 12170 0 0 /news/kentleague/cray/1stsept03.html 1 0 0 0 /news/551a9798cada1 1 4789 0 0 /news/hythrams281023 3 26485 0 0 /news/tenapplyforvacantdoverjob 1 14347 0 0 /news/mundaytargetspreciouspoints 1 15394 0 0 /news/holmesdalewelcomestarsfromthepast 1 13357 0 0 /news/551a9c0e374ce 2 17219 0 0 /news/wardwantstoremainintopfive-exclusiveinterview 1 13224 0 0 /news/.seo.php 1 0 0 0 /news/afccroydonathleticA170120 1 13539 0 0 /news/coneyhallappointlong-servingallenasnewmanager 1 12313 0 0 /news/3rdJuly05A.html 1 0 0 0 /news/tonbridgeangels2-3burytown-itakefullresponsibilityitwasntgoodenough-warrilow 1 36795 0 0 /news/sittingbourne111116 2 24256 0 0 /news/kentleague/deal/Sampson6.html 1 0 0 0 /news/wp-admin/js/widgets/about.php7 1 0 0 0 /news/551bc99dbe7a4/kentleague/sladegreen/kentleague/maidstone/25thaug03.html 2 15653 0 0 /news/551bc5e852909 1 14340 0 0 /news/hythe180616 3 30560 0 0 /news/dealtown030217 1 11985 0 0 /news/dalersbossdismissestitletalk 1 16521 0 0 /news/kentleague/sladegreen/sladevdeal270903.html 1 0 0 0 /archive-2006-2014/172 1 19191 0 0 /news/bearsted090717 1 12887 0 0 /news/wp-content/plugins/fox/css.php 1 0 0 0 /news/551bc99dbe7a4/kentleague/ramsgate/kentleague/thamesmead/10thoct03.html 2 15653 0 0 /news/iwouldbeatragedyifakentclublosestheirrymanleaguestatussaystommysampson 1 17699 0 0 /news/tonbridge010916 2 26245 0 0 /news/551a97b12a889 1 14027 0 0 /southern-counties-east-football-league/27 1 20340 0 0 /news/weregoingforatrebletoosaysmcmahon-exclusiveinterview 1 12888 0 0 /news/notthastheenergyandthedrivesaysstoneschairman 1 14829 0 0 /news/551a95b43e5f8 2 18472 0 0 /news/dartfordincludedinenglands2018worldcupbid 1 12364 0 0 /archive-2006-2014/262 1 18996 0 0 /news/ramsgatechairmanfearsthedropfollowingfour-pointdeduction 1 12942 0 0 /news/stainestown4-1sittingbourne-weredisapointedthatwehaventgotadrawadmitsmattwyatt 1 26020 0 0 /news/551a956b73d30 3 24642 0 0 /news/551bc99dbe7a4/drmartens/eastern/dartford/kentleague/thamesmead/thamesmeadvramsgate160803.html 2 15653 0 0 /news/551bc99ad3083 2 19910 0 0 /news/ryman/bromley/18thsept04.html 1 0 0 0 /news/thamesmead090618 2 29967 0 0 /news/gillsatwembleyletsmakeitadaytoremember-fuller 1 15424 0 0 /news/doverathleticchairmantofundnewcentrespot 1 15642 0 0 /news/stansfeld140122 1 13735 0 0 /news/erithbel201017 1 14134 0 0 /news/24thjuly04.html 1 0 0 0 /news/31stJan04.html 1 0 0 0 /news/MPStatement271120 3 32062 0 0 /news/FAStatement240721 2 26467 0 0 /news/injury-hitsevenoaksaimtobounceback 1 12962 0 0 /news/rusticslookforwardtofivelocalcupfinals 1 12353 0 0 /news/551bc5dd46f0f 2 17515 0 0 /news/afccroydon281217 1 13054 0 0 /news/chairmanleadstributesforsadloss 1 12143 0 0 /news/551bc99dbe7a4/kentleague/erithtown/kentcounty/15thdec03.html 2 15653 0 0 /news/deal020405.html 1 0 0 0 /news/greenwich250118 3 35507 0 0 /news/itwouldbenicetogetintotheplay-offzoneatthisstageoftheseasonsaysfavershamtownboss 1 21219 0 0 /news/itwillbethebiggestnightforabouttenyearssaysfisherbossbillywalton 1 18345 0 0 /news/falanaurgestonbridgefaithfulweneedyoursupportexclusiveinterview 1 13143 0 0 /news/dealkenn081023 1 29825 0 0 /news/kentleague/cray/croydon171104.html 1 0 0 0 /news/holmwell061119 1 39164 0 0 /news/fatrophyspecialwardforcedtooffloadonestriker 1 14398 0 0 /news/sevewhit200819 2 58522 0 0 /news/deallydd280718 3 52529 1 0 /news/551bc99b1d955 2 15206 0 0 /news/sittingbourne1-1waltoncasuals-iknewtheplayerswouldntletmedowntonightsaysbrady 1 20950 0 0 /news/collholl020920 2 35478 0 0 /news/ashfordgivepetersachancetoimpress 1 11640 0 0 /news/soccershortskentclubsstartmakingearlysignings 1 20534 0 0 /news/hythe190615 3 27526 0 0 /news/collinsbeatsoffcompetitiontolandstrikerpowell 1 13431 0 0 /news/551a9cf510d22 3 42135 0 0 /news/imdelightedtobegiventhechancetocarryonsaysmaidstoneunitedbossjaysaunders 1 13751 0 0 /news/rochesterunited100222 1 12856 0 0 /news/ramsgate300123 6 38099 3 3 /news/imdelightedtobebacksaysbinks-exclusive 1 15693 0 0 /news/551a979b1bc3c 1 4969 0 0 /news/551bc5e6a760b 1 21887 0 0 /news/craybogn070922 3 62814 0 0 /news/soccershortsneilcugleytakeschargeoffolkestoneinvictaforthe900thtime 2 54487 0 0 /news/weacceptourswitchtothenortherndivisionsayschathamchairman 1 14106 0 0 /news/charltonathletic2-1queensparkrangers-wevehadquiteasuccessfulseasonsaysstuartweston 2 40108 0 0 /news/basingstoketown2-2dartford-weredisappointedcomingawaywithonlyonepointadmitsburman 1 25691 0 0 /news/551bc99dbe7a4/drmartens/eastern/chatham/kentleague/tunbridgewells/14thaug03.html 2 15653 0 0 /news/wellbelookingtowineverythingsaysdoverchairman 1 14090 0 0 /news/folkestoneinvictabossneilcugleyhasfourplayersmissingforseasonopener 1 15384 0 0 /news/theclubsgrownandwevegrownwiththeclubinoursixyearsinchargesaysgavinrose 1 14878 0 0 /news/drmartens/eastern/ashford/28thjuly04.html 1 0 0 0 /news/croydon030921 1 12308 0 0 /news/stainvcd160216 3 63307 0 0 /news/551a97b0c9a92 2 43772 0 0 /news/551bc99dbe7a4/kentleague/hernebay/kentleague/whitstable/7thjuly03.html 2 15653 0 0 /news/metropolitanpolice1ramsgate0sat29thapril2006 1 18801 0 0 /news/resultsdecember2018 3 102175 0 0 /news/sladevgreen140204.html 1 0 0 0 /news/othernews/AEI070904.html 2 0 0 0 /news/isthmianleaguestatement031220 3 25933 0 0 /news/chatham010516 3 25270 0 0 /news/sittingbourne270320 2 25367 0 0 /news/551bc99a9fca8 2 15628 0 0 /news/tonbridge290805.html 1 0 0 0 /news/stroutsisthemissingpieceinthejigsawsaysseager 1 14784 0 0 /news/barrbrom180120 2 41331 0 0 /news/facarlsbergtrophydrawitsagreatdrawforthefanssayshessenthaler 1 15702 0 0 /news/canterbury120718 1 11893 0 0 /news/551bc5e6093af 1 13196 0 0 /news/holmesdale041215 1 15280 0 0 /news/holmcori200116 1 10770 0 0 /news/tunbknap170919 1 31973 0 0 /news/FAV3rewview121204.html 1 0 0 0 /archive-2006-2014/288 2 22306 0 0 /news/jasonlillis290819 1 14845 0 0 /news/bromley110615 3 21212 0 1 /news/lewisissuesbattlecrytoturnaroundstonesseason 1 12682 0 0 /news/dartsirving280415 2 23907 0 0 /news/14thjan04.html 1 0 0 0 /news/NationalLeagueStatement141220 2 13764 0 0 /news/lewesmarg230119 2 53480 0 0 /news/551a925036de5 2 16008 0 0 /news/551bc5d990ad9 4 31430 1 0 /news/myladswillgiveeverythingtostayupsaysfolkestonebossneilcugley 1 18045 0 0 /news/martinhayesunveilsloantransferofstrikerjonmain 1 16482 0 0 /news/fisherbeck271216 1 33774 0 0 /news/iwantdistancebetweenusandthestonessaysjenkins 1 14477 0 0 /news/drmartens/premier/welling/6thoct03.html 1 0 0 0 /news/ashfordunitedmustplaythewaitinggame 1 15927 0 0 /news/551bc99dbe7a4/conference/gravesend/ryman/bromley/bromvgraysfr090803.html 2 15653 0 0 /news/gateshead3-0dartford-theresnodisgracelosingtogatesheadsaysprouddartsbosstonyburman 1 25652 0 0 /news/3rdjune04.html 1 0 0 0 /news/10thjan05.html 1 0 0 0 /news/drmartens/eastern/ashford/10thaug04.html 2 0 0 0 /news/sitthythe191116 2 71624 0 0 /news/theplayerswillwanttoputthingsrightsaysfolkestoneinvictabossneilcugley 1 16029 0 0 /news/stevenshopefuloftyinguptunbridgewellsdeal 1 13682 0 0 /news/551bc99babdde 1 4740 0 0 /news/craywanderers2-0burnhamramblers-wevegottoturnthisclubaroundsaysmichaelpaye 2 34178 0 0 /news/ashfordunited090620 3 29546 0 0 /news/holmesdale311020 2 15998 0 0 /news/8thaug04.html 1 0 0 0 /news/xo.php 1 0 0 0 /news/fiskwantstoturnreachfieldsbackintoafortress 1 13181 0 0 /news/551a9cf4e236e 2 16025 0 0 /news/25thjuly05.html 1 0 0 0 /news/crayvalley1-3raynesparkvale-itsnotlookinggoodformeatthemomentadmitspaulgross 2 37102 0 0 /news/fadoubleheader080515 2 16571 1 1 /news/westwickvbrom290204.html 1 0 0 0 /news/tenterden211018 1 15086 0 0 /news/stoptalkingaboutmybudgetsayswarrilow 1 17301 0 0 /news/razorruddockhastheedgeforfaversham 1 11064 0 0 /news/wehavetobeatourbesttobeatfavershamtownsaysmaidstoneunitedbossjaysaunders 1 19237 0 0 /news/drmartens/premier/dover/8thsept04.html 1 0 0 0 /news/craywanderers2-3bromley-wewanttofinishourjourneywithwinnersmedalssayshaydenbird 1 36114 0 0 /news/wp-content/plugins/envato/css.php 1 0 0 0 /news/wellingunited070619 2 16279 0 0 /news/erithtown11062018 1 13042 0 0 /news/NationalLeagueStatement021220 2 14765 0 0 /news/551a931da5f08 1 11429 0 0 /news/maidstone220619 1 11300 0 0 /news/raynesparkvale3-3greenwichborough-playersarepointingthefingerofblamesaysfirkins 1 26805 0 0 /news/drmartens/eastern/fisher/7thjuly04.html 2 0 0 0 /news/15thjune04.html 1 0 0 0 /news/wellingtown300519 1 11386 0 0 /news/HarrVCD240315 2 60207 0 0 /news/wimbebbs261115 1 26927 0 0 /news/erithandbelvedere290220 1 12966 0 0 /drmartens/premier/welling/4thjan05.html 1 9955 0 0 /news/horsham1tonbridgeangels0-dolbygoalscoringisamassiveproblemforus 1 15334 0 0 /news/folkestoneinvictaunveilsteveharpersigning 2 18437 0 0 /news/wearecurrentlyinthetransitionofmovingtheclubtothenextlevelsaysjamescollins 1 15036 0 0 /news/craywands280617 3 31621 0 0 /news/clubownerjerrydolkewillbackusallthewaysaysbromleycoachneilsmith 1 19106 0 0 /news/thechairmanwasconvincediwasnttherightpersonforthejobsaysaxedjamescollins 2 30452 0 0 /news/newsigningisamassiveboostforusgoingintoareallyimportantweekendsaysmickycollins 1 14052 0 0 /news/werenotfeelinganypressuresayscugley 1 14014 0 0 /news/imlisteningtoofferssaysbowden-brown 1 12781 0 0 /news/beckenham041204.html 1 0 0 0 /news/juniordian120715 2 35617 0 0 /news/trottsatisfiedwithopeningwarm-up 1 11311 0 0 /news/myplayersbottleditandletmedownbigtimeragesmcmahon-exclusiveinterview 1 17882 0 0 /news/invictawanttoendreplaymiseryatparkviewroad 1 17506 0 0 /news/551bc5e91b290 1 14575 0 0 /news/thestandardssetwerenotmaintainedandthatsnotgoodenoughformesaysrayturner 1 17066 0 0 /news/chatsitt060217 3 83109 0 0 /news/supportersbidtogetfolkestoneinvictabackonitsfeet 1 12848 0 0 /news/scthamesmead230519 1 13163 0 0 /news/551a95b3ac4fc 3 18313 1 1 /news/551a96dbc8aa6 1 5913 0 0 /news/theresnoreasonwhywecantbeattheleagueleaderssayscugley 1 17819 0 0 /news/551a96770f7f3 3 33415 0 0 /news/fordpraiseshisshininglights 1 17464 0 0 /news/tonbridgeangels2-1ramsgate-sellingrookwasprudenthousekeepingsaystonbridgechairman 1 38379 0 0 /news/16thjuly03.html 1 0 0 0 /news/kentleague/beckenham/sladegreen180904.html 1 0 0 0 /news/551bc99a72e60 2 20765 0 0 /news/whitstabletownpartcompanywithbossjustinluchford 1 11662 0 0 /news/tunwells150105.html 1 0 0 0 /news/walkerwantshegleytostay 1 12432 0 0 /news/lossoftrainingfacilitiessentusintofreefallreflectsobrien 1 15129 0 0 /news/punjab011017 1 12582 0 0 /news/551a9c92b0d4a 2 15633 0 0 /news/vickersunveilcaptureofexcitingyoungprospect 1 11973 0 0 /news/craysoh130316 3 67844 0 0 /kent-invicta-league/11 3 43739 0 0 /news/under21youthleaguesettoexpandnextseason 1 14429 0 0 /news/werelikeawoundedanimalatthemomentsovcdbetterwatchoutwarnsjustinluchford 1 13548 0 0 /news/stonessetupdonationfacilitytoassistwithnewstadium 1 12648 0 0 /news/551bc99dbe7a4/kentleague/thamesmead/ryman/bromley/bromvkingsfr290803.html 2 15653 0 0 /southern-counties-east-football-league/17 1 20349 0 0 /news/ebbsfleet290620 1 12966 0 0 /news/folkestoneinvictafansamjonesrunslondonmarathoninmemoryofpaulsykes 1 15512 0 0 /news/balhcray090518 5 99230 1 1 /news/damianscannel011017 3 29265 0 0 /news/coneyhallbeginsearchtofindtheirfifthmanagerin2006-exclusiveinterview 1 13813 0 0 /news/551bc5df9bfe8 1 12989 0 0 /news/551a99e465960 1 12056 0 0 /news/551bc5e5dc00a 1 14113 0 0 /news/leytonorient081104.html 1 0 0 0 /news/phoenix070918 3 28305 0 0 /news/ifiwasagamblingmanidputouropeninggamedownasadrawsaysfisherbossstevefirkins 1 15985 0 0 /news/messagefromtheeditor 1 9959 0 0 /news/erithbelvedereunveilthesigningofjohnwilfort 1 16077 0 0 /news/iwanttofindaladandfulfilhisdreamofbecomingaprofessionalfootballersaysrobquinn 1 14936 0 0 /news/bromley301117 2 16941 0 0 /news/beckcroyath04112015 1 39324 0 0 /news/itsimportanttokeepeveryonesfeetonthegroundsaysblyspartansbossmatthume 1 15812 0 0 /news/erithtown300817 1 12262 0 0 /news/whitstabletownbeginsearchfornewmanagementteam 1 11998 0 0 /news/playersmustbeupforderby-obrien 1 19205 0 0 /news/lingtunb121123 13 226648 5 7 /news/551a956b7783e 3 29777 0 1 /news/greecray010118 4 91056 0 0 /news/wewanttomoveforwardafterthesuccessoflastyearsayshythetownbossscottporter 1 13813 0 0 /news/charlescalledupbyengland 1 16005 0 0 /news/thamesmeadtown1-3folkestoneinvicta-afewofmyplayershaveletdowntheclubfumesmeadboss 1 37067 0 0 /news/ebbsfleet070419 1 19858 0 0 /news/551a931db760d 1 13045 0 0 /news/harlow271104.html 1 0 0 0 /news/551a99e527faf 1 22644 0 0 /news/551bc5dd5d93f 2 19521 0 0 /news/homelands020217 1 16520 0 0 /news/werecommittedtoputtinglordswoodfirmlyonthefootballingmapsaysassistantstevearnold 1 13733 0 0 /news/barton160405.html 1 0 0 0 /news/sportingbengal041204.html 1 0 0 0 /news/551a9c0eaea92 4 40569 0 0 /news/ashbytakesurchinsdefeatonthechin 1 13190 0 0 /news/x-1 1 11255 0 0 /news/iveneverbeeninvolvedinsomethingasdramaticasthatsayswhitstabletownjoint-bossjimward 2 20958 0 0 /news/drmartens/eastern/erith&belvedere/29thaug04.html 1 0 0 0 /news/grahamstack020717 1 19092 0 0 /news/electrictiessesignscontractforstones 1 13358 0 0 /news/folkestone020518 2 29308 0 0 /news/dulwichhamlet150619 1 11663 0 0 /news/dover080216 1 12315 0 0 /news/hernebay190922 5 65605 0 0 /news/wp-content/plugins/press/css.php 1 0 0 0 /news/wecantaffordtoloseanymoregamessayshollandsblairbosspaulpiggott 1 14286 0 0 /news/erithandbelvedere020122 1 12319 0 0 /news/resultsaugustseptember2007 1 33054 0 0 /news/youhavetobeasprofessionalasyoupossiblycanbeatthislevelsaysdarrenanslow 1 16437 0 0 /news/erithtownreadytostandanddeliver 1 14382 0 0 /news/kentyouthleague111021 2 25515 0 0 /news/5thnov04.html 1 0 0 0 /news/ifimgiventimeibelievewecanwintheleaguesayslordswoodbosssimonhalsey 1 19931 0 0 /news/lewishamborough3-4fleetleisure-weveprovedafewpeoplewrongsaysfleetbossleerichmond 1 33486 0 0 /news/weneedtogainmaximumpointsifwearetowintheleaguetitlesaysblairbosspaulpiggott 1 13346 0 0 /news/minorworkathartsdownparkwillensuremargategainpromotion 1 14049 0 0 /news/551a9cf57b1b8 3 35026 0 0 /news/workandfamilycommitmentsforcesdealtownchairmantostepdown 1 15735 0 0 /news/glebelewis090816 1 34784 0 0 /news/favershamtown1-0sevenoakstown-werenearlyoverthatlinesaysluchford 1 23935 0 0 /news/sevenoaksshockwillkickusupthebacksideadmitsporter 1 14807 0 0 /news/chathamtown1harlowtown1 2 16031 0 0 /news/551bc99dbe7a4/kentleague/maidstone/kentleague/whitstable/7thnov03.html 2 15653 0 0 /news/horshamymca2-1chathamtown 1 11937 0 0 /news/resultsjanuary2019 2 87849 0 0 /news/551bc5da52656 3 35677 0 0 /news/margatebeginsearchfornewmanagerafterpartingcompanywithtrott 1 14562 0 0 /news/rusttunw050716 1 30846 0 0 /news/holmesdalebeginsearchfornewreserveteammanager 1 13283 0 0 /news/551bc99c67332 2 19928 0 0 /news/551a979a711c4 1 4791 0 0 /news/whitstabletown221222 1 13976 0 0 /news/551a9799ccf54 1 6175 0 0 /news/harrowborough2bromley0 1 11635 0 0 /news/kentleague/sevenoaks/dealtown250904.html 1 0 0 0 /news/tonbridgeangelslaunchfootballinthecommunityscheme 1 11844 0 0 /news/hythe090305.html 1 0 0 0 /news/551a931df11c8 2 26890 0 0 /news/theleaguetitlewillnotbewonorlostatlyddtomorrowsayshollandsblairbosspaulpiggott 1 15127 0 0 /news/551bc5e24c385 1 11016 0 0 /news/epsomandewell230921 1 11663 0 0 /news/21stjan05.html 1 0 0 0 /news/tonbridgeangelsunveilkeithmastersastheirnewsecretary 1 17582 0 0 /news/everythingstoplayforinthekentleagueatthemomentsaysmickycollins 1 16320 0 0 /southern-counties-east-football-league/42 1 20843 0 0 /news/tonbridgeangels1-2bishopsstortford-iapologisetoeveryonethatcameheretonight-warrilow 1 21289 0 0 /news/corivbrom200903.html 1 0 0 0 /news/wedefinatelywontbetakingbansteadlightlysaysstonesbossjaysaunders 1 12956 0 0 /news/phoenix200918 2 28133 0 0 /news/lewisham271115 1 13633 0 0 /news/551a99e40cd48 1 15495 0 0 /news/crayvalleymoveintofourthplace 1 12075 0 0 /news/fordbeatscompetitiontolandfootballadvisoryroleatderes 1 15181 0 0 /news/weveconsolidatedourpositioninthekentleaguesayscrayvalleybossstevechapman 1 15101 0 0 /news/551bc99baaa23 1 3109 0 0 /news/551a97b14712a 1 17976 0 0 /news/crowborough290618 1 15306 0 0 /news/kentclubscomplainaboutclashwithenglandinternational 1 30821 0 0 /news/ramsgate280422 2 31531 0 0 /news/pfastatement220322 3 33135 0 1 /news/doversweekofdestinywewontliedownanddieagainstterrorssayschatsboss-exclusive 1 17079 0 0 /news/shorts020615 2 37657 0 0 /news/itsbeenalonghardseasonadmitselthampalacechairmanneilproctor 1 14294 0 0 /news/weareintentnottosettleforamid-tablepositionsayshernebaychairmantrevorkennett 1 12418 0 0 /news/seagerlookingforanunbeatenendtotheyear-exclusiveinterview 1 15939 0 0 /news/phoenix090218 2 23668 0 0 /news/harestacticalmasterstrokepaysofffortitlechasingdover-exclusive 1 13966 0 0 /news/temporarydismissalsguidance230619 1 17870 0 0 /news/kentleague/sevenoaks/maidstone301004.html 1 0 0 0 /news/whitstablebossmarklanegiveshissquadthreegamestomake18-mancut 1 16746 0 0 /news/551bc5e606772 1 12838 0 0 /news/551bc5e45b3a9 1 12342 0 0 /news/soccershortssupportdoverathleticinsteadoffbeingfleecedbypremierleaguesayschairman 1 21874 0 0 /news/allwereaskingtheplayersistogiveusaperformancetokeeptheirshirtssaysgerrycox 1 14023 0 0 /news/robbinstargetskentleaguereturn-exclusiveinterview 1 15003 0 0 /news/wellmoveontobiggerandbetterthingsinsistsbromleychairmandolke 1 15124 0 0 /archive-2006-2014/201 1 19275 0 0 /news/551bc5e3b7875 1 16304 0 0 /southern-counties-east-football-league/19 1 21302 0 0 /news/yorathtakestemporarycontrolofmargate 1 11896 0 0 /news/wewillturnthecornervowsdack 1 12699 0 0 /news/phoetunw280115 1 26565 0 0 /news/admin-post.php 1 0 0 0 /news/kentleague/cray/22ndaug04.html 1 0 0 0 /news/551a96775af66 3 39087 0 0 /news/kentseniortrophyfinalthepitchruinedourpassinggamerageshughes-exclusive 1 16382 0 0 /news/551a99e427e0c 1 11732 0 0 /news/myplayershavesetthebarforwork-rateanddesiresayslarkin 1 16024 0 0 /news/551a9250aba32 3 28591 0 0 /news/backdowntoearthforfacupheroeshythetown 1 17272 0 0 /news/maidvlord271203.html 2 0 0 0 /news/fisher0-0corinthian-idlovetowinsomethingforbosstonysitfordsaysmattlonghurst 1 24396 0 0 /news/welling110817 1 13853 0 0 /news/corsdeal140123 4 68078 0 0 /news/fatrophydrawreactionhumeasksforvocalsupporttochopdownforest 1 26811 0 0 /news/12thdec05.html 1 0 0 0 /news/551a9677bb8f1 2 16157 0 0 /news/kentrivalsleftinthedark 1 15190 0 0 /news/dealtown040823 1 12293 0 0 /news/wemustallpitchintobeatdulwichinsistsmiles-exclusiveinterview 1 12207 0 0 /news/fcelmstead220917 1 13392 0 0 /news/sittingbournefc.uk 1 0 0 0 /news/slouvbrom121103.html 1 0 0 0 /news/whitstabletown220722 2 23167 0 0 /news/robbinshythehasgreatpotentialexclusive 1 15601 0 0 /news/ramsgate150619 2 27640 0 0 /news/drmartens/premier/dover/staines140904.html 1 0 0 0 /news/rochwhit250418 1 32227 0 0 /news/551a9797e49fa 1 4586 0 0 /news/sevenoakstownbossdarrenanslowdraftsintwoondual-registrations 1 11868 0 0 /news/551bc5da57f61 4 38696 0 0 /news/hernebay151119 2 24517 0 0 /news/ramsdale050516 1 14307 0 0 /news/whitstable241115 2 30443 0 0 /news/thiswholetransferwindowscenarioiskillingclubsatourlevelbemoansfleetboss 1 13722 0 0 /news/tilleysuffersthirdbadbreak-exclusiveinterview 1 16287 0 0 /news/folkdork220815 3 61497 0 0 /news/551bc5e845c8f 1 10970 0 0 /news/551bc5e43c3e8 1 3833 0 0 /news/551bc99dbe7a4/othernews/kentleague/sladegreen/3rdnov03.html 2 15653 0 0 /sitemap.xml 6 283314 0 0 /news/stamford081005.html 1 0 0 0 /news/corlord290917 1 31725 0 0 /news/551a97982b2c8 1 6748 0 0 /news/thepitchwasplayableagreedisappointedbosses-exclusiveinterviews 1 15087 0 0 /news/resultsjanuary2023 4 172326 0 0 /news/holmwhit050423 4 128262 0 0 /news/bromwoki240919 2 36999 0 0 /news/itsachancetoprovewerethebestsideinkentsaysgillinghambossianvarley 1 12126 0 0 /news/tonbridge260216 2 28184 0 0 /news/551bc5e4af58c 1 11347 0 0 /news/gurunanakunveildennishughesastheirnewboss 1 12471 0 0 /news/ryman/bromley/fisherfacupreplay210904.html 1 0 0 0 /news/ramsgate080319 2 24096 0 0 /news/tunwells191105.html 1 0 0 0 /news/551bc5e863180 1 11470 0 0 /news/551a956c85f12 1 4000 0 0 /news/bealeshasgivenusaselectionheadacheadmitsimpressedsawyer 1 19267 0 0 /news/thisisaperiodthattestsandstretcheseveryonessquadssaysbromleycoachhugolangton 1 12435 0 0 /news/551a931ddaef3 1 13880 0 0 /news/craywanderers2-1worthing-itwasimportanttobeatthelandofthegiantsadmitskempster 1 21237 0 0 /news/craywands060918 3 34845 0 0 /news/resultslockdown2020 3 33000 0 0 /news/sporfore260922 4 105734 0 0 /news/ifwerenotchallengingthenimnotdoingmyjobproperlysaysramsgatebosstimdixon 1 17695 0 0 /news/dulwichhamlet101220 1 12183 0 0 /news/551a967725ce8 2 21295 0 0 /news/welling230218 1 12706 0 0 /news/tommywarrilowfreshensuphisstrikeforce 2 18941 0 0 /news/sittvdart141003.html 1 0 0 0 /news/1stjuly05A.html 1 0 0 0 /news/vcdathletic3-3erithbelvedere 1 13280 0 0 /news/anteraisedforsecondkeeperwars-exclusive 1 13131 0 0 /news/551bc5e0a5239 1 22683 0 0 /news/www.dgsmarine.com 1 0 0 0 /news/dorkbeck110916 1 29066 0 0 /beckenham-2003-2006 14 185192 1 0 /news/jonathanstone260220 1 12481 0 0 /news/england03072018 2 26162 0 0 /news/smithextendshisstayatashfordforanothermonth 1 12821 0 0 /news/ryman/bromley/11thjuly03.html 1 0 0 0 /news/551bc99bcb969 2 16922 0 0 /news/551a9c0ece399 3 33730 0 0 /news/551bc99dbe7a4/drmartens/premier/dover/othernews/ksc1stround.html 2 15653 0 0 /news/wellsbankingonsponsorsmoney-exclusive 1 12940 0 0 /news/kentleague/cray/20thaug04A.html 1 0 0 0 /news/wingate&finchley101205.html 1 0 0 0 /news/551a956c4f813 1 3221 0 0 /news/suttonunited220416 1 15091 0 0 /news/wellingunited2-0eastbourneborough-teamsarenotgoingtomakeiteasyforussaysjamieday 1 23477 0 0 /news/wemustfindtherightmansaysmargatechief 1 16097 0 0 /news/thesquadicurrentlyhaveisthebestsquadihavemanagedsinceijoinedramsgatesaysjimward 1 13308 0 0 /news/webeleivewecanturnitaroundsayslangton 1 19213 0 0 /news/sheppeyunited020822 2 31839 0 0 /news/thebiggertheyarethehardertheyfall 1 11783 0 0 /news/kentleague/sladegreen/deal061104.html 1 0 0 0 /news/ramsgate201016 2 27215 0 0 /news/dartford1-2sittingbourne 1 14785 0 0 /news/favershamkickoffthekentishfootballseason 1 11134 0 0 /news/551a925097ec7 1 4012 0 0 /news/hessenthalerpullsoffsouthallcoup 1 12665 0 0 /news/woodbrothersleftoutinthecoldbeforesigningforvickers 1 17617 0 0 /news/weneedgatesofover500tokeeptheclubsheadabovewaterwarnsmargatedirector 1 23292 0 0 /news/hernebaydontwanttoliveinwhitstablesshadowssayssimonhalsey 1 15995 0 0 /news/22ndaug04A.html 2 0 0 0 /news/comeandjoinusandprovehowgoodyouare 1 14328 0 0 /news/551a97991927f 1 5010 0 0 /news/wintryblastbringskenttoastandstill 1 12906 0 0 /news/551bc5e2cee35 1 13970 0 0 /archive-2006-2014/252 1 19407 0 0 /news/theeasterprogramme 1 19536 0 0 /news/bromyeov081220 5 80969 0 0 /news/everyoneexpectsustogetpromotedthisyearadmitsmaidstoneunitedbossjaysaunders 1 14881 0 0 /news/551bc99dbe7a4/conference/margate/drmartens/eastern/dartford/27thnov03.html 2 15653 0 0 /news/croydon180915 1 11511 0 0 /news/dartford080517 2 16580 0 0 /news/fordrelishestheirunderdogtagasvickersaimfortheirsecondtrophy 2 17828 0 0 /news/ifweplaytoourmaximumpotentialbathwillbeinforatoughgamesaysfleetbossstevebrown 1 14167 0 0 /news/ashford270805.html 1 0 0 0 /news/gateshavebeendisappointingadmitsfleetchairman 1 12678 0 0 /news/ALFA_DATA/alfacgiapi/database.php 1 0 0 0 /news/whytetonb070715 4 40923 1 1 /news/wellingtown041021 2 15289 1 1 /news/ahwansuffersinjuryset-back 1 13371 0 0 /news/newromney100517 1 14757 0 0 /news/sittingbourne250322 2 29981 0 0 /news/balrust09082019A 3 43807 1 1 /news/tootingmitchamunited1-0chathamtown-binkstellsdovermyplayersgaveabsoutelyeverything 1 18704 0 0 /news/551bc5e365fcd 1 14119 0 0 /news/itwouldbegoodifwecanemulatemartinhayesandgetintofacupthirdroundsayschriskinnear 1 16112 0 0 /news/welldonekeithyoudeserveditsayspromotedbossseager 1 14918 0 0 /news/ramsgate0-1leatherhead-wedontwanttobemidtablealso-ranssaysramsgatebosstimdixon 1 31606 0 0 /news/easttonb280416 2 55526 0 0 /news/erithtown1-2lewishamborough-theywanteditmorethanusadmitsembarrassedtonyrussell 1 26808 0 0 /news/551bc5dc872c0 3 31368 0 0 /news/bromwork060218 1 30167 0 0 /news/551bc99bd7b3b 2 30950 0 0 /news/ialwayssaidtherewasmoretocomesaysashfordunitedbosspaulchambers 1 15002 0 0 /news/cantleic020219 1 31327 0 0 /news/cheltonb170220 2 26184 0 0 /news/wehavenotbeenhappyinthekentleagueforaconsiderabletimenowsayspeterpalmer 2 18679 0 0 /news/welling241117 1 12755 0 0 /news/7thmar05.html 1 0 0 0 /news/dealtown1-2ashfordunited-ithoughtwewerequitecomfortablesaysashfordbosspaulchambers 1 26095 0 0 /news/isthmianleague310722 2 22917 0 0 /news/403.php 1 0 0 0 /news/holmesdalecommittedtofulfillingourfixturesforthisseasonandbeyond-clubstatement 1 13522 0 0 /news/daishsuffersmacdonaldblow 2 14493 0 0 /news/idontfearanyoneinthisleaguesaysramsgatebosstimdixon 1 13540 0 0 /news/vcdathletic9-2lordswood-someonewasgoingtotakeahidingsoonerorlatersaysraypowell 1 28243 0 0 /news/sittingbourne250920 2 28437 0 0 /news/551bc5dd129d4 1 14207 0 0 /news/soccershorts260516 3 56097 0 0 /news/ryman/bromley/27thoct03.html 1 0 0 0 /news/therewillbemoretocomefromuswarnshernebaybosssimonhalsey 1 14787 0 0 /news/551a956c9b052 1 3731 0 0 /news/idontthinktherewillbeabettercentreforwardinnon-leaguefootballsayskeithmcmahon 1 22828 0 0 /news/bedfont100905.html 1 0 0 0 /news/Governmentpetition061020 2 18059 0 0 /news/soccershortswarrilowblastsrefyousent-offthewrongman-poutonquitsstones 1 38026 0 0 /news/folkestoneinvicta261123 7 77035 0 0 /news/551a97b0b4cec 1 14789 0 0 /news/folkestoneinvicta2-3billericaytown 1 14541 0 0 /news/playersdontplayformeformoneyinsistsobrien 1 26313 0 0 /news/ramsgate2-0margate-goalswerebetterthanpremierleaguehailsward 1 14853 0 0 /news/takaloowefearnoone-exclusiveinterview 1 14587 0 0 /news/lewisham310818 1 12959 0 0 /news/wellingtown240520 1 16755 0 0 /news/551a9c923263c 3 44658 0 0 /news/thamesmeadtown1sevenoakstown1 1 13558 0 0 /news/phoenixsports170120 3 29889 0 0 /news/livecoverageerithtown1-0hythetown-dockerscelebratethankstocookowngoal 1 29816 0 0 /news/roystonwantstoreclaimhisshirtfortelevisedcupclash 1 15042 0 0 /news/favershamdismissmanagementteam 1 13812 0 0 /news/doverathleticreleasefouraftersealingpromotionbacktotop-flight 1 13001 0 0 /news/551bc5e57a833 2 21433 0 1 /news/Hernebay200805.html 1 0 0 0 /news/worthing0-0beckenhamtown-wereabitguttedwehaventwonadmitsproudmichaelmarks 1 25634 0 0 /news/doverathletic220920 1 11996 0 0 /news/551bc5dd09e8f 1 13225 0 0 /news/doverathletic311018 1 11899 0 0 /news/ilford111005.html 1 0 0 0 /news/harlowtown1-2maidstoneunited-stonesclimboutofdropzonethankstosaunderslatewinner 1 14213 0 0 /news/gormanbeginssalvageoperation-exclusiveinterview 1 17204 0 0 /news/margatebeginsearchforyorathsreplacement 1 13090 0 0 /news/whitstable060418 1 12553 0 0 /news/maidstoneunited4beckenhamtown3aet 2 18828 0 0 /news/yanz.php 1 0 0 0 /news/minshullcharlton120515 1 15671 0 0 /news/551bc5dbbe4d6 3 33608 0 0 /news/551bc5e8d8be7 1 19354 0 0 /news/wellingtown020719 1 14365 0 0 /news/ramsgate301117 1 14124 0 0 /news/seniorsworldcup090616 1 14018 0 0 /news/dealtown060821 1 13445 0 0 /news/idontknowtoomuchaboutorpingtontobehonestwithyouadmitsbearstedbosstonycornwell 1 13563 0 0 /news/thefacupthirdqualifyingrounddraw 1 12091 0 0 /news/ramsgatesplayerdevelopmentprogrammegetsunderway 1 12192 0 0 /news/kentleague/tunbridgewells/thamesmead011204.html 1 0 0 0 /news/newromney300519 2 14670 1 1 /news/maldontripwasourworstperformanceoftheseasonadmitsmcmahon 1 17647 0 0 /news/dartfordstrikermcdonaldpens18-monthdealwithcanaries 1 14808 0 0 /isthmian-league/34 3 44145 0 0 /news/cirencester221005.html 1 0 0 0 /news/wandsgiveyoungstersachancetoshine 1 15056 0 0 /news/itsimportantwestaypositiveduringtestingtimessayswarrilow 1 17149 0 0 /news/wecanholdourheadsuphigh-exclusiveinterviews 1 14209 0 0 /news/dovermakelastsummersigning-addingspicetotheirsquad 1 12195 0 0 /news/551a9250216d7 2 17680 0 0 /news/cafc.co.uk/news/view/5edf3aa26a41c/consortium-led-by-businessman-paul-elliott-purchases-east-street-investments 2 0 0 0 /news/weregoingtofinishashighaswecansayscorinthianassistantmattlonghurst 1 13681 0 0 /news/ramsgate050117 4 43810 1 1 /news/hastingsunited011121 2 24468 0 0 /news/bromvkingsfr290803.html 1 0 0 0 /news/lovellstartstorebuildashfordsquad 1 14511 0 0 /news/captaincookcontinuestoleadbyexampleathythetown 1 12654 0 0 /news/theladshaveenjoyedtheexperienceanditwillinspirethemtomoveonsayschriskinnear 1 18958 0 0 /news/folkestoneinvictafearpointsdeduction 1 15957 0 0 /news/wp-content/plugins/ioptimizations/abruzi.php4 1 0 0 0 /news/maidstoneunited.co.uk/2020/12/match-postponed-due-to-positive-covid-19-tests/ 2 0 0 0 /news/farnboroughobg1-8bromley-idliketoseemoreinterestinmyplayerssaysbromleybossdryland 1 32912 0 0 /news/beckshep050417 1 31381 0 0 /news/ashfordtown0-4moleseychiefexecutiveiapologiseforatrociousdisplay 1 18690 0 0 /news/551a9678a0306 3 42117 0 0 /news/fixturessaturday22april2006 1 12629 0 0 /news/othernews/coneyhall100804.html 1 0 0 0 /news/551a956bd3565 1 3895 0 0 /news/formerskipperreturnstofisher 1 23524 0 0 /news/craymone221117 3 71637 0 0 /news/wemustfindourshootingbootssaysward 1 16581 0 0 /news/wivenhoetown1sittingbourne0 1 13383 0 0 /news/551bc5dc6de5c 3 30321 0 0 /news/angelsnotcasualwithpitchpreperation 2 14759 0 0 /news/551bc5e6f38ee 1 19017 0 0 /news/bromley010218 1 18139 0 0 /news/551a9798621b7 1 3471 0 0 /news/weregoingtowembleywhatagreatachievementforaclublikeebbsfleetsaysdaish 1 15991 0 0 /news/itstimetogetseriousinsistsdolby-exclusiveinterview 1 16070 0 0 /news/22ndnov04.html 1 0 0 0 /news/november2009fixtures2-13november2009 1 14903 0 0 /news/ithinkwevebeenunluckyinsomeofthegamesadmitsdartfordbosstonyburman 2 18189 0 0 /news/imexpectingahardfoughtlocalderbyagainstfavershamsayshernebaybosssamdenly 1 14579 0 0 /news/corinthian111118 1 16463 0 0 /news/wellingtown300819 1 12617 0 0 /news/nationwideconferencefixturesannounced 1 10136 0 0 /news/suttonunited1-2wellingunited-wehavetogetbothfeetthroughthedoorsaysjamieday 1 21390 0 0 /news/favehyth020123 5 180370 0 0 /news/drmartens/eastern/sittingbourne/sittvchat261203.html 1 0 0 0 /news/phoenix210217 3 27318 0 0 /news/doverathleticappointtwonewboardmembers 1 13206 0 0 /news/thepressureisallonhytheinsistsmartinlarkin 1 16816 0 0 /news/snodlandtown250222 1 12798 0 0 /news/itsachancetobespecialforadaysaystunbridgewellsbossmartinlarkin 1 16515 0 0 /news/drmartens/premier/welling/16thsept04.html 1 0 0 0 /news/corileig290220 1 11212 0 0 /news/bravestonesfansraisemorefundsforgroundfund 1 13026 0 0 /news/afccroydonath271115 1 12977 0 0 /news/iwillnotstanddownsaysdefiantunder-firewhitstabletownbossjustinluchford 1 17225 0 0 /news/illbetryingtomaketheplay-offsandgetoutoftheleaguesaysangelsbosstommywarrilow 1 17967 0 0 /archive-2006-2014/258 1 19266 0 0 /news/hernebayskipperlukeharveytellshisteammatesgiveuseverythingandbeourhero 1 17849 0 0 /news/burmansettomakechangesfortrophytieatsittingbourne 1 16776 0 0 /news/10thjuly05.html 1 0 0 0 /news/kentleague/sladegreen/23rdjuly03.html 1 0 0 0 /news/hessenthalergiveshesitantstrikerdrydencontractdeadline 1 12520 0 0 /news/551a9c91a8a86 2 21706 0 0 /news/londonwomen0gravesendnorthfleetladies0 1 13161 0 0 /news/suttonathleticunveilstalwartbenyoungastheirnewmanager 1 13123 0 0 /news/conference/margate/19thnov04.html 1 0 0 0 /news/ourleaguepositionisgoodontheeyesaysjenkins 1 19616 0 0 /news/advertisingrates 2 13731 0 0 /news/conference/margate/30aug04.html 1 0 0 0 /news/wp-content/plugins/superstorefinder-wp/ssf-wp-admin/pages/SSF_WP_UPLOADS_PATH/csv/import/abruzi.php4 1 0 0 0 /news/beckenham030119 1 14927 0 0 /news/theroadtowembleykentmanagersfocusonsecondchances-exclusives 1 17662 0 0 /news/dockerstomakeofficialcomplaintoveryiadomsaga 1 16050 0 0 /news/kfuelt180916 1 37519 0 0 /news/551a9250a4cdd 1 3337 0 0 /news/29thnov03.html 1 0 0 0 /news/folkestoneinvicta2-0chathamtown-immanenoughtotakeitonthechinsaysobrien 1 38233 0 0 /news/551a931eb7eb4 2 29316 0 0 /news/deal111005.html 1 0 0 0 /news/20thjune04.html 2 0 0 0 /news/wellingunited2-2cambridgeunited-iwantustobeentertainingsaysjamieday 1 26761 0 0 /news/phoenix261017 2 23050 0 0 /news/itsacrazyleague-itsscreamingoutforacoupleofteamstopullawaysaysjaysaunders 1 13138 0 0 /news/bearsted240818 1 12311 0 0 /news/wewishmichaelwestthebestforthefuturesaysebbsfleetunitedbossliamdaish 1 12853 0 0 /news/craywanderersbossianjenkinsreachesmilestone 1 13015 0 0 /news/suttonunited1-0doverathletic-wevegotmoreimportantthingstoworryabout-exclusive 1 20111 0 0 /news/westviewcupproducesfivemouth-wateringkentshowdowns 1 12681 0 0 /news/fivemorevictorieswillkeepusinthedivisionsayssittingbournejoint-bossmattwyatt 1 18063 0 0 /news/spicegivenchancetoreclaimfirstteamshirt 1 13400 0 0 /news/vickerscancausevaseupset 1 16343 0 0 /news/sittingbournevfleet060903.html 1 0 0 0 /news/hythe010916 2 25426 0 0 /news/weneedthecrowdstoreturntoseeourpushforthetitlesaysdoverchairman 1 12800 0 0 /news/supportersruelastminutevenueswitch 1 15454 0 0 /news/showdowntalksforcemundaytolookformorequality 1 15124 0 0 /news/harristeamsupwithmcintyrebackatks 1 11550 0 0 /archive-2006-2014/241 1 19128 0 0 /news/favershamtownkeepersimonoverlandruledoutthroughfracturedtibia 1 11795 0 0 /news/551bc5e502ba8 1 13489 0 0 /news/wembleywoesendinyourviews-mcclarenremainsdefiantdespiteembarrassingexit 1 12598 0 0 /news/collbeck300322 4 121402 0 0 /news/kentcountyleagueannouncesquadsforfainterleaguecupwarm-upgames 1 14899 0 0 /news/551a99e3986f4 1 11652 0 0 /news/551a9799a7113 1 5079 0 0 /news/28thaug03.html 2 0 0 0 /news/wardrymanpremierleaguefootballdoesntfrightenmeexclusiveinterview 1 18866 0 0 /news/crystalpalacerespportsmouthresp 1 10507 0 0 /news/beckenham290718 1 13551 0 0 /news/lyddhavesamesightsasidosayshughes 1 11985 0 0 /news/4thaug03.html 1 0 0 0 /news/whitstable210804A.html 1 0 0 0 /news/marlonpattersonsharesourambitionsaysbromleyassistanthaydenbird 1 19939 0 0 /news/hallsathletic050320 1 10801 0 0 /news/someoftheacademyladsdeservetostartthefinalsaysmaidstoneunitedbossjaysaunders 1 18381 0 0 /news/551bc5dd3d6ee 2 18377 0 0 /news/welldoourselvesjusticesayssevenoaksbossjones 1 12426 0 0 /news/551a9250c99c8 2 16366 0 0 /news/551a9cf5a8ce7 2 19026 0 0 /news/bearsted150615 3 21339 0 0 /news/burmankeepshissquadoptionsopen 1 14840 0 0 /news/11thsept05.html 1 0 0 0 /news/tunbridgewells150519 1 13004 0 0 /news/imabsolutelyguttedandshatteredthatithasntworkedoutsaysfabiorossi 1 12432 0 0 /news/woking1-0ebbsfleetunited-daishbemoanescontentiousdecisionsagainsthisside 1 19731 0 0 /news/bromleyminshull210515 2 16922 0 0 /news/551bc5e6d9b3a 1 21236 0 0 /news/creditcrunchwerestrugglingtocopesaysonelocalchairman 1 12507 0 0 /news/beckenham250920 4 50746 0 0 /news/dolbyhasmadehastingshardtobeatathomewarnscugley-exclusive 1 25485 0 0 /news/x 1 10518 0 0 /news/wemustfinishoffthejobinsistspennock-exclusive 1 13804 0 0 /news/551a979920a10 1 6395 0 0 /news/chathamtowncanbeclassedasasleepinggiantsaysmiles-exclusiveinterview 1 17002 0 0 /news/ramsgateunveilthesigningofnigerianstrikerjosephafusi 1 12017 0 0 /news/sheppey300518 1 11909 0 0 /news/croyshep200920 1 35368 0 0 /news/fatrophyspecialplacingobrienonthetransferlistwasadifficultdecisionadmitsburman 1 15900 0 0 /news/wewantlyddtopushusallthewaysayshollandsblairbosspaulpiggott 2 19555 0 0 /news/gillinghamunveilsimonratcliffeastheirnewladiesmanager 1 13683 0 0 /news/thereismoretocomefrommygoodsquadsaysdartfordbosstonyburman 1 12983 0 0 /news/ebbsfleet080616 1 13054 0 0 /news/whoeverwantstostandinfrontofmeiwanttobeatthemsayssittingbournejoint-bossjimward 1 16575 0 0 /news/favershamtown250222 2 28263 0 0 /news/551a956c0bb85 1 3180 0 0 /news/werenotfiringonallcylindersandwecanstillplayalotbettersaystommywarrilow 2 23902 0 0 /news/551bc99e42073 2 21204 0 0 /news/erithandbelvedere230922 1 14641 0 0 /news/lovellwemuststayincontention-exclusiveinterview 1 13693 0 0 /news/551a9798337fe 1 5313 0 0 /southern-counties-east-football-league/32 1 21137 0 0 /news/croydonappointrobbinsaheadofeuropeanfootballer 1 34971 0 0 /news/otfordcharity140119 1 11107 0 0 /news/itsourchancetoimpresssaysangelsyouthteamboss-exclusiveinterviews 1 15515 0 0 /news/doverathleticsignfive-figuresponsorshipdealwithseafrance 1 13049 0 0 /news/551a95b390b05 3 47829 0 0 /news/thamesmeadtown2-1concordrangers-itwilltakeanexceptionalsidetobeatussaysmcmahon 1 39929 0 0 /news/beckenham101116 1 11866 0 0 /news/wp-content/plugins/ioptimization/xo.php 1 0 0 0 /news/15thoct04.html 1 0 0 0 /news/iwantsomeonetogetmyplayersintoshapesayssittingbournejoint-bossjimward 1 11125 0 0 /news/551bc5e4d0ba5 1 11972 0 0 /news/trottinastateofshockasmargatelosesevengoalthriller 1 17768 0 0 /news/hernebay280819 2 26495 0 0 /news/tonbridgeangels1-0aveley-youdnicka1-0winalldaylongadmitsalexobrien 1 21409 0 0 /news/drmartens/eastern/fisher/26thfeb04.html 1 0 0 0 /news/ramsgate310119 2 25056 0 0 /news/supporterstrustneedsnewofficials 1 11327 0 0 /news/551bc5e68abcf 1 14726 0 0 /news/greenwich281217 1 13259 0 0 /news/maidstoneunited140920 1 14291 0 0 /news/phoetilb090116 2 54452 0 0 /news/551a967912b49 2 15019 0 0 /news/brompete101118 2 42115 0 0 /news/rymanleagueopeningdaypreview 1 32701 0 0 /news/littlehamptontown1-0greenwichborough-myplayershavegottolearnquicksaysjohncumberbatch 1 27571 0 0 /news/kentleague/thamesmead/16thsept04.html 1 0 0 0 /news/croydontargetpromotionbackintotherymanleaguewithintwoyears-exclusiveinterviews 1 17996 0 0 /news/kentleague/ramsgate/21stjuly04.html 1 0 0 0 /news/551bc5db49a83 2 13570 0 0 /news/551a9c0f2c48a 2 21188 0 0 /news/werebuildingtowardswinningtheleaguenextseasonsayserithtownbossmarktompkins 1 14584 0 0 /news/wp-content/themes/seotheme/mar.php 1 0 0 0 /news/ashfordunitedcact071121 3 37382 0 0 /news/sladegreen1dealtown2 1 16735 0 0 /news/551bc99dbe7a4/drmartens/eastern/sittingbourne/kentleague/whitstable/27thnov03.html 2 15653 0 0 /news/551a9cf5000bc 3 53663 0 0 /news/551bc99dbe7a4/drmartens/premier/dover/kentleague/sevenoaks/16thaug03.html 2 15653 0 0 /news/noonewantstoseecrockenhillgooutofbusinesssaysmanagercraigclark 1 16952 0 0 /news/screritht080816 1 27142 0 0 /news/erithbelvederebossmattlonghursthailsthetogethernessandmaturityofhisplayers 1 15390 0 0 /news/soccershortsfolkestonetomakeannouncementconcerningtheirfuture-tomorrow 1 23308 0 0 /news/hollands180119 1 15289 0 0 /news/8thaug03.html 2 0 0 0 /news/wp-includes/random_compat/about.php 1 0 0 0 /news/551a97b070b12 2 28402 0 0 /news/551bc99c4fcc8 2 28213 0 0 /news/sceflstatement060321 1 10781 0 0 /news/tunbridgewells1-2rusthall-impleasedmyboysdidthebusinesssaysproudronaldson 1 40232 0 0 /news/551bc99dbe7a4/ryman/drmartens/eastern/sittingbourne/tootingvsittfat041003.html 2 15653 0 0 /news/drmartens/eastern/folkestone/gillingham090704.html 1 0 0 0 /news/FishErit230315 1 30714 0 0 /news/seagerlookingforbonuspoints 1 14830 0 0 /news/ramsgaterelishvisitfrommargate-exclusiveinterviews 1 16227 0 0 /news/chathamtownunveilobrienastheirnewboss 1 12625 0 0 /news/bromley240517 1 14062 0 0 /news/foleyunveiledaschathamtownsnewboss 1 14851 0 0 /news/starscomeoutforcharitygame 1 12050 0 0 /news/551bc99dbe7a4/nationwide/gillingham/drmartens/eastern/fisher/21stjuly03.html 2 15653 0 0 /news/551bc99d81fe3 2 21392 0 0 /news/maidstoneunited2-4bognorregistown-imunderpressuretowinpromotionnextyear-saunders 1 26181 0 0 /news/tomphipppensnewcontractatebbsfleetunited 1 12550 0 0 /news/ebbsfleet181018 1 13675 0 0 /news/551bc5df310db 1 17572 0 0 /news/hythetownmidfielderronniedolanofferedtrialatwellingunited 2 14911 0 0 /news/margate180119 2 27021 0 0 /news/craywands250416 3 46192 0 0 /news/erithdartfordtown1-2vcdathletic-imheretowintheleaguesaysgaryabbott 1 22196 0 0 /news/petershiltonsignsforfolkestoneinvicta 1 12437 0 0 /news/charltonathletic051222 1 12892 0 0 /news/harlcray270416 2 59509 0 0 /news/UKGovernmentStatement240920 3 49765 0 0 /news/othernews/30thsept03.html 2 0 0 0 /news/doverathletic051018 1 13167 0 0 /news/snodlandperry310515 2 20313 0 0 /news/chattoot150816 3 63873 0 0 /news/facarlsbergvasefourthrounddrawitsasclearasblackice 1 12174 0 0 /isthmian-league/15 3 43549 0 0 /news/invictastopdrawlottery 1 11306 0 0 /news/kentleague/sladegreen/31stjuly04.html 2 0 0 0 /news/dockersdemandafour-figurecompensationfeefor43-goalstrikercassius 1 23071 0 0 /news/551a96dc134c9 5 66007 0 0 /news/dartfordbosstonyburmanseeksvastlyimprovedperformanceagainstportvale 1 17006 0 0 /news/kentleague/ramsgate/25thjan04.html 1 0 0 0 /news/southern160117 2 23335 0 0 /news/glebe270416 1 12331 0 0 /news/sittingbourne2-2leatherhead-bradytakentohospitalfollowingfreakheadinjury 1 16261 0 0 /news/lordswoodbeginsearchfornewbossasjasonlillisstepsdownatendofseason 1 12702 0 0 /news/wellingunitedbossjamiedaylooksforwardtocharltonathleticvisit 1 12556 0 0 /news/NationalLeague250320 2 15740 0 0 /news/croweast020822 4 113922 0 0 /news/comment190117 3 32018 0 0 /news/phoenix221217 1 17071 0 0 /news/youneedtobeatyourbesteverytimeyouplaysayswoodstockassistantchriscooper 1 13821 0 0 /news/soccershortsebbsfleetkeepercalledupforengland 1 24311 0 0 /news/collectingamassivethreepointsfromsevenoakswillnotbeeasyadmitshalsey 1 17479 0 0 /news/ramsgate260518 2 29548 0 0 /news/gillingham3-1stockportcounty-stimsonpraisesthegillssnowmen 1 22307 0 0 /news/angelslooktocontinuegoodformagainsthendon 1 12335 0 0 /news/erith&belvedere031205.html 2 0 0 0 /news/551a9c9242e83 3 40316 0 0 /news/imveryexcitedaboutwhatliesaheadforhythetownsaystimdixon 1 12198 0 0 /news/coneyhallbeginsearchforexperiencednewboss-exclusiveinterview 1 12976 0 0 /news/551bc5e616f8e 1 15268 0 0 /news/31staug04.html 1 0 0 0 /news/dulwton280316 2 67543 0 0 /news/whitstable040420 2 25557 0 0 /news/kentleague/sladegreen/chessingtonvsladefr260703.html 1 0 0 0 /news/wp-content/plugins/proxy/css.php 1 0 0 0 /news/jeffreyunveilskentyouthleaguerepsquad 1 11680 0 0 /news/margate180519 2 23474 0 0 /news/tunbridgewellsappointnewreservemanagementteam-exclusive 1 11568 0 0 /news/beckenhamtown240120 2 16251 0 0 /news/bromleydavidgregory130518 1 16524 0 0 /news/punjabunited290322 1 13141 0 0 /news/drmartens/eastern/erith&belvedere/4thoct04.html 1 0 0 0 /news/resultsjanuary2009 1 25864 0 0 /news/drmartens/premier/dover/9thdec04.html 1 0 0 0 /news/soccershortswewillnotgooutandspendbigmoneyonplayerssayshernebaybosssamdenly 1 14416 0 0 /news/drmartens/eastern/folkestone/ashford240704.html 1 0 0 0 /news/myplayersbeleiveinthemselvesnowsayssuttonathleticbossjamescollins 1 14420 0 0 /news/coriasco301119 1 33306 0 0 /news/551bc99bd43b8 2 21895 0 0 /isthmian-league/14 3 43169 0 0 /news/551a99e4d612f 2 40246 0 0 /news/chathamsstarnamesreturnfortilleystestimonial-exclusiveinterview 1 15117 0 0 /news/14thnov03.html 1 0 0 0 /drmartens/eastern/erith&belvedere/cray260705.html 1 9955 0 0 /news/thedreamstartshere 1 11138 0 0 /news/academyreferee100621 2 15046 0 0 /news/551a97b262d93 1 15228 0 0 /news/551a97b091170 1 10855 0 0 /news/enfieldtown011005.html 1 0 0 0 /news/margatesteponthegasinbidtoavoidthedrop 1 13112 0 0 /news/wearegoingforthetreble-seager 1 11719 0 0 /news/suttonathletic270722 1 13534 0 0 /news/phoenix080319 1 13924 0 0 /news/thefacupsecondrounddrawrevised 1 11974 0 0 /news/lordsvcray251003.html 1 0 0 0 /news/hernebaywerethebestsidethatweveplayedthisseasonsaysjones 1 20382 0 0 /news/formerchampionsleaguestarrelishinghisnewchallengeathythetown 1 14509 0 0 /news/hythetown4-1hernebay-smissenhat-trickisperfectresponseforfisk 1 13956 0 0 /news/kentcountyleague050520 1 13988 0 0 /news/greenwich030217 2 28147 0 0 /news/chatspark110815 3 59368 0 0 /news/iveworkedhardtobearymanleaguemanagersaysvcdathleticbosstonyrussell 1 14683 0 0 /southern-counties-east-football-league/14 1 20963 0 0 /news/551bc5e3e0b44 1 16323 0 0 /news/croydon270519 1 11491 0 0 /news/dartford150718 2 18300 0 0 /news/CONIFAWorldCupBhandal280518 3 36025 0 0 /news/were100behindthemanagersaysfolkestonedirector 1 13739 0 0 /news/551a9718db68d 3 24706 0 0 /news/crowboroughathletic030522 1 12514 0 0 /news/thefalaunchprobeoversuspiciousbettingactivityinconferencesouth 1 11646 0 0 /news/551a9c92d5c62 2 19505 0 0 /news/kentleague/beckenham/19thsept04.html 1 0 0 0 /news/invictadrawcomfortagainstleagueleaders 1 14589 0 0 /news/bromleyaskforassistance 2 12903 0 0 /news/551a95b38e1f7 2 15109 0 0 /news/bromley160217 2 16867 0 0 /news/bromley250318 1 17053 0 0 /news/wewontliedownaswewanttomeetourowntargetsinsistsvickersbossrickybennett 1 18325 0 0 /news/soccershortsosbornnamedasbromleyboss 1 19083 0 0 /news/sladegreen041005.html 1 0 0 0 /news/glebe250422 4 51734 0 0 /news/wehavenotbrokenthebanktolandhocktonsayshume 1 18758 0 0 /news/551a979828cfb 1 4423 0 0 /news/551bc5dac1c6b 4 40092 0 0 /news/wp-content/xleet-shell.php 1 0 0 0 /news/ChallengeCupFinal040519 1 15174 0 0 /news/grazioliappointedlondonscoutforbristolrovers 1 11888 0 0 /news/rowlandreachesstonesmilestone 1 11127 0 0 /news/marijuana.php 1 0 0 0 /news/crowborough270117 1 12131 0 0 /news/wp-admin/x.php 1 0 0 0 /news/551a9250c1004 3 34609 0 0 /news/letshopeitsfolkestoneandramsgateinthenextroundsaysjimward 1 12711 0 0 /news/kentleague/erithtown/31staug04.html 1 0 0 0 /news/soccershortsbromleygreenarelookingforgroundalternativessaysmanagerdavesmith 1 24351 0 0 /news/551a9c0ee7494 4 181166 0 0 /news/NationalLeague220420 2 15109 0 0 /news/langtonourmindshavetoberighttoavoidgiantkilling 1 16018 0 0 /news/walkervowstoendhisbarrenfacuphistory 1 12064 0 0 /news/rothwell081005.html 1 0 0 0 /news/dartsfansraise1500frominternetauction-cassrejectsdovermove 2 16547 0 0 /news/bradbrookboostforburman 1 14980 0 0 /news/tonbridge180915 3 25806 0 0 /news/ebbsfleetunitedopentheirgatesfortrophytie 1 12220 0 0 /news/551a924ff0736 1 3771 0 0 /news/whitstable300715 2 31905 0 0 /news/imhappywithprogresssofarsayshernebaybosssamdenly 1 15512 0 0 /news/551a925067b79 2 19430 0 0 /news/macclesfield190819 1 12851 0 0 /news/whitstable130805.html 1 0 0 0 /news/cassiusistoogoodforthekentleaguesaysoboyle 1 12720 0 0 /news/metrtonb110519 2 49110 0 0 /news/sct230518 1 15487 0 0 /news/13thmar05.html 1 0 0 0 /news/551bc5e46ac75 1 11016 0 0 /news/dartford200905.html 1 0 0 0 /news/theclubwanttowinthefatrophyandithinkwecansaysdoverathleticmidfielderliambellamy 1 16884 0 0 /news/551bc99c76114 2 23648 0 0 /news/551a931e64c76 2 23374 0 0 /news/topsixwouldbeniceandafinalsaysfleetleisurebossleerichmond 1 15525 0 0 /news/ebbsfleetunited1-3cambridgeunited-itwilltaketimetogetitright-daish 1 24815 0 0 /news/551bc5dece9f3 1 12692 0 0 /news/551a979a772dc 1 6176 0 0 /news/margate250118 2 26916 0 0 /news/551bc99dbe7a4/kentleague/cray/kentleague/sladegreen/chessingtonvsladefr260703.html 2 15653 0 0 /news/soccershortsinjurypronegoalkeepermittenhasplayedhislastgameforfolkestonesayscugley 1 28112 0 0 /news/551bc5dd560dd 2 17420 0 0 /news/551a97b0aa631 1 11508 0 0 /news/lashingsmakingprogressastheybidtotakeovermaidstoneunited 1 13929 0 0 /news/theresnoreasonwhywecantmaketheplay-offs-warrilow 1 20390 0 0 /news/myplayersarentmotivatedbymoneysayslovell-exclusive 1 14289 0 0 /news/hythetown2-0hastingsunited-itsgreattohavethatwinningfeelingbacksaystimdixon 2 39457 0 0 /news/wehaveanoutsidechanceofmakingtheplay-offssayswalker 1 12048 0 0 /news/bearsted110517 1 13358 0 0 /news/theseasonsofarisaboutasgoodaswecouldhaveexpectedsayselthampalaceschrismccarthy 1 14394 0 0 /news/thefacupdraw2012-2013 1 15303 0 0 /news/551bc99dbe7a4/drmartens/eastern/chatham/kentcounty/22ndjune03.html 2 15653 0 0 /news/thestandardofourleagueisgoingtobehighthisyearsaysfolkestoneinvictabossneilcugley 1 13409 0 0 /news/erithbelv240316 1 13585 0 0 /news/23rdmar05.html 1 0 0 0 /news/ashfordunited0-3gillingham-itsnicetoseeashfordbackonitsfeetsaysandyhessenthaler 1 23240 0 0 /news/cray-wanderers.com 1 0 0 0 /news/thamvcd271217 2 15096 0 0 /beckenham-2003-2006/3 4 29620 0 0 /news/ioxi-rex4.php7 1 0 0 0 /news/tonbridgeangels0-3afcwimbledon-wewerebeatenbythebettersideadmitswarrilow 1 18069 0 0 /news/glebe100517 1 12611 0 0 /news/wellcarl061215 2 39383 0 0 /news/kolaaddsmorefizzforfolkestone 1 17437 0 0 /news/stanhaye061220 4 142722 0 0 /news/kentleague/VCD/7thjuly03.html 1 0 0 0 /news/resultspreseason2015 2 72848 0 0 /news/phoegleb190717 2 71507 0 0 /news/erith&belvedere111204.html 1 0 0 0 /news/markjennerstandsdownasfolkestoneinvictachairman 1 15011 0 0 /news/ksports130917 1 11890 0 0 /news/26thoct05.html 1 0 0 0 /news/wejusthavetomakesurewerenotgoingtobepartofacupshockstorysaysmarkgoldberg 1 16143 0 0 /news/bromley070519 2 17921 0 0 /news/ebbsfleetunitedpulloffdannykedwelltransfercoup 2 27582 0 0 /news/tunwells250915 1 13433 0 0 /kent-invicta-league/10 3 45859 0 0 /news/FACupDates130820 3 31210 0 0 /news/welling150617 1 12005 0 0 /news/ashfordunitedwilltreateveryonewiththeutmostrespectsaysmarkpatterson 1 15906 0 0 /news/craywanderers2-0whitstabletown-seagermyteamhaveweightoftheworldontheirshoulders 1 20113 0 0 /news/signuptokeepcraywanderersreturnhomealive 1 13779 0 0 /news/charltonathletic1-2gillingham-anexplayeralwayswantstoproveapointsaysjamesmarrs 1 22707 0 0 /news/fisher0-0crayvalleypapermills-ourdecisionmakinginthefinalthirdislacking-chapman 1 20410 0 0 /news/canterbury081018 1 13972 0 0 /news/absentmilesconfidentofpickingupholidaypoints 1 12833 0 0 /news/hastingsunited2-1chathamtown 1 13306 0 0 /news/vcdbill250415 2 62864 0 0 /news/551bc5da4513c 4 53188 1 1 /news/mychairmanwillnotcutmybudgetifweloseinfatrophysaysramsbossjimward 1 14058 0 0 /kent-invicta-league/www.heineken.co.uk/ 1 4529 0 0 /news/551a97b277c27 1 14750 0 0 /news/woking2-1wellingunited-weveswitchedoffattwovitaltimessaysjamieday 1 18528 0 0 /archive-2006-2014/245 1 19205 0 0 /news/dawsonpenslengthydealtostayatthamesmead 1 14592 0 0 /news/crayrams311216 3 91443 0 0 /news/snodstap040515 1 31407 0 0 /news/wemustnotletitslipsaytitle-chasingmanagers 1 18604 0 0 /news/greenhast270916 2 54076 0 0 /news/doverathletic070221 1 12615 0 0 /news/drmartens/eastern/sittingbourne/3rdfeb04.html 1 0 0 0 /news/551bc99dbe7a4/drmartens/eastern/dartford/kentleague/lordswood/30thsept03.html 2 15653 0 0 /news/551a931e5b944 1 11498 0 0 /news/drmartens/eastern/tonbridge/tonbvfolk131203.html 1 0 0 0 /news/tonbridgeangelssearchfornewbosswhilestevebrownhailsebbsfleetsplay-offspot 1 15647 0 0 /news/551a9c91ea9e5 3 33465 0 0 /news/knightrelishinghisreturntodover-exclusive 1 19851 0 0 /news/werenotgoingtostandstillinsistshessenthaler 1 15539 0 0 /news/551a9250f260d/10thoct05G.html 2 6643 0 0 /news/underestimateusatyourperilmcmahontellstitlefavouritesware 1 14937 0 0 /news/millwall290620 2 24059 0 0 /news/maidstoneunited2-1wealdstone-wemaybehittingformattherighttimesayshume 1 20931 0 0 /news/seagerhailshisfive-starteam 1 13645 0 0 /news/ourfixtureback-logisridiculousbemoanstunbridgewellsbossmartinlarkin 1 17621 0 0 /news/hopefullywellwintheleagueoutrightsaysebbsfleetunitedchairmandrabdullaal-humaidi 1 11987 0 0 /news/exbromleybossreturnstoks 1 11340 0 0 /news/theboyswillgettheirheadsdownandshowwhattheycandosayssittingbournebossgaryabbott 1 15984 0 0 /news/soccershorts241215 3 40898 0 0 /news/dulwich020618 1 12524 0 0 /news/551bc99dbe7a4/drmartens/eastern/folkestone/kentcounty/26thjune03.html 2 15653 0 0 /news/areyouinterestedinsponsoringthiswebsite 1 10750 0 0 /news/fiskchallengeshisplayersprovetomeweveturnedthecorner 1 14511 0 0 /news/551a97b0c6312 2 27824 0 0 /news/elmstead020817 1 13076 0 0 /news/wp-includes/style.php 1 0 0 0 /news/ramsgate050421 2 25043 0 0 /news/crowborough020520 1 10879 0 0 /news/doverchairmanplansforpromotion 1 14750 0 0 /news/551a99e4610a7 2 27034 0 0 /news/redbridge0-4chathamtown-ithinkweveunderachievedsayschathamtownbosskevinwatson 1 21299 0 0 /news/theresalotmoretocomefrommysideinthefuturesaysdartfordbosstonyburman 1 15053 0 0 /news/6thjune05.html 1 0 0 0 /news/wevejustgottogooutthereanddothebusinesssayspeckhamtownbossalanjacobs 1 17913 0 0 /news/kentleague/maidstone/23rdjuly03.html 1 0 0 0 /news/551bc99dbe7a4/drmartens/premier/dover/kentleague/deal/dealvcray011103.html 2 15653 0 0 /news/stonesenticepettitandrichmondbacktotheclub 1 21677 0 0 /news/wemustcreatehistorybyreachingthefavasewembleyfinalsayshernebaybosssimonhalsey 1 17807 0 0 /news/premierleagueplough1minto68bluesquareclubs 1 15485 0 0 /news/sittingbourne050216 2 27835 0 0 /news/whyteleafe140621 2 35823 0 0 /news/playershavegottostandupandbecountedsaysbromleybossmarkgoldberg 1 15303 0 0 /news/sevehyth040220 3 73174 0 0 /news/idontthinktheresanyeasygamesinthekentleaguesaysholmesdalecoachrossmitchell 1 13024 0 0 /news/resultsaprmay2017 2 128403 0 0 /news/tonbridgeangels0-1suttonunited-theresstilleverythingtoplayforsaystommywarrilow 1 21292 0 0 /news/soccershorts260619 2 35554 0 0 /news/aresittingbournepeopleinterestedintheirclubanymore 1 15378 0 0 /news/NationalLeague170620 3 20629 1 1 /news/comingup 1 10587 0 0 /news/weareworkingtirelesslytomakethisworksayssittingbournejoint-bossnickdavis 2 16678 0 0 /news/kentleague/ramsgate/ramsvsidleyfavase230903.html 1 0 0 0 /news/551bc99d624ce 2 27287 0 0 /news/margatevexeter160803.html 1 0 0 0 /news/551bc5dd868b5 2 17242 0 0 /news/leavingfavershamwasnotaneasydecisionsaysdaleskelton 1 15447 0 0 /news/17thoctZ.html 1 0 0 0 /news/paulfoley100420 1 16580 0 0 /news/ivemissedbeingaroundtheplaceandbeinginvolvedsaysdealtownstalwartderekhares 1 15956 0 0 /news/tunbwhit050518 1 30354 0 0 /news/lovellexpectingtotakehalfadozentrialiststoramsgate 1 11844 0 0 /news/burnham0tonbridgeangels1-leighwantshisplayerstopushforfirstteamplaces-exclusive 2 23235 0 0 /archive-2006-2014/118 1 20659 0 0 /news/drmartens/premier/dover/13thoct04.html 1 0 0 0 /news/27thfeb04.html 1 0 0 0 /news/551a95b3d36c4 3 32097 0 0 /news/play-offsarearealisticambitionsayscugley 1 16316 0 0 /news/truroisneveraneasyplacetogotosayswellingunitedbossjamieday 1 11146 0 0 /news/ramswoki041123 8 249828 0 0 /news/budgetcutsforcerobbinstobringinlocaltalent 1 14092 0 0 /news/october2008results 1 21840 0 0 /news/robcurtis070719 1 14817 0 0 /news/itwouldhavebeennicetobegivenlongertoturnthingsaroundsaysaxedkeithbird 2 22901 0 0 /news/hernebay3-1favershamtown-iwontneedtomotivatemyplayersforsecondleg-luchford 1 34509 0 0 /news/croydon020818 1 12416 0 0 /news/therescertainlynobottomlesspitofmoneyatdoverinsistschairman 1 14676 0 0 /news/551bc5de58b6e 2 19809 0 0 /news/kentleague/maidstone/whitstable241004.html 1 0 0 0 /news/ryman/bromley/3rdaug03.html 1 0 0 0 /news/hollandsblair1-0ashfordunited-therewasabitofpressueonustodaysaysblairbosspiggott 1 20568 0 0 /news/canterburycity190921 2 20209 0 0 /archive-2006-2014/237 1 19157 0 0 /news/enfieldtown3-1margate-itwasntourdaytodayadmitsterrybrown 1 24611 0 0 /news/vcdathletic3-0hythetown-foleyitsabouttimewebeatthem 1 14655 0 0 /news/551a96dbceb66 2 14590 0 0 /news/turningpattersonfromclaretintoawhitewilladdspicetofacuptieatchelmsfordsaysbird 1 21235 0 0 /news/tonbridgeangels3-2harrowborough-whatthefanssawwasafantasticnightfortonbridge-obrien 1 28688 0 0 /news/englandfrance151115 3 33607 1 0 /news/551a979b05a34 1 4880 0 0 /news/horshamymca050904.html 1 0 0 0 /news/ebbsfleet140720 1 15746 0 0 /news/itsnicetogetofftoagoodstartsayserithbelvederebossmickycollins 1 13238 0 0 /news/551a99e3813ef 1 11051 0 0 /news/corinthian210220 1 16393 0 0 /news/551a95b36d1f9 3 17462 0 0 /news/werrenotlookingtobuildshort-termwerelookingtothefuturesaysjustinluchford 1 16062 0 0 /news/dartford5-0hendon-haworthsbookingignitedfansandteam-burman 1 24812 0 0 /news/551bc99bc2e31 1 5019 0 0 /news/rookgivenanotherchancetoimpressseagulls 1 18337 0 0 /news/gillinghamwomen190822 3 34413 1 1 /news/551bc5e78531e 8 43474 5 6 /kent-county-league/4 3 41255 0 0 /news/551a9c915279e 3 28543 0 0 /news/hopefullyjodybrowncancomeinandhitthegroundrunningsayswellingdefenderlouifazakerley 1 14716 0 0 /news/sutubrom030315 1 24851 0 0 /news/facarlsbergvasethirdrounddraw-2 1 10544 0 0 /news/clubsbidtoimprovefacilitiesatdansonyouthcentre-holmesdaleconfirmdaviesisstayingput 1 19084 0 0 /news/bromley1-1stainestown-itslikealoss-werealldevastatedsaysbromleycoachneilsmith 1 23320 0 0 /news/551a9cf58db98 2 23943 0 0 /news/ryman/bromley/18thjuly03.html 1 0 0 0 /news/werenotunderpressuretowintheleaguesaysfolkestoneinvictabossneilcugley 1 14356 0 0 /news/bromley170617 1 11369 0 0 /news/16thjune05.html 1 0 0 0 /news/hollandsblair2-0hythetown-wevegottostaypositivesayshythetownassistantdarrenbeale 1 25360 0 0 /news/ivelearntalotfromlovellandithankhimsaysdepartinglangton 1 18985 0 0 /news/dockersbossoboyleofferstrialistsafleetingchance 1 14492 0 0 /news/metropolitanpolice3-3sittingbourne-brickiesgoalkeeperrescuespoint 1 13877 0 0 /news/kentleague/cray/15thjuly03.html 1 0 0 0 /news/dartford4-1basingstoketown-dannyharrismeansalottoussaysdartsbosstonyburman 1 18926 0 0 /news/551a99e38cb83 1 13337 0 0 /news/greatwakeringrovers2chathamtown0 2 15902 0 0 /news/551a9250d2c58 1 3589 0 0 /news/soccershortscraywanderersfacesheffieldinoldestclubbattle 1 32408 0 0 /news/iknowmyteamwillonlygetstrongersayshollandsblairbosspaulpiggott 1 13411 0 0 /news/punjab290319 1 12303 0 0 /news/551bc5e5d6092 1 14547 0 0 /news/dartford240905.html 1 0 0 0 /news/craywandererslosestrikerlaurenthamicibutbringingoalkeeperandywalkerfrommaidstoneunited 1 13559 0 0 /news/fcelmstead160621 1 12573 0 0 /news/30thjune04.html 1 0 0 0 /news/dartfordbosstonyburmansignsadambirchallonloanfromgillingham 1 13110 0 0 /news/551a97b13be5d 1 14759 0 0 /news/sittingbourne100119 3 28458 0 0 /news/myyoungsterswillgetachancesaysdockersboss 1 24072 0 0 /news/26thjuly04.html 2 0 0 0 /news/afccroydonathletic170120 1 13884 0 0 /news/551bc99dbe7a4/kentleague/thamesmead/ryman/bromley/bromvdartksc071003.html 2 15653 0 0 /news/othernews/24thmar04.html 2 0 0 0 /news/ryman/bromley/bromvnorthleighfac300803.html 1 0 0 0 /news/facupspecialgreeniesfridaypreview 1 33175 0 0 /news/iknowtheplayersivegotherewillgetusoutofthemessvowswhitstabletownbosspeternott 1 15464 0 0 /news/sixcandidatesinlineforsevenoakstownjob 1 11745 0 0 /news/stansfeld040416 1 12412 0 0 /isthmian-league/35 3 44632 0 0 /news/therecorddoesntreallymeanmuchifwedontgetoutoftheleaguesayswellingbossjamieday 1 15158 0 0 /news/wevegotagroupofplayerswhogiveeverythingthattheyvegotfortheclubsaysjimward 1 15104 0 0 /news/greencor031017 2 53187 0 0 /news/crayvalley060122 3 30388 0 0 /news/greeniesfridaypreviewonthefacuptrail 1 17541 0 0 /news/kickcons130415 2 17689 0 0 /news/weveplayedthebestfootballandbeenthebestsideallseasonsaysvickerschampionbenpayne 1 16988 0 0 /news/midweekmatchreports 1 23834 0 0 /archive-2006-2014/112 1 20616 0 0 /news/FAVaseFATrophystatement210320 1 11019 0 0 /news/rymanreports 1 55714 0 0 /news/itsgoodtomakehistoryfortheclubsayscrayvalleybossstevechapman 1 15074 0 0 /news/551bc5dab18cc 3 27365 0 0 /news/drmartens/premier/dover/10thnov04.html 2 0 0 0 /news/wp-content/themes/alera/alpha.php 1 0 0 0 /news/551bc99b61e0a 2 16624 0 0 /news/theresnoreasontosuggestthatwecannotbeasgoodasanyonesaysfolkestonebossneilcugley 1 11977 0 0 /news/andyconstableleadsgoalscoringchartswith31goals 1 12333 0 0 /news/resultsdecember2020 2 63537 0 0 /news/vcdathletic110720 2 24131 0 0 /news/ramsgate170804.html 1 0 0 0 /news/seageracceptsunderdogtagforsemi-finalcuptie 1 13417 0 0 /news/sheppey200820 1 11490 0 0 /news/hamptonrichmond1-1hythetown-hopefullywecanfinishoffthejobathomesaysscottporter 1 25185 0 0 /news/faappealleavestheclubinlimboadmitsfoley 1 22044 0 0 /news/thedressingroomiffullofconfidenceandsmilingfacessayscraywanderersbossianjenkins 1 14997 0 0 /news/kentleague/greenwich/greenwich.html 1 0 0 0 /chatham-2003-2006/www.heineken.co.uk/ 1 3175 0 0 /news/whitstabletown2-3eastbournetown-battlingqualitieswillhelpusbeatdropsaysseager 1 18151 0 0 /news/facupspecialwemustdothebusinessatbourneparksaysmartin 1 15769 0 0 /news/keisterreturnstomargate 1 14443 0 0 /news/551a956c3f311 1 4841 0 0 /news/551a9c933c753 3 32062 0 0 /news/faversham010617 3 31537 0 0 /news/ifwedontgoupwellbeaforcenextyearwarnscraywanderersbossianjenkins 1 17329 0 0 /news/thamesmead181204.html 1 0 0 0 /news/NationalLeagueSouthClubsStatements200221 2 24511 0 0 /news/doverathleticunveilbirchallsigning 1 13559 0 0 /news/crayport211118 5 91763 2 2 /news/graemeandrewsreturnstobearstedafterseven-yearsaway 1 12021 0 0 /news/thamesmeadtown2-0redhill-thepressurewasonustowinsayskeithmcmahon 2 42652 0 0 /news/leaguefixturesaugust-september2009 1 76215 0 0 /news/551a97b11bb79 1 13917 0 0 /news/hornchurch120305.html 1 0 0 0 /news/craycray210718 3 65015 0 0 /news/551bc99dbe7a4/drmartens/eastern/sittingbourne/drmartens/eastern/sittingbourne/sittveastthurrockfac270903.html 2 15653 0 0 /news/lanewantstocurbfridaynightdrinkingtoimproveresults 1 16194 0 0 /news/ijustthinkthebigthinginthislevelisconsistencysayswellingskipperjackparkinson 1 13732 0 0 /news/dartford210220 2 14561 0 0 /news/lukedaleywillbeagoodadditiontooursquadsaysdartfordbosstonyburman 1 12108 0 0 /news/551a9677506ac 3 39141 0 0 /news/14thdec03.html 1 0 0 0 /news/greenways110517 1 13354 0 0 /news/8thmay04.html 1 0 0 0 /news/28thapr04.html 1 0 0 0 /news/551bc99c028e4 2 22042 0 0 /news/phoenixsports200320 2 25573 0 0 /news/soccershorts170517 2 51997 0 0 /news/sittingbourne140122 3 25132 0 0 /news/ebbsbrom290415 1 27393 0 0 /news/opkchangenametobexleyborough 1 13265 0 0 /news/bearshythe090716 3 69239 0 0 /news/stonesbossjaysaunderssnapsuplocaltalent 1 18412 0 0 /news/croydon250322 1 13553 0 0 /news/dulwichhamlet010323 2 17722 0 0 /news/refereekevinwelshformsacademyatfavershamtown 1 14143 0 0 /news/anynewswillfollowhere-2 1 9743 0 0 /news/isthmianleague180919 2 30407 0 0 /news/sevenoakstown4-1tunbridgewells-wevehadalittlebitoftherubofthegreenadmitslevett 1 23130 0 0 /news/dartford1-1ebbsfleetunited-fansmadeitanafternoontoremember-daish 1 28443 0 0 /news/balhbeck210921 1 29376 0 0 /news/wefacesomedifficultgamesaheadwarnsbromleyassistanthaydenbird 1 17570 0 0 /news/folkestoneinvicta3-1worthing-johanterhorstshouldbeatafootballleagueclubsayscugley 1 27328 0 0 /news/imsopleasedforscottlindseysaysfolkestonebossneilcugley 1 20494 0 0 /news/scoutssearchforkentishtalent-exclusiveinterviews 1 17300 0 0 /news/deal090205.html 1 0 0 0 /news/ashfordlordswood010923 2 25491 0 0 /news/ryman/bromley/28thsept03.html 2 0 0 0 /news/551a956cceacd 1 4603 0 0 /news/waltoncasuals2-1chathamtown-wehavetostartbeleivinginourselves-obrien 1 19874 0 0 /news/wejusthavetomaintainourperformancelevelssaysfavershamtownbossrayturner 1 14371 0 0 /news/soccershortsihadtothinklongandhardaboutleavingchathamforfolkestonesayscass 1 54372 0 0 /news/fleetsignfuller 1 10605 0 0 /margate-2003-2006/3 3 31924 0 0 /news/weregoingtowellingtocauseanupsetinsistswarrilow 1 14683 0 0 /news/thesquaditgoingtobetestedsayswellingunitedbossjamieday 1 13289 0 0 /news/weremorethancapableofgettingaresultatbognorregistownsaysjaysaunders 1 13684 0 0 /news/27thmay04.html 1 0 0 0 /news/togetsuchaflatrefusalwasremarkableadmitscraywanderersassistantjoefrancis 1 18882 0 0 /news/551bc99d9f4ef 2 23635 0 0 /news/ambitiousvickersjoinconferenceyouthelite 1 12870 0 0 /news/gwr300405.html 2 0 0 0 /news/themostimportantthingistowintheleaguesaysblyspartansbossmatthume 1 13802 0 0 /news/wevegotsomethingtoshowforoureffortssaysproudabbott 1 13506 0 0 /news/teammoraleisexcellentrevealsdartsbossburman 1 11999 0 0 /news/hernebay270320 2 29692 0 0 /news/doubleswoopforfisher 1 13343 0 0 /news/doverathletic150620 1 11334 0 0 /news/craywanderers3-2waltonhersham-jenkinsrelishingreunionwithabbott 1 16553 0 0 /news/itsimportantthatno-onestartspressingthepanicbuttonsaystommywarrilow 1 15174 0 0 /news/worthing050905.html 1 0 0 0 /news/erithtown120123 1 15599 0 0 /news/ryman/bromley/slouvbrom121103.html 1 0 0 0 /news/westartasunderdogsagainstastrongbeckenhamsidesaysfleetleisurebossleerichmond 1 18424 0 0 /news/bluesquarefixtures 1 18197 0 0 /news/sevenoaks030905.html 1 0 0 0 /news/maidstone291018 1 12988 0 0 /news/livecoveragestainestown2-1ramsgate-penaltydecisioncostsramsplaceinplay-offfinal 1 26215 0 0 /news/hessenthalerlookstocompletehisjigsaw 1 11521 0 0 /news/erithtown030217 1 12521 0 0 /news/workbeginstobringstonesbackhome 1 12465 0 0 /news/sevash150317 1 35260 0 0 /news/wevenotshownenoughdesireinkentderbiesbemoansnott 1 16564 0 0 /news/february2010results 1 75422 0 0 /news/canterburycity5-1greenwichborough-togoroundkickingourplayersisadisgraceblastsaustin 1 27955 0 0 /news/551a96dc559d4 3 41142 0 0 /news/chipstead290621 4 37567 0 0 /news/551bc5e63b777 1 16787 0 0 /news/clarkesuffershorrificinjury 1 12211 0 0 /news/wereinapositiontoberespectedsaysbridonropesmanagergarylisney 1 16218 0 0 /news/drmartens/eastern/sittingbourne/10thjuly03.html 2 0 0 0 /news/play-offsemi-finalspecialwerereadyforpromotionsayscraychairman 1 18152 0 0 /news/itsoutofourhandsbutwellgiveitagoinsistsburman 1 12593 0 0 /news/cvalwing180215 1 23712 0 0 /news/seageraimingforninepointsoverfestiveperiod-exclusiveinterviews 1 17125 0 0 /news/wewillnaturallymissliamdicksonsaysfolkestoneinvictabossneilcugley 1 14203 0 0 /news/phoenixsports311218 3 31262 0 0 /news/dealtown250322 1 13810 0 0 /news/551bc5dea4a6a 2 15816 0 0 /news/thebigkick-offkentleagueannouncefixturelists 1 14039 0 0 /news/dealvcrayfav181003.html 1 0 0 0 /news/idehill1-4peckhamtown-wevemadeareputationofbeingagoodsidesaysalanjacobs 1 34290 0 0 /news/ifwekeepbeatingteamsaroundusitputsusinagoodpositionsayswellingbossjamieday 1 15511 0 0 /news/snodlandtown291020 1 14471 0 0 /news/551a9c0ed57a4 4 36191 1 1 /news/whitstable111120 2 25107 0 0 /news/hollands050617 1 14945 0 0 /archive-2006-2014/205 1 19992 0 0 /news/folkestoneinvictabringgillinghamgameforward 1 15352 0 0 /news/starsturnoutforgoalkeepinglegendrogerstestimonialmatch 1 14177 0 0 /news/28thmar04.html 1 0 0 0 /news/kentishfootballaresoproudofthefleetletsmakeitawembleydoublesaysmccarthy 1 12974 0 0 /news/daishbeatstransferdeadlinebecauseheknowshowe 1 11037 0 0 /news/551a92504f4c8 2 15780 0 0 /news/haywardsheath240122 3 30257 0 0 /news/visittonewstadiumhelpsstrikerstaywithdarts 1 12795 0 0 /news/551bc5e89d518 1 15451 0 0 /news/ramsgateunveiljustinluchfordastheirnewmanager 1 12298 0 0 /news/sittingbourne090715 2 24844 0 0 /news/nickysouthallisagreatsigningforwhitstabletownsaysbossjustinluchford 1 16219 0 0 /news/margate061223/home 1 3891 0 0 /news/favershamtown140423 3 39976 0 0 /news/sevenoakstown1-4dartford 1 19584 0 0 /news/9thaug04.html 1 0 0 0 /news/hernebay100915 2 25748 0 0 /news/brommaid031216 2 42228 0 0 /news/tunberit301121 4 139302 0 0 /news/crayareahardsidetobreakdownwarnsbutler 1 26041 0 0 /news/formerpremierleagueacesetforhernebaymove 1 22008 0 0 /news/sittingbourne2-1fleettown-thewholeteamhavebeenbrilliant-garyabbott 1 19389 0 0 /news/fisherchairmantomeetfanstoprovidestadiumupdate 1 12333 0 0 /news/ourmindsareonthejobinsistswatson 1 13089 0 0 /news/sheppeyunited030623 2 30471 0 0 /news/551bc5dd82bcc 2 19505 0 0 /kent-county-league/13 2 22812 0 0 /news/craywands080419 3 28651 0 0 /news/sporlark280222 6 152681 0 0 /news/woundedanimalsfightbackwarnsseager 1 18295 0 0 /news/canterbury101117 1 12087 0 0 /news/wejustwanttobecompetingagainlikewedidlastyearsaysbromleybossmarkgoldberg 1 14942 0 0 /news/tonbbill290816 2 54000 0 0 /news/551a9c0ed1eac 3 31766 0 0 /news/fcelmkfu210417 2 19069 1 1 /news/iseenoreasonwhywecantachievepromotionthisseasonsaysnewhythetownchairman 1 12843 0 0 /news/daishmacdonaldcontractshowsourlongertermcommitmenttobringsuccesstotheclub 2 17307 0 0 /news/doversigncumbersonloan 1 11469 0 0 /news/551bc5e85057d 1 12357 0 0 /news/bromley100120 2 17504 0 0 /news/tonbridgeangels3-2ramsgatemainservesupsixofthebest 1 18652 0 0 /news/ithinktheladsconfidencehasdroppedalittlebitadmitswhitstabletownbossnickysouthall 1 16895 0 0 /news/heybridge051105.html 1 0 0 0 /news/wellgiveplayersafaircrackofthewhiptobuilduptheirfitnesssayssawyer 1 16806 0 0 /news/imreallypleasedparkinsonandpireshavestayedsayswellingunitedbossjamieday 1 11294 0 0 /news/wellbrom061015 1 31413 0 0 /news/KentFAStatement140921 2 26182 0 0 /news/NationalLeague130720 2 14953 0 0 /news/sittingbourne240218 2 25459 0 0 /news/erithbelv040816 1 12662 0 0 /news/wp-includes/js/tinymce/plugins/compat3x/css/index.php 1 0 0 0 /news/imquietlyconfidentthateverythingwillturnoutallrightsayswellingunitedowner 1 16982 0 0 /news/croydonath020817 1 14010 0 0 /news/soccershortswarrilowfacesfansquestions 1 15626 0 0 /news/mcmahonreplacesbladetopushthamesmeadalongfurther 1 12426 0 0 /news/tunhay050917 2 65994 0 0 /news/551bc99af15a9 2 23923 0 0 /news/kentleague/beckenham/22ndnov04.html 1 0 0 0 /news/thamesmeadkick-startspicesfootballingcareer 1 16057 0 0 /news/afchornchurch2-0maidstoneunited-wethoughtwecouldgetoutofitadmitsjaysaunders 1 14732 0 0 /news/braintreetown3bromley1 2 18553 0 0 /news/wehavetobeatthebigboyssaysjones 1 20603 0 0 /news/maidstoneunited0-1margate-margatewerethebettersideadmitshume 1 26069 0 0 /news/551bc99dbe7a4/kentleague/sladegreen/ryman/bromley/bromvmarl171203.html 2 15653 0 0 /news/wp-includes/index.php 1 0 0 0 /news/greeniesfridaypreview17thmarch2006 1 19733 0 0 /news/ashfordtown1-3waltonhersham-wecantmakeanymooremistakessayslovell-exclusive 1 16343 0 0 /news/folkwort140821 5 160360 0 0 /news/weareupwiththebigboys-butwelldoourbestsaysdartfordbosstonyburman 1 16468 0 0 /news/craytilbury190415 3 65989 0 0 /news/greesnod081121 2 71144 0 0 /news/thamestilb070316 2 57799 0 0 /news/margatebossiainoconnellhailscamaraderieathartsdownpark 1 18737 0 0 /news/rusthall080622 4 46070 0 0 /news/kentleague/hernebay/ramsgate170804.html 2 0 0 0 /news/dartford1-0crawleytown-jetsettingchampionswonderstrikedumpsfavouritesoutoffatrophy 1 18806 0 0 /news/bromley040416 2 16173 0 0 /news/resultsdecember2008 1 19745 0 0 /news/itwillbeatoughbattleagainstdartfordsayswellingunitedbossjamieday 1 17618 0 0 /news/gravesendnorthfleet1margate0-daishjacksonsinjurytakesshineoffreachingfinal 1 16874 0 0 /news/cugleywelcomesbacktrio 1 18961 0 0 /news/croydon170120 2 16004 0 0 /news/afccroydonathletic040823 2 17595 0 0 /news/maidstoneunited0-0harrowborough-thecommitmentshownwithninemenshouldkick-startus-ford 1 23107 0 0 /news/551a931dab6ff 1 10976 0 0 /news/551a9cf5676de 3 46526 0 0 /news/nealleavessittingbournetofindregularfootball-exclusive 1 12940 0 0 /news/tootingmitcham2-2tonbridgeangels-mysquadisgoodenoughforbluesquaresouth-warrilow 1 18060 0 0 /news/sandemanfairclough050715 2 17711 0 0 /news/budgetcutwillhaveanaffectonplayersstayingsayswellingunitedbossjamieday 1 12660 0 0 /news/16thsept04.html 1 0 0 0 /news/darronanslowpartscompanywitherithdartfordtownforapossibleswitchtosevenoakstown 1 12374 0 0 /news/sevenlewes0070916 1 28644 0 0 /news/thamesmeadtownwait12weeksforplanningpermissiontobuildtheirmini-dartford-exclusive 1 14347 0 0 /news/551a9c9254911 3 35805 0 0 /news/roystonwemustcutoutindividualerrors-exclusiveinterview 1 12351 0 0 /news/bromley190218 1 17213 0 0 /news/playingfourgamesaweekisdifficultsaysburman 1 16687 0 0 /news/camberley110904.html 1 0 0 0 /news/551bc5ddbd980 1 14359 0 0 /news/551a9b481d9ed 4 29700 1 0 /news/bromley1-2eastleigh-wedontwanttofinishwithnothingsaysbromleybossmarkgoldberg 2 35451 0 0 /news/whiteebbs040516 1 24402 0 0 /news/551a956cbe261 1 6453 0 0 /news/stainvbrom090304.html 1 0 0 0 /news/welfordpensnewdealtostayatdoverathletic 1 11746 0 0 /news/wp-content/plugins/tex/css.php 1 0 0 0 /news/fansupsetasfavouritefalanaisshownthedoor 2 17638 0 0 /news/crowborough270620 1 14909 0 0 /news/MPvbrom070204.html 1 0 0 0 /news/afcsudbury0-0ramsgateramswon5-4onpensramsgatesbiggestandbestnightsayschairman 1 24541 0 0 /news/551bc99dbe7a4/conference/margate/kentleague/whitstable/23rdjune03.html 2 15653 0 0 /news/30thsept05.html 1 0 0 0 /news/hytheast120823 5 156890 0 0 /news/wp-content/plugins/ioptimizations/a57bze8931.php 1 0 0 0 /news/551a979a4fb08 1 4907 0 0 /news/epsomandewell101021 2 14961 0 0 /news/wevegottobeatourbesttoclaimback-to-backwinssaysyorath 1 12599 0 0 /news/wejustneedtokeeptherungoingsaysfavershamtowncoachclivewalker 1 14314 0 0 /news/kentstarscomeoutinforcetohonoursyko 1 12643 0 0 /news/3rdjan06.html 1 0 0 0 /news/551a956c2344c 1 3936 0 0 /news/IsthmianLeague140320 3 31606 0 0 /news/soccershortsfleetpasesideplayinmaddamstestimonialmatch 1 17270 0 0 /news/dartsfansarenotbeingkeptinthedark 2 14231 0 0 /news/aldebrom200218 1 27080 0 0 /news/wemustclaimbraggingrightsagainsayswarrilow 1 15033 0 0 /news/crayvalley291018 1 14051 0 0 /news/lewash121016 2 49359 1 1 /news/cugleypleasedwithopeningtrainingsession 1 15478 0 0 /news/551a97b22cc73 1 13540 0 0 /news/ashfordunited250422 3 35243 0 0 /news/erithandbelvedere190519 1 14758 0 0 /news/phoenixsports011121 2 30070 0 0 /news/drmartens/premier/welling/18thjuly03.html 1 0 0 0 /news/obrienlookingforwardtotonbridgereturn 1 13717 0 0 /news/shittuwillfrightenyouwarnsyorath 1 12398 0 0 /news/hernvlords111003.html 1 0 0 0 /news/folkestoneinvictayouthteamskippercallumwraighttogethisfirstteambreak 3 20552 2 2 /news/erithbelvedere2-1sidleyunited-thingsaregoingtohappenwithfordonboard-gorman 1 34845 0 0 /news/551bc5e28762e 1 11188 0 0 /news/ifeelwereveryclosetogettingthingsrightsaysdartsbosstonyburman 1 18008 0 0 /archive-2006-2014/227 1 19863 0 0 /news/iwillputasidetogetherthatthetownofsittingbournewillbeproudoffsaysnickdavis 1 15069 0 0 /news/hytheunveildentasnewfirstteamcoach 1 16415 0 0 /news/bromley4-0londonbari-weachievedeverythingthatwewantedsaysmarkgoldberg 2 40700 0 0 /news/551bc5de17b4d 1 12766 0 0 /news/chatshep281219 1 38488 0 0 /news/551bc99dbe7a4/drmartens/premier/welling/drmartens/eastern/ashford/12thsept03.html 2 15653 0 0 /news/551bc5dad05ed 4 37628 0 1 /news/breakingnews11pmdartfordreluctantlyacceptleagueswitch 1 13412 0 0 /news/fisherbossgarylisneywantshissidetoshowprogression 1 12467 0 0 /news/ivehadenoughofgamesbeingcalledoffsaystonbridgeangelsbosstommywarrilow 1 22562 0 0 /news/porterplotsfacupgiantkilling 1 16370 0 0 /news/phoenix160518 2 28498 0 0 /news/thestonesaregoingup 1 10813 0 0 /news/soutsitt140922 3 67169 0 0 /news/illplaysomeoftheyoungerladsandreservesintheleaguecuprevealsfavershambossrayturner 1 13367 0 0 /news/snodlandtown100921 1 12918 0 0 /news/coldsnapforcesdoverathletictorethinktravelplanstofleetwood 1 24424 0 0 /news/kentleague/sporting/sporting.html 2 0 0 0 /news/551a9250254ae 2 25032 0 0 /news/bromley260617 2 20195 0 0 /news/soccershorts040616 2 45417 0 0 /news/ramsgate180919 3 29862 0 0 /news/551a931dbac22 1 12003 0 0 /news/ashford111116 1 11722 0 0 /news/ahwansetshimselftwenty-goaltarget 1 12754 0 0 /news/winchester111204.html 1 0 0 0 /news/maldon200805.html 1 0 0 0 /news/rymanleagueinsistfanshavetopaytowatchrearrangedkentderby 1 12786 0 0 /news/thamesmeadtown0-2hendon-thewholeplacejustneedsaliftsaysmeadbosskeithmcmahon 1 32908 0 0 /news/sitteast171020 5 161445 0 0 /news/9thdec04.html 1 0 0 0 /news/wehopeevenmorenewfanswilldiscoverthegreatfootballweareplayingsayschairjackpayne 1 17482 0 0 /news/walkerifeelthepressureontheseladsissometimestoomuch 1 18068 0 0 /news/551a9250c8377 2 15962 0 0 /news/folkestone300916 3 31416 1 1 /news/551a99e4d073c 2 37072 0 0 /news/lovellsubmitsseven-dayapproachformidfielder-exclusiveinterviews 1 23006 0 0 /news/kentleague/whitstable/26thfeb04.html 1 0 0 0 /news/15thJan04.html 1 0 0 0 /news/itrustkeistertogetonwiththecoachingsaysoconnell 1 14692 0 0 /news/greenwichborough0erithbelvedere1 1 12286 0 0 /news/crayvalley290718 1 11920 0 0 /news/soccershortsdartssigncableonloanfromthamesmead 1 18177 0 0 /news/favmerst280415 2 54078 0 0 /news/NationalLeague311220 2 17054 0 0 /news/hythetown281020 2 26053 0 0 /news/fishershep151116 1 36679 0 0 /news/551bc5e407707 1 14321 0 0 /news/farnieiwantthesamecommitment-exclusive 1 14650 0 0 /news/youcanhelptomakekentishfootballevenbetternextseason 1 13817 0 0 /thamesmead-2003-2006 13 171480 0 0 /news/551bc5ddded5f 1 12903 0 0 /news/facupfirstrounddrawebbsfleetunitedhighlightstobescreenedonitv 1 13584 0 0 /southern-counties-east-football-league/4 2 40553 0 0 /news/erithtownre-signlondonolympicgamesmedalhopeful 1 16493 0 0 /news/holmesdale090218 1 11867 0 0 /news/dovercalltheshotswewontselladambirchallinsistsdoverchairman 1 14116 0 0 /news/551a925012ca6 2 14776 0 0 /news/kentleague/thamesmead/17thjuly03.html 1 0 0 0 /news/abingdon231004.html 1 0 0 0 /news/lordvdeal191103.html 1 0 0 0 /news/sevenoakstown2-3hernebayaet-hat-trickherokinghadhisrightheadonhimtoday-halsey 1 44704 0 0 /news/soccershorts110518 2 43436 0 0 /news/wewanttoproduceourhome-growntalentsaysealham 1 13628 0 0 /news/551a96774afc2 2 27886 0 0 /news/dartford1-1sittingbourne-latesherwoodstrikestunswastefuldarts 1 21081 0 0 /news/whitstable190205.html 1 0 0 0 /news/551bc5e8c038b 1 11128 0 0 /news/thiswasanopportunitythaticouldntturndownsayscorinthiansnewbossjamescollins 2 18112 0 0 /news/doverathletic2-0aldershottown-adambirchallsendsdoverathleticintofacupthirdround 1 20456 0 0 /news/sittingbourne230919 2 22794 0 0 /news/rusthall030317 1 13188 0 0 /archive-2006-2014/150 1 19466 0 0 /news/stoneschairmanissuesapologyafterlatetrophypostponement 1 17135 0 0 /news/551bc99b8de72 2 19558 0 0 /news/ramsgatesubmitappealoverpointsdeductionblow 1 14655 0 0 /news/wehave19gamestogetateamtogetherthatwillcompeteforthetitlenextseason-margateceo 1 15379 0 0 /news/sevenoakstown0maidstoneunited4-stoneskentleaguechampions2005-06 1 17121 0 0 /news/beckenhamtown1-4sevenoakstown-friendsaveshisheroicsforcomeback-exclusiveinterviews 1 18462 0 0 /news/ourluckisturningsaystarget-manhaworth 1 14232 0 0 /news/margate261216 1 13028 0 0 /news/metpolice030504.html 1 0 0 0 /news/othernews/lsc03-04.html 1 0 0 0 /news/fordwellgiveitourbestshotforthewholeofkent 1 15051 0 0 /news/strikerianpulmantargets30goalstokeepwhitstabletownup 1 18361 0 0 /news/ineedmoneytoincreasesquadnumbersadmitswarrilow 1 21827 0 0 /news/forestgreenrovers0gravesendnorthfleet0 1 12355 0 0 /news/sittingbourne0-1folkestoneinvicta-abbottfentshisfuryatkentrivals 1 20854 0 0 /news/crayval011216 1 12502 0 0 /news/551a979a35040 1 4930 0 0 /news/ashford230705.html 1 0 0 0 /news/vcdathletic0-2maidstoneunited-tonyrusselliexpectthemtogiveeverythingforthisclub 1 30752 0 0 /news/cugleysevenmorepointswillkeepusup-exclusive 1 14772 0 0 /news/1stapr05.html 1 0 0 0 /news/lancashf170222 5 153550 0 0 /news/551bc99dbe7a4/kentleague/tunbridgewells/kentleague/cray/crayvchesfav221103.html 2 15653 0 0 /news/551a9678516dd 2 13763 0 0 /news/KSTSF030305.html 1 0 0 0 /news/youjustwontmeetabraverpersonthanleenoblesaysdartsbosstonyburman 1 16321 0 0 /news/phoenixsports080319 3 31108 0 0 /news/thamesmeadtown1-2maidstoneunited-winningbecomesagoodhabitsaysstonesbossjaysaunders 1 23029 0 0 /news/erithtown210316 1 15213 0 0 /news/wearegoingupinsistswhitstablechairman 1 13828 0 0 /news/soccershortsabbottclaimshedidntswearatthelinesmanafterpowerscontroversialgoal 1 19755 0 0 /news/firkinsdemandspositivereaction 1 13048 0 0 /news/ifwecanfinishinthetopthreeorfourthisyearillbeabsolutelyoverthemoonsayslonghurst 1 15777 0 0 /news/woking1-0dartford-itsabitterpilltoswallowadmitsdartfordbosstonyburman 1 24215 0 0 /news/551bc5e123192 1 14340 0 0 /news/551a979a00f12 1 4780 0 0 /archive-2006-2014/113 1 20489 0 0 /news/chathamtown0stamford1 2 15900 0 0 /news/newstrikerswillgiveusthecuttingedgeinthefinalthirdsayssammacneil 1 14800 0 0 /news/keevillisinmylong-termplanssaysmcmahon 1 14915 0 0 /news/whitehousestunningsaveisuptherewithbankspelesaveclaimsbinks-exclusive 1 17276 0 0 /news/drmartens/eastern/folkestone/folkvbht070204.html 1 0 0 0 /news/othernews/crayvalley031204.html 1 0 0 0 /news/chatham041015 3 33208 0 0 /news/theweekahead-1 1 19041 0 0 /news/croydonath250118 1 12088 0 0 /news/doverathletic2-2dartford-debutantsmakedreamstartsaskentderbyendsall-square 1 22458 0 0 /news/img/xmrlpc.php 1 0 0 0 /news/croydon100921 1 12434 0 0 /news/campaign100820 3 33402 0 0 /news/wewillnotjeopardisetheangelslong-termfutureinsistsnewchairman 1 15992 0 0 /news/lindseyreturnstofolkestoneascoach 1 16945 0 0 /news/fisher0-4erithbelvedere-everythingalfiemaytouchesseemstogoesinsaysmattlonghurst 1 33432 0 0 /news/chatsappointbinksastheirnewskipper 1 11100 0 0 /news/notmanypeoplearegivingusachanceoutsidedartfordsaystonyburman 1 16844 0 0 /news/551bc99dbe7a4/drmartens/eastern/ashford/ryman/bromley/22nddec03.html 2 15653 0 0 /isthmian-league/25 3 46471 0 0 /news/thefacupdraw2013 1 21515 0 0 /news/erithfisher020916 1 31634 0 0 /news/theleaguehavebeengreatallowinggamesongoodartificialpitchessaysglebebossrockymcmillan 1 14595 0 0 /news/crayvalley150117 1 12352 0 0 /news/fisher1-3bethnalgreenunited-wedidntperformonthenightadmitsstevefirkins 1 22306 0 0 /news/margateprepareformakeorbreakshowdowns 1 12415 0 0 /news/fanswanttouseaclubhouseatjameswhatmanway 1 11167 0 0 /news/kentleague/deal/Sampson8.html 1 0 0 0 /news/thamesmeadtown3-0whitstabletown 1 14865 0 0 /news/ashford020518 3 29321 0 0 /news/hythetown191021 6 72637 1 1 /news/thechairmanwouldkillmeifididnttakethefacupseriouslysaysvcdbosstonyrussell 1 16947 0 0 /news/iwouldlikeacrackatfootballmanagementsaysmunday 1 14206 0 0 /news/hollands&blair231120 1 13761 0 0 /news/gillingham110620 2 29119 0 0 /news/phoenix250915 2 24443 0 0 /news/lewisham240417 1 16244 0 0 /news/sportingbengalpulloutofkentleaguefixture-exclusive 1 11092 0 0 /news/kentleague/whitstable/whitstable.html 1 0 0 0 /news/folkestone110820 2 24771 0 0 /news/cambridge261105.html 1 0 0 0 /news/weremoreexperiencedtohandleplay-offssaysdaish 1 13913 0 0 /news/iwanttheboystoenjoyplayingdagenhamandshowpeopletheyregoodplayerssaysnickysouthall 1 15633 0 0 /news/fisher250518 1 14391 0 0 /news/ourleaguepositiondoesntmakegoodreadingadmitsramsbossjimward 1 18618 0 0 /news/becklord250217 1 41500 0 0 /news/dartford2-2tonbridgeangels-wereconfidentofgettingintoplay-offs-sawyer 1 24481 0 0 /news/hernebay230320 3 32908 0 0 /news/erithtownunveiljamescollinsastheirnewboss 1 12131 0 0 /news/551bc5ddc7132 1 13504 0 0 /news/wemustmaintainourhighstandardsinsistsobrien 1 17237 0 0 /news/wp-content/plugins/dzs-zoomsounds/king 1 0 0 0 /news/551bc99d33019 2 19348 0 0 /news/ifwecangounbeatenitwillbeagoodchristmasforussayshythetownbossscottporter 1 13565 0 0 /news/soccershortsnineteenapplyforsittingbournemanagersjob-exclusive 1 14215 0 0 /news/weneedeveryonepullingtogethersayswarrilow 1 18446 0 0 /news/soccershortshollandsblairfeeltotallydevastatedafterlosingpromotionappealatthefa 1 25198 0 0 /thamesmead-2003-2006/3 2 16380 0 0 /news/551a96dc00a5f 1 4274 0 0 /news/langtonwantsabrightstartdownattheymca 1 16275 0 0 /news/todaysresults280106 2 18363 0 0 /news/robbinsconfirmscroydondeparture 1 12358 0 0 /news/orpington5-0crockenhill-weknowweregoingtobeupagainstitadmitscrocksbosscraigclark 1 31942 0 0 /news/551a979b01c01 1 5328 0 0 /news/fishwing091115 1 27370 0 0 /news/goldbergquitsbromley 1 11564 0 0 /news/craywanderers1-3billericaytown-imnotthrowinginthetowelsaysianjenkins 1 37042 0 0 /news/godalmingtown0-0chathamtown 1 11374 0 0 /news/chathamtown2-0afchayes-wevegotmoreinthelockersayschathamtownbosskevinwatson 2 31924 0 0 /news/kentleague/sladegreen/8thaug04.html 1 0 0 0 /news/551a9718e03b1 3 50769 0 0 /news/gravesendnorthfleet1-4staffordrangers-sparsestonebridgesufferstaffordshocker 1 15953 0 0 /news/sheppeyunited310519 1 12647 0 0 /news/drmartens/eastern/tonbridge/1stoct04.html 1 0 0 0 /news/551a96784c078 2 16250 0 0 /news/soccershortsfatherandsontakechargeofbexleyborough 1 22199 0 0 /news/sladegreen0-4paghamheaslewooddemandsareactionaftercupshocker-exclusive 1 19000 0 0 /news/idontthinktopspotisdoneanddustedyetsayscraywanderersbossianjenkins 1 22153 0 0 /news/folkestoneinvicta0-2billericaytown-wedidntdoourselvesjusticeadmitswatson 1 21895 0 0 /news/551a9c9314711 3 50105 0 0 /news/kentclubssearchforsponsors 1 14810 0 0 /news/kentcountyleaguescoopsfarespectaward 1 13832 0 0 /news/facupspecialfirstqualifyingroundpreviews 1 19506 0 0 /news/551bc99dbe7a4/kentleague/cray/drmartens/eastern/folkestone/29thsept03.html 2 15653 0 0 /news/anynewswillfollowhere-1 1 9747 0 0 /news/elmsfore300920 4 112662 0 0 /news/551a97b24391f 1 15232 0 0 /news/kentleague/tunbridgewells/camberley110904.html 1 0 0 0 /news/beckjers310721 5 137415 0 0 /news/toallhoveringvulturesthereisnotamanagerialvacancyatgreenwichboroughinsistsgerrycox 1 17144 0 0 /news/rusthall030817 1 15101 0 0 /news/wp-admin/js/widgets/about.php 1 0 0 0 /news/cugleylambssendingoffwasaterribledecision 1 17276 0 0 /news/werestartingtoturncrabblenowintoalittlebitofafortresssaysnickyforster 1 13256 0 0 /news/wenowneedtostoptherotsayswhitstabletownbossjustinluchford 1 14288 0 0 /news/551bc99dbe7a4/kentleague/erithtown/kentleague/cray/crayvhern121103.html 2 15653 0 0 /news/drmartens/eastern/sittingbourne/wingate280804.html 2 0 0 0 /news/chatcori040519 2 48248 0 0 /news/551a97987ef7b 2 23570 0 0 /news/bromley081119 2 21160 0 0 /news/551a931e52b9e 2 24478 0 0 /news/holmesdale5-3westwickham-ourrootswillstayfirmlywheretheyaresayskeithdurso 1 31548 0 0 /news/wilkinsonreturnstodovertostiffencompetition 1 12578 0 0 /news/ontheairwaysangrywingsbossfordmakeshispoint 1 23335 0 0 /news/hythtonb181123 11 357191 2 2 /news/551a96dc95213 2 24241 0 0 /news/kentinvictaleagueopenerisgoingtobeagoodgameforeveryonetoseesaysgaryabbott 1 15136 0 0 /news/theperformancewastotallyunacceptableandnowherenearourstandardssaysramsbosstimdixon 1 13206 0 0 /news/otfordunited150223 2 25802 0 0 /news/hemelhempstead200520 1 12741 0 0 /news/wedlovearuninthefacupsayscorinthianbosstonysitford 1 12025 0 0 /archive-2006-2014/239 1 19041 0 0 /news/wehaveputtogetherastrongandattractivesuperleaguebidsaysgillschairmanmartinandrews 1 13867 0 0 /news/canterbury090218 1 12999 0 0 /news/551a99e35d461 1 10968 0 0 /news/ashfordzanone240515 2 15922 1 0 /news/soccershorts150820 2 40401 0 0 /news/551a956c6604c 1 3843 0 0 /news/ihavenoideawhenillbebacksayssampson 1 12829 0 0 /news/nosidecankeepupwithoursecondhalffitness-burman 1 15614 0 0 /news/successfulchriskinnearreturnstomargate 1 13242 0 0 /news/farnieweneedbetterbackingexclusiveinterview 1 14916 0 0 /news/wecertainlyoweramsgateonesaysfolkestoneinvictabossneilcugley 2 20773 0 0 /news/snodlandtown130219 1 11447 0 0 /news/iwanttogiveouryouthplayersanopportunityofimpressingfirstteamcoachessaysandyweeks 1 15658 0 0 /news/wellbereadytorumblebysundaysayswellingunitedcaptainjackparkinson 1 17325 0 0 /news/margate120218 2 23366 0 0 /news/wewanttobetopdogsinthanet-ward 1 16636 0 0 /news/7thoct05.html 1 0 0 0 /news/CEPMStatement200320 4 58255 1 1 /news/itsnosecretthatinthedressingroomafterwardsiofferedtoresignsaysmattwyatt 2 18844 0 0 /news/larkinhasascoretosettle 1 15800 0 0 /news/bromley0-4charltonathletic-werestillfinalisingoursquadsaysbromleysmurrayjones 1 22325 0 0 /news/dennesssignscontractatchathamtown 1 11844 0 0 /news/afccroydonathletic020818 1 12019 0 0 /news/551a9c0f08893 3 32754 0 0 /news/551a956c8b28d 1 4100 0 0 /news/hastvsitt201203.html 1 0 0 0 /southern-counties-east-football-league/16 1 19868 0 0 /news/staplehurst270420 1 13889 0 0 /news/dartford170620 4 22925 2 2 /news/551bc5dc52d16 3 35826 0 0 /news/hythe030905.html 1 0 0 0 /news/24thaug05.html 1 0 0 0 /news/tunwells171116 1 12625 0 0 /news/otfordhawkinge231020 2 17253 0 0 /southern-counties-east-football-league/10 2 40737 0 0 /news/whitstable190819 2 24667 0 0 /news/idontfearanyonebutirespectthemsaysdockersbosstonyrussell 1 18051 0 0 /news/greenwich090218 2 29227 0 0 /folkestone-2003-2006/2 2 18153 0 0 /news/dartford300916 2 18614 0 0 /news/hopefullywecanhelpjamiedayandthesquadtogettothenextlevelsayssupporterschief 1 12512 0 0 /news/bromleyfc.tv 1 0 0 0 /news/facarlsbergtrophythirdqualifyingrounddraw-1 1 14206 0 0 /news/etownphoe210115 1 33676 0 0 /news/matchoftheseasondartford4-3ashfordtown-martinsaysgoodbyeinseven-goalthriller 1 25683 0 0 /news/19thsept04.html 1 0 0 0 /news/551a9250af8d1 2 14180 0 0 /kent-county-league/12 2 22635 0 0 /news/corinthian030221 3 31686 0 0 /news/vcdathletic2-0thurrock-itwaslikeagameofchessadmitsvcdathleticbosstonyrussell 2 34954 0 0 /news/tonbridgeangels2-1doverathletic-everyonesgiventheiralltodaysaystommywarrilow 1 31813 0 0 /news/backthebidtobringthewandshome 1 16608 0 0 /news/justhopewecankeeptheboystogetherandwinsomethingsaysbridonropescaretakerkrishollidge 1 14004 0 0 /news/princesparkisforthewholecommunity-exclusive 1 15979 0 0 /news/iwantthisgroupofplayerstobethebestgroupinourhistory-sayserithtownbosstonyrussell 1 20494 0 0 /news/bromley210719 3 33492 1 0 /news/whitstabletowntellunder-pressuremundaytostartpickinguppoints 1 19305 0 0 /news/crisisclubholmesdalebringindavies 1 12788 0 0 /news/wevegottosolelyconcentrateonbeatingcanveyislandsaysdartsbosstonyburman 1 17551 0 0 /news/craywanderers0-2concordrangers-itjustdidnthappenforustonightadmitsianjenkins 1 23688 0 0 /news/tooting230805.html 1 0 0 0 /news/tonbmers060519 2 40961 0 0 /news/fisher121018 1 14273 0 0 /news/wevebeentremendoussayschampionshipwinninghessenthaler 1 11597 0 0 /news/soccershortsbromleysignconvicteddrugdealer 1 18981 0 0 /news/doverathletic281119 1 12140 0 0 /news/hernebay230721 2 22511 0 0 /news/whitstabletownbossmarklanetargetsback-to-backleaguewinsaheadofcanveycupclash 1 19371 0 0 /news/beckstpe260219 2 37927 0 0 /news/hopefullywecanplayourwayoutoftroublesayschathamtownbosspaulfoley 1 17720 0 0 /news/dulwichhamlet0-2hythetown-iknowwecancompetewiththebestteamsintheleaguesaysporter 1 23608 0 0 /news/551bc5ddf3bcd 2 18011 0 0 /news/wellingunited3-1afchornchurchpennockbeatingurchinsisagreatresultforus-exclusive 1 18388 0 0 /news/551a9250f260d/17thmay04.html 2 6643 0 0 /news/551a96dbf02e8 2 17722 0 0 /news/charltonlegends240516 3 28005 0 0 /news/wemustnottakeourfootofthepedalsayswarrilow 1 19583 0 0 /news/LettertoTheFA300320 2 27544 0 0 /news/dealtown090421 2 19362 0 0 /news/wereconfidentwellgetoutoftherelegationzonesaysthamesmeadtownbosskeithmcmahon 1 14089 0 0 /news/ticketsforprincesparkopenernowonsale 1 12442 0 0 /news/canterburycity310322 2 15075 0 0 /news/wehavetomakesureourwork-rateisatalevelitshouldbesaystunbridgewellsbosslarkin 1 14271 0 0 /news/dartford260518 2 14717 0 0 /news/wehaventgotanywherenearourhighstandardsadmitsfolkestoneinvictabossneilcugley 1 12542 0 0 /news/551a96dbd63d1 1 4244 0 0 /news/551a99e376154 1 13944 0 0 /news/wortfolk150220 2 62120 0 0 /news/kentleaguereleasefixtures 1 20159 0 0 /news/fatrophyfirstrounddrawiwanttoleaddoveroutatwembleysayshessenthaler 1 17278 0 0 /news/551bc99dbe7a4/kentleague/cray/ryman/bromley/10thoct03.html 2 15653 0 0 /news/kentleague/sladegreen/sladevbeck011103.html 1 0 0 0 /news/20thaug04.html 1 0 0 0 /news/beaconsfieldsycob1-3greenwichborough-theyunderestimatedusandwewillgetbettersaysblade 2 37980 0 0 /news/hythetownbossunveilsthearrivalofcoachstevenolan 1 12717 0 0 /archive-2006-2014/10 3 46032 0 0 /news/glebe210715 1 19142 0 0 /news/551bc5e8c7bf5 1 17498 0 0 /news/maidstoneunited0-2heybridgeswifts-theplayersleteveryonedownslamshume 1 14102 0 0 /news/punjab070819 1 15698 0 0 /news/afcsudbury0-0ramsgateramswon5-4onpens-herowilkersonsaveshisbestforlast 1 32322 0 0 /news/itstimethatkentendeditseight-yearwembleywaitsaysfoley-exclusive 1 18077 0 0 /news/wewanttoputinagoodperformanceforourhomecomingsaysmaidstoneunitedbossjaysaunders 1 18535 0 0 /news/favershamyoungstersadoptprofessionalapproach 1 15668 0 0 /news/551a979ad56c6 1 6381 0 0 /news/theresnopressureonsittingbourneaseveryonesexpectingdulwichtowinsaysmarcseager 1 14402 0 0 /news/551a931dddcb9 1 12331 0 0 /news/iamobviouslydelightedtobeappointedasmanagerofsuchagreatclubsayssamdenly 1 11318 0 0 /news/rymanreportswalkerthingsarelookinggreatforus 1 43525 0 0 /news/whitstabletown1-1whyteleafe-mundaypleasedwithhissidescharacterastheyendmiserablerun 1 20722 0 0 /news/seagullsofferrookaone-weektrial 1 21788 0 0 /archive-2006-2014/14 2 25347 0 0 /news/551a9c0e6bbb1 2 22248 0 0 /news/resultsdecember2014 1 76503 0 0 /news/maldfolk131119 2 63495 0 0 /news/cugleydelightedtobreakhisramsgatehoodoo 1 17278 0 0 /news/ramsgate301219 2 25877 0 0 /news/551bc99dbe7a4/drmartens/premier/dover/conference/margate/24thjune03.html 2 15653 0 0 /news/tommysampsonguestofhonouratfacupclashbetweenhernebayanddealtown 1 13393 0 0 /news/greenwich050818 2 25886 0 0 /news/eastshep131020 4 60691 3 3 /news/bromley060120 2 17750 0 0 /news/glebbrom190717 1 31775 0 0 /news/crowborough210617 1 14018 0 0 /news/bearsted200117 1 12906 0 0 /news/551a97b2334cd 1 12711 0 0 /news/kentleague/lordswood/26thjuly04.html 1 0 0 0 /news/irosetothevolatilehatredthatwasaimedatmesayshyde-exclusive 1 16851 0 0 /news/beckenhamtown2-0corinthian-werenotgoingtosettheworldonfireadmitsrealisticsitford 1 24271 0 0 /news/fanspitchinsowingsvisitcangoahead 1 13677 0 0 /news/soccershortsmartinmovestomargate 1 12879 0 0 /news/iwillputthingsrightvowsdolby-exclusive 1 15250 0 0 /news/soccershortswevenotgotabudgetlikemanchestercitysaysbutler 1 33192 0 0 /news/shockasmrtonbridgeangelscharliecoleresignsfromclub 1 14767 0 0 /news/551bc99cec806 2 24148 0 0 /news/werehandpickingqualityplayerstomakeusbettersayschathamtownbosskevinwatson 1 17052 0 0 /news/farnietellshisplayerstofightfortheirshirts-exclusiveinterview 1 16666 0 0 /news/bromley1-0valeofwhitehorse-myplayersrosetotheoccasionsaysproudjackparkinson 1 23005 0 0 /news/margatestarwaynewilsonputsthethanetcommunityfirst 1 22996 0 0 /news/kentleague/sevenoaks/aldershot280904.html 2 0 0 0 /news/craywanderers2-1leatherhead-francisjoyatlast-gaspwinner 1 19262 0 0 /news/thesethingsaresenttotestourresolvesaysfolkestoneinvictachairmanmarkjenner 1 19161 0 0 /news/folkestoneinvicta5wealdstone2 1 13909 0 0 /news/crayvalley2-3southpark-itcouldhavegoneeitherwaysayscrayvalleybossstevechapman 2 33917 0 0 /news/drmartens/eastern/sittingbourne/Salivsitt100104.html 1 0 0 0 /news/cupholdersramsgatehandedhomekentderby 1 12195 0 0 /news/wingsnetyoungfree-kickspecialist 1 12441 0 0 /news/mickycollinsconcernoverstarsmissingmum 1 12148 0 0 /news/drmartens/eastern/folkestone/sailsburyvfolkestone200903.html 1 0 0 0 /beckenham-2003-2006/2 3 32166 0 0 /news/thamesmeadtown2-2wellingunited-theboysdidtheclubproudsayskeithmcmahon 1 29971 0 0 /news/imhopingwellgoupintothekentinvictaleaguesayselthampalacemanagerterrynaden 1 16346 0 0 /news/gillingham070820 3 27320 0 0 /news/kentleague/greenwich/23rdnov03.html 2 0 0 0 /news/charlsouth300816 2 35196 0 0 /news/rusthall2-2snodland 1 12873 0 0 /news/ashfordtown1-0folkestoneinvicta-lyeheadersettlesderby 1 12674 0 0 /news/wellingunited200921 1 12011 0 0 /news/margate161118 2 27528 0 0 /news/FACupSecondRoundDraw111119 2 14451 0 0 /news/chathambossbinkshopesforbetterluck 1 14079 0 0 /news/erithandbelvedere070522 1 11791 0 0 /news/dontthinkbecausewehavealittlebitmoremoneywewillbeguaranteedsuccesssaysdannyward 1 12740 0 0 /news/millwalllionesses0-0doncasterroversbelles-imdelightedwiththepointsaysalbertokurti 1 25958 0 0 /news/551a99e510dad 1 13087 0 0 /news/theweekaheadwc200306 1 3167 0 0 /news/thepitchwastoodangeroustoplayonsayswarrilow 1 17041 0 0 /news/bearsted300721 4 54694 0 0 /news/relegatederithbelvederepartcompanywithchriscosgrove 1 15681 0 0 /news/551bc5e08a7dd 1 19312 0 0 /news/ashfordathletic111218 2 17651 0 0 /news/sheppeyunited020122 1 12741 0 0 /news/wewillgivesomeoneagoodhidingwarnsmaidstoneunitedbossjaysaunders 1 15802 0 0 /news/drmartens/eastern/ashford/16thoct04.html 1 0 0 0 /news/551a9719002fc 3 33853 0 0 /news/551a97b1e0157 1 13316 0 0 /news/551bc5e73a834 1 16591 0 0 /news/holldeal140919 1 38882 0 0 /news/conference/margate/19thfeb04.html 2 0 0 0 /news/ksports281016 1 12845 0 0 /news/551a9c9168eb7 2 19188 0 0 /news/iwanttofightforhonourssayswhitstabletownbossnickysouthall 1 15703 0 0 /news/change.org/p/award-roy-larner-the-george-cross 2 0 0 0 /news/551bc99dbe7a4/drmartens/eastern/dartford/conference/margate/2ndjuly03.html 2 15653 0 0 /news/erithandbelvedere260120 1 17435 0 0 /news/carlrichardssonplaysforbromleyssecondstring 2 14268 0 0 /news/551bc99c6e5f2 2 29941 0 0 /news/reserveswillbegivenachancesaysnott 1 15857 0 0 /news/maidstone260518 1 11190 0 0 /news/sittingbourne1-1merstham-theressomethingnotquiterightaboutmysquadadmitsgaryabbott 1 18274 0 0 /news/551bc99dbe7a4/drmartens/eastern/folkestone/othernews/favase3rdround.html 2 15653 0 0 /news/tonbhamp071123 3 70475 1 0 /news/bromley130715 2 22296 0 0 /news/drmartens/premier/dover/25thnov04.html 1 0 0 0 /news/crowborough290117 1 15530 0 0 /news/551a9cf55939d 3 30448 0 0 /news/phoenixsports011119 2 25086 0 0 /news/beckenham110904.html 1 0 0 0 /news/kentleague/cray/crayvchesfav221103.html 1 0 0 0 /news/burgesshill061104.html 1 0 0 0 /news/drmartens/premier/dover/15thaug03.html 1 0 0 0 /news/551bc5dca4cb1 3 36096 0 0 /news/welcomebackclive 1 13073 0 0 /news/551bc99dbe7a4/drmartens/eastern/dartford/kentleague/cray/30thaug03.html 2 15653 0 0 /news/dartfordbosstonyburmanunveilsjonwalliscapture 1 19162 0 0 /news/sct201016 1 12320 0 0 /news/551a92503ddeb 1 3840 0 0 /news/fishwell120923 4 157798 0 0 /news/FAVaseStatements281120 2 17220 0 0 /archive-2003-2006 14 126834 1 1 /news/551a9250e4f33 4 38912 0 0 /news/sittingbourne201116 2 29452 0 0 /news/wellingunited2-1dartford-ihavetomakechangeswarnsdartsbosstonyburman 1 25674 0 0 /news/bromley3-1gillingham-itwasmenagainstboyssaysbromleybossmarkgoldberg 1 29720 0 0 /news/sittingbourne290116 2 25320 0 0 /news/canterbury270817 1 12215 0 0 /news/lewfor040917 1 29702 0 0 /news/coverageovertheeasterperiod 1 13303 0 0 /isthmian-league/48 3 45125 0 0 /news/harisitt131117 2 53059 0 0 /news/kentseniorcupdraw 1 12006 0 0 /news/stonesbossjaysaunderssnapsuptommyosbornefrommargate 1 11506 0 0 /news/cuxton250517 2 15679 0 0 /news/551bc5e4624aa 1 18772 0 0 /news/dartstoannouncepulmanreplacement 2 15776 0 0 /news/greeniesfridaypreview-weekendoftrophyandvasefootball 1 16406 0 0 /news/harmsworthexplainstramsdeparture 1 11493 0 0 /news/551bc5e90bd30 1 19915 0 0 /news/soccershortsmanagersbeatthetransferdeadlinetobolstersquadsforthefinalmonth 1 57707 0 0 /news/551bc5e7b9473 1 14600 0 0 /news/sceflstatement190620 1 15090 0 0 /news/drmartens/eastern/ashford/21stoct03.html 1 0 0 0 /drmartens/eastern/tonbridge/cray261205.html 1 9955 0 0 /news/wp-admin/css/colors/blue/xmrlpc.php 1 0 0 0 /news/wp-content/uploads/wp_live_chat/abruzi.php 1 0 0 0 /news/bromley200117 2 18255 0 0 /news/balhwell160920 3 60871 0 0 /news/551a9c0e70081 2 18598 0 0 /news/greenwich271218 3 28498 0 0 /news/bromley110720 2 18073 0 0 /news/551bc5e15743d 1 16787 0 0 /news/30thjan05.html 1 0 0 0 /news/thenationalleague.org.uk/national-league-statement-outcome-of-club-charges-65398 1 0 0 0 /news/favershamtown1-1merstham-icanseeusgettingbetterandstrongersaysrayturner 1 30185 0 0 /news/tonbridgeangels1-4suttonunited-wevejustgottosticktogethersaystommywarrilow 1 21198 0 0 /news/hythearentasgoodaseveryonemakesouttheyaresaysnortonsplayer-bossbentaylor 1 19702 0 0 /news/margate-fc.co.uk 2 0 0 0 /news/wp-content/plugins/file-edit/css.php 1 0 0 0 /news/knightoptsforcraywanderers-exclusive 1 15290 0 0 /news/ksports190822 1 13339 0 0 /news/rustholm261022 1 36497 0 0 /news/ramsgate1-2whitstabletown-itwasadayforheroeshailswhitstablebossjustinluchford 1 21648 0 0 /news/doverunveilloansigningfrombarnet 1 12381 0 0 /news/wardwellrolloursleevesuptogoonanotherrunexclusive 1 14109 0 0 /news/sevenoakstown121123 6 81208 1 1 /news/dartford280422 2 14718 0 0 /news/2ndmay05.html 1 0 0 0 /news/itjustshowspeoplearewillingtohelpwhensomebodyneedsitsaysdarrenanslow 1 21172 0 0 /news/walthamforest3chathamtown1 1 12537 0 0 /news/551bc5df732e0 2 24336 0 0 /news/wecanstillkeepimprovingsaysdoverathleticbossnickyforster 1 14259 0 0 /news/tonbleat020216 2 61171 0 0 /news/551a979810a62 1 4506 0 0 /news/551a92509b3cc 2 15657 0 0 /news/greatwakering161104.html 1 0 0 0 /news/itstooearlytoopanicsaypromotionchasingrivals 1 15273 0 0 /news/hythetownfc.co.uk 1 0 0 0 /news/welling020617 1 12452 0 0 /news/favershamtown4-0sittingbourne-itwasimportanttobouncebacksaysfavershambossrayturner 1 18669 0 0 /news/pagham040904.html 1 0 0 0 /news/seveeast201021 5 139137 0 0 /news/croydon1-2lordswood-myplayerscommitmentwasoutofthisworldsaysjasonlillis 1 25547 0 0 /news/whitstabletown090123 1 14936 0 0 /news/thetitleraceisnotoverinsistshessenthaler 1 18929 0 0 /isthmian-league/40 3 44684 0 0 /news/corinthian100120 1 13793 0 0 /news/gillingham260419 1 11100 0 0 /news/doyouronlineshoppingwithkentishfootball 1 12311 0 0 /news/551bc5e457ff4 1 11326 0 0 /news/ashfordunited260618 3 28240 0 0 /news/corinthiancasuals0-3ashfordtown 1 12926 0 0 /news/jimward230817 2 28475 0 0 /news/resultsnovember2017 2 106797 0 0 /news/ryman/bromley/lewesvbrom160304.html 1 0 0 0 /news/dansonsports130522 3 33862 0 0 /news/ryman/bromley/windsorvbrom090903.html 2 0 0 0 /news/beckenham020817 1 15162 0 0 /news/551bc5de8b0ea 1 16697 0 0 /news/jonproveshesthemainman 1 11695 0 0 /news/kentsidesplotfayouthcupshocks-exclusiveinterviews 1 18479 0 0 /news/wewanttofinishonahighsayswhitstabletownbossnickysouthall 2 18685 0 0 /news/dartford150619 2 15059 0 0 /news/bromley040618 2 16417 0 0 /news/551a9cf573896 3 48467 0 0 /news/craywanderers5-0erithtown-wearegoodenoughfortheconferencesouthsaysianjenkins 1 28241 0 0 /news/drmartens/eastern/sittingbourne/burgessvsittfat011103.html 1 0 0 0 /news/iknowwhatsonthemaidstoneunitedgamesaystonbridgeangelsbosstommywarrilow 1 15900 0 0 /news/tunbwhit300923 1 35233 0 0 /news/greeniesgoodfridaypreview 2 24497 0 0 /news/werestillaimingfortheplayoffsinsistsward-exclusive 2 19244 1 1 /news/kentleague/sevenoaks/15thjuly03.html 2 0 0 0 /news/wereaheadofourmonthlytargetrevealshessenthaler 1 16432 0 0 /news/lewes250705.html 1 0 0 0 /news/551a97b215967 1 13663 0 0 /news/NationalLeagueStatement290920 2 15263 0 0 /news/soccershorts120622 2 28341 0 0 /news/sevenoakstown120222 2 27725 0 0 /archive-2006-2014/229 1 19402 0 0 /news/fisherjobwastoohardtoturndownadmitsedinburgh 1 11562 0 0 /news/marshscoopsbrickiesaccolades 2 15395 0 0 /news/ramsgateladies3woodstockpark1 1 12224 0 0 /news/551bc5dc26b4b 3 34369 0 0 /news/551bc5d9b6c9a 4 36483 0 0 /news/19thjan04.html 1 0 0 0 /news/wellingunitedbossjodybrownringsthechangesatthestartoftransferwindow 2 35770 0 0 /news/roystonreturnstostones 1 12068 0 0 /news/ashford220218 3 31376 0 0 /news/hytheshardgraftpaysoffasgroundpassesinspection 1 20237 0 0 /news/makeadonation 1 11959 0 0 /news/margate220116 1 13844 0 0 /news/hadlowevolution2-1sevenoaks-itsgreatforustogetthiswinsayshadlowbossanthonykent 1 24334 0 0 /news/aldebrom130819 2 38253 0 0 /news/551bc99b12bcd 2 24541 0 0 /news/551a931de5186 1 13820 0 0 /news/551a9718d1c82 2 17719 0 0 /news/canterbury220219 1 15445 0 0 /news/551bc99dbe7a4/drmartens/premier/dover/kentleague/thamesmead/23rdaug03.html 2 15653 0 0 /news/wehavelostfaithintheclubsaysformerbosssteveoboyle 1 13927 0 0 /news/551a967827d39 2 18965 0 0 /news/sittingbourne0wivenhoetown2 1 14709 0 0 /news/walkerhailsstonesexcellentresultatfacupheroeshorsham-exclusive 1 16481 0 0 /news/551a95b4619eb 2 18334 0 0 /news/londonseniorcupquarter-finaldraw 1 11019 0 0 /news/25thjuly05G.html 1 0 0 0 /news/551bc5e61f3fe 1 16002 0 0 /news/gravesendnorthfleet1-3kidderminsterharriers-daishwereavictimofourownsuccess 1 18386 0 0 /news/donotruleusoutoftherunningforkentleaguetitlesaysrobbins 1 13441 0 0 /news/lordswoodstatement221220 1 14017 0 0 /news/drmartens/eastern/sittingbourne/walthamforest231004.html 1 0 0 0 /news/bromleyisnotaneasyplacetogowarnstonbridgeangelsbossstevemckimm 2 26120 0 0 /news/12thoct03.html 1 0 0 0 /news/itsfrighteningwhatwecanachieve-warrilow 1 15683 0 0 /news/iamverypleasedtohaverhyslawsonjoiningtheclubsayslordswoodbosssimonhalsey 1 12702 0 0 /news/sittingbourneturndowntakeoverbidbutlaunchfootballacademy 1 17625 0 0 /news/aclondon180915 2 17124 0 0 /news/longhurstwieldstheaxe 1 12576 0 0 /news/tudorsports071018 1 11341 0 0 /news/whyteleafe1horsham1 1 12422 0 0 /news/kentleague/sladegreen/3rdnov03.html 1 0 0 0 /news/drmartens/eastern/tonbridge/3rdmar04.html 1 0 0 0 /news/tonbridgeangels2-1eastleigh-thisisamassivethreepointsforustonightsaystommywarrilow 1 29498 0 0 /news/sittingbournepullplayingbudgetasfinanceshitcrisispointwith20000debt 1 14550 0 0 /news/ryman/bromley/24thoct03.html 1 0 0 0 /news/obviouslymanagementandcoachingiswhatiwanttodosaysdual-registeredtonydolby 1 23399 0 0 /news/lyddtown1-1hollandsblair-imconvincnedtheresgoingtobetwistsandturnssayssmith 1 29410 0 0 /news/bromley180515 2 18131 0 0 /news/551a97983f23a 1 3797 0 0 /news/ithinkphoenixsportshasalotofpotentialsaysjoint-managersteveoboyle 1 16444 0 0 /news/chatham130815 3 32209 0 0 /news/hernebay280519 2 27005 0 0 /news/erithtownunveiloboyleastheirnewmanager 1 14008 0 0 /news/fatrophyspecialchatsplottinganothertrophysurprise 1 14631 0 0 /news/rustwest040123 2 22358 0 0 /news/eritmile240917 1 25469 0 0 /news/vcd130717 2 26489 0 0 /news/soccershortsfolkestonefansraisefundsforkeeperbudget 1 23819 0 0 /news/bredclark250515 2 14998 0 0 /news/tonbridgeangels0doverathletic0exclusiveinterviews 1 18064 0 0 /news/551a97981a8d1 2 19837 0 0 /news/itsafourhorseracesaysmcmahon-exclusive 1 12671 0 0 /news/drmartens/eastern/ashford/4thjuly04.html 1 0 0 0 /news/551bc5df2dd0d 1 16255 0 0 /news/solidaritywillhelpclaimourplay-offspotsaysford 1 12915 0 0 /news/holllydd070215 1 33987 0 0 /news/wemighthavetofindourfeetinthesceflsayscrowboroughjoint-bossseanmuggeridge 1 14149 0 0 /news/551bc5da62f1b 4 58488 0 0 /news/551a956c0233d 3 24411 0 0 /news/sheppey301020 1 14400 0 0 /news/wingssquadtakesshapefornextseason 1 11657 0 0 /news/margatepreview170705.html 1 0 0 0 /news/phoenix041215 2 27110 0 0 /news/greenwichborough0-3westwickham-therewasnofireinourbellytonightadmitsboroughbosscox 1 25918 0 0 /news/whitstabletownbossmarklanemakesdoubleswoop 1 16036 0 0 /news/carrolldropsbromleyabombshell 2 14195 0 0 /news/551a9c92187c3 2 24007 0 0 /news/faversham260620 2 27871 0 0 /news/wevemanagedtogetagoodsidetogethersaysashfordunitedbosstonyreynolds 1 16769 0 0 /news/myinjurywasaverytoughexperiencesaysbromleystrikerwarrenmcbean 1 12088 0 0 /news/vcdbish190718 2 51033 0 0 /news/chathampitchintomaintaintheirrymanleaguestatus 1 12798 0 0 /news/551bc99dbe7a4/kentleague/tunbridgewells/kentleague/tunbridgewells/9thsept03.html 2 15653 0 0 /news/romford121119 2 26994 0 0 /news/beckenham181019 1 14488 0 0 /news/kentseniorcupsemi-finaldraw-1 1 11046 0 0 /isthmian-league/4 6 89261 0 0 /news/rustchat040923 5 199170 0 0 /news/younevergetaneasygameagainstcraywarnsangelsbosstommywarrilow 1 16937 0 0 /news/maidstone290105.html 1 0 0 0 /news/9thJune04.html 1 0 0 0 /news/551bc5e126dae 1 11032 0 0 /news/cable-itsdecisiontime-exclusive 1 14682 0 0 /news/551a956c9f786 1 3375 0 0 /news/kentleague/beckenham/21stnov04.html 1 0 0 0 /news/551bc5e5d229f 1 12751 0 0 /news/551bc99dbe7a4/kentleague/hernebay/drmartens/premier/welling/30thjune03.html 2 15653 0 0 /news/wevegotmorefireinourbelliestogoonandbesuccessfulagainsaysblairbosspaulpiggott 1 13891 0 0 /news/mynextjobistogetwingspromotedsaysford 1 13632 0 0 /news/551bc5de60a56 1 10347 0 0 /news/weneedsomepointsontheboardsaysthamesmeadbosskeithmcmahon 1 17014 0 0 /news/doverathletic3-0tonbridgeangels-doverareunstoppableatfortresscrabble 1 18007 0 0 /news/vcdaerit241023 3 88506 0 0 /news/551a9799dc9e4 1 4606 0 0 /news/551bc5e2478b6 1 14045 0 0 /news/dartskeepingfullyfocusedduringtwo-horsetitlerace 1 28930 0 0 /news/itsreallyimportanttostartwellsaysmaidstoneunitedbossjaysaunders 1 14483 0 0 /news/551a931d97673 1 12052 0 0 /news/551bc5e1b6ae3 1 10924 0 0 /news/facarlsbergtrophyfirstrounddraw 1 10544 0 0 /news/tozeroptsforthamesmeadmove 1 11418 0 0 /news/551bc5dae876c 4 36126 1 0 /news/kentleague/lordswood/22ndaug04A.html 1 0 0 0 /news/dealtown250222 1 12876 0 0 /news/ashfordtown0-2craywanderers-titlechasetakesnewtwist 1 22455 0 0 /news/newstofollowherelater 1 11283 0 0 /isthmian-league/54 3 44809 0 0 /news/sevenoakstown2-3lordswood-ileftayeartooearlyadmitslordswoodbossjasonlillis 1 30970 0 0 /news/wellingtown090717 1 13519 0 0 /news/sevenoaksinacupfinalwouldbemiraculoussaysjones 1 19760 0 0 /news/soccershortswellprobablyhavetoreachfacupquarter-finalstobeonthebox-martinhayes 1 43209 0 0 /news/19thjune05.html 1 0 0 0 /news/charlieslocombe240719 3 28822 0 0 /news/bromley250321 2 17057 0 0 /news/wemuststartourleaguecampaignwellsayscugley-exclusive 1 15031 0 0 /news/maidstoneunited0-5bromley-someonehaditcomingtothemsaysbromleymanagerpaulproctor 1 23618 0 0 /news/551a97b2667b7 1 16643 0 0 /news/folkestoneinvictamakebigmoneysigningfromashford 1 11910 0 0 /news/horsmarg130422 5 157925 0 0 /news/hythashf031023 5 182965 0 0 /news/wealwell050318 1 24542 0 0 /news/chathamtown2sittingbourne3 2 19669 0 0 /news/dulwdart020319 2 38931 1 1 /news/fisher100818 1 12158 0 0 /news/doversweekofdestinyfinishoffthejobandthenthepartycanbeginsayshare 1 14024 0 0 /news/strikerlovellremainsonthesidelines 1 13995 0 0 /news/doverathletic141120 1 12236 0 0 /news/lingfieldmoveisrightformesaysbeckingham 1 18897 0 0 /news/warrilowwemustgetbacktobasicsandclimbtheleaguetable 1 13257 0 0 /news/margateunveilterrybrownastheirnewboss 1 16564 0 0 /news/dagenham030120 2 16285 0 0 /news/smellsliketeenspiritatchatham-exclusiveinterview 1 16651 0 0 /news/CEStatement270420 3 39782 0 0 /news/weneedallthehelpwecangettoreturnhomesaysfisherchairman 1 16936 0 0 /news/parmenterplaysdownkinnearlink 1 13271 0 0 /news/resultssept2017 2 124936 0 0 /news/fgrday110515 1 12446 0 0 /news/erithandbel090418 1 14916 0 0 /news/551a9c0e8b31d 2 15194 0 0 /news/551bc99c858da 2 19206 0 0 /news/margatewaryofstonesstrikerbeckford 1 12621 0 0 /news/dartswillnotspendovertheoodsinsistsburman 1 17611 0 0 /news/ramsgatesackjustinluchfordaftereightgamesincharge 1 13556 0 0 /news/sittingbourneappealforfinancialhelptoassistwithpitchimprovements 1 13090 0 0 /news/sammottdeservestomoveontotheprogamesaysthamesmeadtownbosskeithmcmahon 1 15550 0 0 /news/longwantstoplayhiscardsright 1 15089 0 0 /news/sittingbourne2-1corinthian-casuals-werereallyintherewithachancenowsaysabbott 1 15706 0 0 /news/14thoct05.html 1 0 0 0 /news/kentleague/ramsgate/17thdec03.html 1 0 0 0 /news/hartbrom060621 4 111598 0 0 /news/itllbeamiracleifwegetpromotionwithouroff-fieldproblemssayscugley 1 12689 0 0 /news/wp-content/repeater.php 2 0 0 0 /news/hytheboundshearerscoopshat-trickofawards 1 12498 0 0 /news/kentleague/sevenoaks/31stoct04.html 1 0 0 0 /news/glebe300323 1 13735 0 0 /news/551a99e3e9841 2 27730 0 0 /news/3rdjuly05.html 1 0 0 0 /news/wellingtown250518 1 14133 0 0 /news/551bc99cba741 2 22117 0 0 /isthmian-league/55 3 43979 0 0 /news/551a967854e7b 2 15521 0 0 /news/ramsu18vchat210304.html 1 0 0 0 /news/othernews/YLFIX280104.html 1 0 0 0 /news/FACupNews251020 6 96949 2 0 /news/itsanhonourtobeappointedstonesreservebossattheageof22saysjimbodle 1 13138 0 0 /news/stanfrim121221 4 117678 0 0 /news/kentmanagersmindgamestellusyourthoughts 2 15639 0 0 /news/551a931e1dcd4 1 12412 0 0 /news/hernebay170521 2 24913 0 0 /news/glebepalmer200515 2 34648 0 0 /news/ultimatelytheplayersperformundermydirectiveandthebuckstopswithmeadmitssimonosborn 2 40382 0 1 /news/anythinghigherthantopsixwillbeamassiveachivementsaysmiltonfulstonbossaaronperry 1 13246 0 0 /news/heaslewoodtellshisplayerswemustkeepourheads-exclusiveinterview 1 14836 0 0 /news/zanonerecord260415 5 49726 3 3 /news/drmartens/eastern/folkestone/cheshunt131104.html 1 0 0 0 /news/phoehorn260915 3 68360 0 0 /news/angelspartcompanywithskipperpowell-exclusive 1 14513 0 0 /news/thamesmeadtown1-0tilbury-thisisourmostsuccessfulseasonsayskeithmcmahon 1 30244 0 0 /news/leemorgan280416 1 12564 0 0 /news/weneedeveryonepullinginthesamedirectionsaysbromleycoachneilsmith 1 16244 0 0 /news/kentleague/ramsgate/ramsgatevdeal071003.html 2 0 0 0 /news/cumbersmakesgoodfirstimpressionwithstonesfaithful-exclusive 1 14827 0 0 /news/wardaimingtokeepramsinplay-offspots-exclusive 1 12465 0 0 /news/kentleague/tunbridgewells/17thjuly03.html 1 0 0 0 /news/theroadtowembleyfacupthirdqualifyingrounddraw 1 10829 0 0 /news/fisher1-0hendon-werelookingadecentsidesaysfisherbossstevefirkins 1 21804 0 0 /news/erithbelvedere2-1hernebay 1 13522 0 0 /news/othernews/ksc1stround.html 1 0 0 0 /news/otford080616 1 13404 0 0 /news/dartsbossburmansignsqualitymidfielderberquez 1 12998 0 0 /news/29thsept03.html 1 0 0 0 /news/crayvalley010623 3 29009 0 0 /archive-2006-2014/136 1 19458 0 0 /news/idontknowwheremyfuturelies-guest 1 18586 0 0 /news/8thdec03.html 2 0 0 0 /news/holmesdale110522 1 11841 0 0 /news/conference/margate/margatevexeter160803.html 1 0 0 0 /news/thamesmead110416 2 27643 0 0 /news/maidstoneunitediscommittedtofindthenextchrissmallingsaysyouthmanageriangrieves 1 14885 0 0 /news/dolbyunveiledasnewhastingsboss 1 22051 0 0 /news/551a96dc6c69b 5 71868 0 0 /news/about.php 1 0 0 0 /news/folkestoneinvicta0-0fleettown-invictadrawablank 1 14160 0 0 /news/ramsgate3-0leatherhead-quinnlaysthefoundationsofcomfortableramsgatetrophywin 1 23926 0 0 /kent-invicta-league/14 2 24835 0 0 /news/ebbsfleet250720 1 13692 0 0 /archive-2006-2014/73 1 20582 0 0 /news/551bc5e7ce7ba 1 14304 0 0 /news/ourrecordbreakingleaguepositionisdowntolaurenthamicisgoalssaysjenkins 1 20662 0 0 /news/soccershortsihavethestrongestteamindartfordsrecenthistorysaysburman 1 26060 0 0 /news/wemustmaintainourhighlevelssayshessenthaler 1 15739 0 0 /news/kentleague/thamesmead/thamesmeadvramsgate160803.html 2 0 0 0 /news/551a97b23ebb8 1 13832 0 0 /news/craywands220115 3 46516 0 0 /news/thekentinvictaleagueisasteptooearlyforusadmitsotfordunitedbossdennisleigh 1 12402 0 0 /news/fisher081015 1 12196 0 0 /news/dealtown031117 1 12019 0 0 /news/sevecroy200318 1 32456 0 0 /news/favehyth270819 2 55148 0 0 /news/margate061223/ 1 3891 0 0 /news/starmidfielderpondershisfuture 1 11500 0 0 /news/greenwich040118 2 24630 0 0 /news/wellingunited1-0tonbridgeangels-theteamhasprogressedsinceivebeenheresaysjamieday 1 22150 0 0 /news/551bc5e83df2b 2 18605 0 0 /news/sheppeyunited290721 1 12688 0 0 /news/craywanderers3molesey3exclusiveinterview 2 21698 0 0 /news/.pitchero.com/clubs/metrogasfc 1 0 0 0 /news/dulwwell281118 1 27751 0 0 /news/facupfirstround051123 5 65747 0 1 /news/kentleague/sevenoaks/erithtown261004.html 1 0 0 0 /news/itsgoingtobeanexcitingchristmassaysbromleycoachhugolangton 1 16663 0 0 /news/favershamtown191022 2 27649 0 0 /news/dartfordbosstonyburmanrelishingfitnesstestsagainstprosides 1 13756 0 0 /news/chathamtown1ilford2 2 17837 0 0 /news/jonesrelievedofhisdutiesasbillericaylosetomargateforfirsttime 1 13077 0 0 /news/551bc5e23379d 1 12882 0 0 /news/551bc5e6a0f13 1 17035 0 0 /news/ebbsfleet210720 1 13031 0 0 /news/bromley200718 2 17693 0 0 /news/afccjers201222 1 11486 0 0 /news/national200617 2 19251 0 0 /news/sittingbourne1barkingeasthamunited1 1 16034 0 0 /news/kentunited110823 10 68820 6 5 /news/3rdsept03.html 1 0 0 0 /news/portsmouthoutfitwarnothersaboutthenon-leaguerobber 1 11581 0 0 /news/theresnoplacelikehomesayspennock-exclusiveinterview 1 13940 0 0 /news/coriseve260222A 3 85945 0 0 /news/crewealexandrareduceticketpricesforfleetsvisit 1 13339 0 0 /news/welltavi051019 1 27145 0 0 /news/551bc5da9f638 4 33656 0 0 /news/soccershortsshockoverdeathofformerkentfootballer 1 12612 0 0 /news/dolbypromiseschangesaftersickeninghendondefeat-exclusive 1 14387 0 0 /news/promotionthisyearwouldbethehighlightofmycareersayscugley 1 16847 0 0 /news/drmartens/eastern/dartford/29thfeb04.html 1 0 0 0 /news/imkeentogiveyouthachancesaysnewly-appointedrochesterunitedbossdarrenphillips 1 13104 0 0 /news/551bc5e423de7 1 13678 0 0 /news/doverathletic1-4gillingham-timetopayupjack 1 16360 0 0 /news/clubsslashpricesforopeninghomefriendlies 1 12263 0 0 /news/holmesdale160317 1 13971 0 0 /news/rochash180518 1 28038 0 0 /news/cugleymakesplansfornextseason 1 15616 0 0 /news/fobgfc.org 1 0 0 0 /ashford-2003-2006/4 3 20728 1 0 /news/wevegotagoodchancetocausestalbansproblemssayschathamtownbosskevinwatson 1 17246 0 0 /news/holmesdale120118 1 12138 0 0 /news/legendarystrikerjonmaincomesbackhome 1 18395 0 0 /news/551bc5e4c4a6e 1 17823 0 0 /news/551a956c6d1f6 3 31093 0 0 /news/dulwich061117 2 25082 0 0 /news/daishextendswatkinsandgloziersloanspells 2 14682 0 0 /news/kentleague/whitstable/7thjuly03.html 1 0 0 0 /news/551bc5e45fc2c 1 12654 0 0 /news/wp-content/plugins/cherry-plugin/admin/import-export/a57bze8931.php 1 0 0 0 /news/ashfordsigntwotostaveoffrelegation 2 16917 0 0 /news/robbinsunveilssignificantcablesigning 1 11559 0 0 /news/charltonathletic180321 1 13303 0 0 /news/doverathletichasthebestyouthset-upinthesouth-eastofenglandsayswillgraham 1 14755 0 0 /news/oursupportersaretremendoussayspromotionchasingfolkestoneinvictabossneilcugley 1 17165 0 0 /news/24thjune05.html 1 0 0 0 /news/551bc5e67aefb 1 19990 0 0 /news/dartford2-3woking-thetitleraceisnotoveryetinsistsdartfordbosstonyburman 1 18425 0 0 /news/wevegotachancetogoallthewayinthefavasesaysgreenwichboroughassistantpaulblade 1 14817 0 0 /news/dartfordbegintheirclimbupthefootballladder 1 12905 0 0 /news/beckenhamtown1-2worthing-weranoutoffabitofsteamsaysjasonhuntley 1 22715 0 0 /news/fisher0-3hernebay-werereadytosnatchitifhytheslipupsayssimonhalsey 1 26371 0 0 /news/glebetoot030516 1 29118 0 0 /news/551bc99dbe7a4/kentleague/sladegreen/ryman/bromley/19thsept03.html 2 15653 0 0 /news/whitewemustaddressourlasttwodisplays 1 14195 0 0 /news/vcd090405.html 1 0 0 0 /news/1staug04.html 1 0 0 0 /news/thehardworkstartsnowsaystonbridgeangelsbosstommywarrilow 1 18496 0 0 /news/play-offfinalspecialitsourturntogoup-jenkins 1 16043 0 0 /news/soccershorts110816 2 44046 0 0 /news/enfield230805.html 1 0 0 0 /news/kentleague/VCD/26thoct04.html 1 0 0 0 /news/14thjuly04.html 1 0 0 0 /news/maidbrom280418 1 30927 0 0 /news/whitstabletownunveilpaulhydeastheirnewkeepercoach 1 14599 0 0 /news/maidstoneunited120221 1 12850 0 0 /news/cpalace030804A.html 2 0 0 0 /news/elmsgree080223 2 63980 0 0 /news/drydenapprovesofkeistersigning 2 16507 0 0 /news/wecanentertainmanchesterunitedbutnotthreebridgessayssittingbournechairmanmauricedunk 2 15796 0 0 /news/dartsputkeepersthroughtheirpacesinaidofbritishheartfoundation 1 20600 0 0 /news/didcottown180320 3 29098 0 0 /news/kingstonian221105.html 1 0 0 0 /news/holmesdalewillnotcometohernebayandliedownwarnssimonhalsey 1 14052 0 0 /news/vcdathletic0-1erithbelvedereabandoned48minsrefereespoiltourdayragederes 1 17622 0 0 /news/551a9250ad419 1 4332 0 0 /news/FAStatement101220 3 33007 0 0 /news/29thjune05G.html 1 0 0 0 /news/nationalawards021015 1 14398 0 0 /news/fisher081217 1 12284 0 0 /news/chatvdart120404.html 1 0 0 0 /news/hernebaychairmantrevorkennettaxesbosssimonhalsey 1 12533 0 0 /news/werenotreadytogoupadmitsward 1 16435 0 0 /news/greenwich010116 1 13321 0 0 /news/tootingmitchamunited0-1doverathletic-doverarethekingsofrymanonesouth 1 18951 0 0 /news/whitstable230517 2 23769 0 0 /news/dartford260218 1 15686 0 0 /archive-2006-2014/31 2 26185 0 0 /news/folkrook250515 3 29433 0 0 /news/23rdmay04.html 1 0 0 0 /news/stonessettosignsecondchoicegoalkeeper-exclusiveinterview 1 14824 0 0 /news/folkestone260519 2 24322 0 0 /news/mooneycanscore25goalsforussayslarkin 1 18993 0 0 /news/charltonathleticsvisittodartfordmadeall-ticket 1 13106 0 0 /news/551a967795ad5 2 16514 0 0 /news/551bc99de9329 2 20758 0 0 /news/551a9cf50c054 3 38991 0 0 /news/maidstoneunited0-1tonbridgeangels-angelsstoptherotwithsmash-and-grabvictory 1 17247 0 0 /news/551bc5dd8dcf0 2 19023 0 0 /news/551a9c931f85f 3 43695 0 0 /kent-invicta-league/28 2 23279 0 0 /news/themagicwandsaregoinguposborngoesoutonanall-timehigh 1 15218 0 0 /archive-2006-2014/124 1 19163 0 0 /news/barton131104.html 1 0 0 0 /news/iwanttobemakingthefinaldecisionssaysdarrenanslow 1 17545 0 0 /news/beckseven100318 1 11393 0 0 /news/erithtown140815 1 15309 0 0 /news/winninggamesistheprioritysaystunbridgewellsbossmartinlarkin 1 16777 0 0 /news/551a925087d80 1 3257 0 0 /news/551bc99c3294a 2 23083 0 0 /news/kentleague/hythe/30thjuly04.html 1 0 0 0 /news/551a956bde16e 3 25024 0 0 /news/soccershorts140616 2 39162 0 0 /news/gillinghamsignchathamprospect 1 11804 0 0 /news/mersmarg141118 2 61846 0 0 /news/oboylelooksforwardtofreshnewchallenges-exclusive 1 15504 0 0 /news/CONIFAWorldCup270518 3 29174 0 0 /news/551a95b45b6cc 2 19527 0 0 /news/sladevseven090304.html 1 0 0 0 /news/kentleaguenetnewsponsor 1 12417 0 0 /news/hernebay291018 2 25970 0 0 /news/tunwells291216 1 13651 0 0 /news/marghornc181218 3 62126 0 0 /news/effortwillkeepustheresaystabletoppingdolby 1 17175 0 0 /news/whibleytitle180415 1 17456 0 0 /news/haworthisourmaninsistsdartfordboss 1 13358 0 0 /news/corinthian010322 3 32589 0 0 /news/551bc5e18776d 1 20128 0 0 /news/kentleague/lordswood/lordvramsfav181003.html 1 0 0 0 /news/poutonsignsnewdoverdeal 1 12177 0 0 /news/greenwich270817 2 25273 0 0 /news/sceflstatement270221 1 11966 0 0 /news/21stsept05.html 1 0 0 0 /news/hernebay250519 2 25636 0 0 /news/tonbridgeangelsclampdownonanti-socialbehaviour-exclusive 1 17676 0 0 /news/werenotgoingtokickpeoplesaysrusthallbossgarysharman 1 12406 0 0 /news/healthsafetyhasgonemad-burman 1 26165 0 0 /news/whitstableisacompetitivegameandagamewellbelookingtowinsayshernebaybosssamdenly 1 15321 0 0 /news/bromvbans211003.html 1 0 0 0 /news/doverreadyforonefinalpush 1 11395 0 0 /news/ineedallmyplayersontheirgametoknockoutholderswhitleybaysayssimonhalsey 1 22001 0 0 /news/erithandbelvedere100822 1 15944 0 0 /news/marathonmanianjenkinscelebratestwentyyearsatcraywanderers 1 12166 0 0 /news/551a96db97cac 2 16130 0 0 /news/kentcountyleaguerepsidehurtbylatewinner 2 17128 0 0 /news/wehavetobeatourverybesttogetaresultatdoversaysbromleycoachneilsmith 1 17830 0 0 /archive-2006-2014/92 1 20809 0 0 /news/bromley170716 3 27476 0 0 /news/faversham130817 2 25882 0 0 /news/youneedagoodhomerecordandtogethernesssaysthamesmeadtownbosskeithmcmahon 1 14727 0 0 /news/berkhamsted030905.html 1 0 0 0 /news/bromley090519 2 16786 0 0 /news/angelsaimtobouncebackfollowingdisappointingtrophyexit 1 16225 0 0 /news/theteamsthatgodownwillprobablybeonarecordnumberofpoints-oconnell 1 16896 0 0 /news/wellingtown231216 1 11925 0 0 /news/hemensmakesswitchtowells 1 11915 0 0 /news/sladegreenpulloffcotterillcoup 1 11610 0 0 /news/vanaramaunveiledasfootballconferencetitlesponsorinthree-yeardeal 1 14205 0 0 /news/551bc99dbe7a4/kentleague/ramsgate/kentleague/maidstone/maidvlord271203.html 2 15653 0 0 /news/dartfordbosstonyburmanwantstoliftthefogonthethames 1 22665 0 0 /news/551a9798041bf 1 4364 0 0 /news/chartott140416 3 64886 0 0 /news/stainestown2folkestoneinvicta2sat29thapril2006 1 13051 0 0 /news/winnertakesallinrymanrace 1 29680 0 0 /news/becktunb201020 2 34016 0 0 /news/thefacupbringsupitsownromancewhichhastingsexperiencedlastyearsaystimdixon 1 17915 0 0 /news/cache-compat.php 1 0 0 0 /news/seveburg021122 2 57217 0 0 /news/thamesmeadtownsubmitplanstobuild385mmini-dartfordatbaylissavenue-exclusive 1 14030 0 0 /news/ashfordbeatthedeadlinetosignthreeexclusive 3 25110 1 1 /news/whitstabletown0-2dulwichhamlet-ineedmorequalityinmyteamadmitsseager-exclusive 1 20273 0 0 /news/20thjan05.html 1 0 0 0 /news/551bc5e633d5d 1 11761 0 0 /news/weretheunderdogsforthethirdyearrunningclaimscorinthianbossmattlonghurst 1 19969 0 0 /news/crayvalleycollins210817 1 15330 0 0 /southern-counties-east-football-league/41 1 19973 0 0 /news/15thjuly05.html 1 0 0 0 /news/welling250116 1 14909 0 0 /news/myhonestycostmemyplacewithstonesadmitsroyston-exclusive 1 16796 0 0 /news/drmartens/eastern/tonbridge/17thdec03.html 1 0 0 0 /news/551a92511617a 2 23084 0 0 /news/551a931ec0401 2 29286 0 0 /news/maidstone031205.html 1 0 0 0 /news/lewishamborough0-1bridonropes-iwanttoturnitaroundsayslewishambosswillieosullivan 1 23293 0 0 /news/551a956ccaf84 1 5022 0 0 /news/itsalwaysatoughgameattunbridgewellswarnsvickersbossrickybennett 1 14158 0 0 /archive-2006-2014/57 1 20920 0 0 /news/551a925059278 2 15610 0 0 /news/551a92507339d 2 15549 0 0 /news/551bc99dbe7a4/othernews/kentleague/tunbridgewells/17thjuly03.html 2 15653 0 0 /news/551a94af42cff 3 37798 0 0 /news/holmesdale150523 2 19273 0 0 /news/25thjune04.html 1 0 0 0 /news/ebbsfleet101019 1 11728 0 0 /news/gormansettounveilnewsummersignings 1 12201 0 0 /news/ashfordtownfaceanothersummerofdiscontent 1 19774 0 0 /news/551bc99dbe7a4/drmartens/eastern/ashford/kentleague/lordswood/lordvramsfav181003.html 2 15653 0 0 /news/551a956bc93f8 1 4440 0 0 /news/yourchancetobeakentfootballmanager 1 12250 0 0 /news/kentleague/sevenoaks/14jan04.html 1 0 0 0 /news/drmartens/premier/dover/slough140804.html 1 0 0 0 /news/canterbury120118 1 12509 0 0 /news/551bc5e832612 2 16930 0 0 /news/doversweekofdestinydoverstartplanningfornextseason 1 13376 0 0 /news/eastbourneborough0-3maidstoneunited-winningtrebleisanoutstandingachievement-parkinson 2 34215 0 0 /news/wewereleftinanunlikelypositionofhavingonlyninefitplayers-hythetown 1 17281 0 0 /news/lyddtown161218 1 11807 0 0 /news/soccershortsnevillesouthallbringsthefacuptomargate 1 20986 0 0 /news/luchfordwantsfavershamtoimpressinfrontofthecameras 1 16722 0 0 /news/ivegottohaveplayerswhoaregoingtoworkfor90minutessaysbeckenhamtownbosshuntley 1 13622 0 0 /news/burmanupbeatdespitedisappointingopeningweek 1 12315 0 0 /news/wewillbelookingtokeepthemomentumgoingsaysramsgatebosstimdixon 1 13685 0 0 /news/sevenoaks140804.html 1 0 0 0 /news/beckenhamtown1-2erithbelvedere 1 18380 0 0 /news/wecanlastthedistancesaysmarathanmanianjenkins 1 14658 0 0 /news/guildford110904.html 1 0 0 0 /news/welling100915 1 14570 0 0 /news/551a9c932a09a 2 24493 0 0 /news/ashford030619 3 27653 0 0 /news/thamesmeadunveilwalkersigning 1 11741 0 0 /news/551bc99dbe7a4/kentleague/sevenoaks/kentleague/thamesmead/23rdaug03.html 2 15653 0 0 /news/551a979879e81 1 3808 0 0 /news/findingtherightmanwhoisgoingtodelivertoourexpectationsisgoingtobedifficult-piper 1 15951 0 0 /news/gillingham011123 1 12580 0 0 /news/kentleague/sladegreen/11thmar04.html 1 0 0 0 /news/welling050216 1 13125 0 0 /news/harrvbromlgecup181103.html 1 0 0 0 /news/erithtown130805.html 1 0 0 0 /news/ramsgate080523 2 24999 0 0 /news/ithinkthisisanexcitingtimeforholmesdalesaysbosspaulproctor 1 14152 0 0 /news/englandmanagerroyhodgsonpitchesinatbigginhillschool 1 22607 0 0 /news/ramsgate161020 2 31297 0 0 /news/canterbury221219 1 11491 0 0 /news/portvale4-0dartford-ourupsetshouldvehappenedathomeadmitsprouddartsbossburman 1 30110 0 0 /news/faveeast091018 2 58831 0 0 /news/europeancupwinnersignsformaidstoneunited 1 12814 0 0 /news/drmartens/eastern/erith&belvedere/23rdmar04.html 1 0 0 0 /news/ashford180717 3 32556 0 0 /news/551a979a3157c 1 5199 0 0 /news/erithbelvederebeginsearchfornewsecretary 1 12412 0 0 /news/resultsnovember2020 2 97211 0 0 /news/itsimportantthatwedontstandstilloffthepitchsayswellinguniteddirectorbarryhobbins 1 14019 0 0 /news/play-offfinalspecialiwanttosendmybelovedcrayupsaysloyalservantwood 1 18426 0 0 /news/11thjan05.html 1 0 0 0 /news/ramsgate020915 2 23714 0 0 /news/sittingbourne1-2eastbournetown-wedeservedsomethingoutofthegameadmitsmarcseager 1 22122 0 0 /news/theboysaredreamingofwembleysayslordswoodbossjasonlillis 1 16855 0 0 /news/horsham2ramsgate1-wardimpleasedforhorshambutwellgoupwithyou 1 17690 0 0 /news/kimbleintherunningforwingsvacancy 1 15278 0 0 /news/wp-content/themes/intense/block-css.php 1 0 0 0 /news/iamhopefulthatwecanfinishtheseasoninabetterpositionsaysfisherjoint-bossmartinford 1 12759 0 0 /news/folkestone120617 2 23475 0 0 /news/werereallyfiredupandlookingforwardtotheseasonsayscraywanderersbosskeithbird 1 16725 0 0 /news/maidstoneunited0-3folkestoneinvicta-welookbacktoourbestsaysinvictabossneilcugley 1 19878 0 0 /news/soccershorts020622 2 35861 0 0 /news/fiskweregoingtogiveitagoodgoexclusiveinterview 2 23155 0 0 /news/mcmahontakespositivesfromopeningweek 1 13092 0 0 /news/wemustrisetotheoccasion-exclusiveinterview 1 14431 0 0 /news/tunbridgewells020715 1 15934 0 0 /news/551a97b210c3f 1 14789 0 0 /news/551bc5ddd7249 1 14463 0 0 /news/conference/margate/11thsept04.html 1 0 0 0 /news/thereisnoreasonwhywecantcauseanupsetattonbridgesayshernebaybosssamdenly 1 13591 0 0 /news/bromvfolk230304.html 1 0 0 0 /news/angelsdayofdestinyitsfinallyhere 1 16978 0 0 /news/551a9cf4eb620 2 15875 0 0 /news/wevegottogetbacktowinningwayssaysbromleycoachneilsmith 1 15827 0 0 /news/youvegottoenjoyeverysingleminuteofthemsaysfolkestoneinvictabossneilcugley 1 19662 0 0 /news/whitstabletownreceivefifteenapplicationsforvacantmanagersrole 1 15899 0 0 /news/craywands220319 3 34097 0 0 /news/sittingbourne1-0tootingmitchamunited 1 14558 0 0 /news/fisher041215 1 12532 0 0 /news/whithern300821 5 168435 0 0 /news/dover290416 1 13907 0 0 /news/tonbridgeangels200120 1 13082 0 0 /news/kessellsignsfordartsfollowingtonightstrainingsession 1 13171 0 0 /archive-2006-2014/47 1 20676 0 0 /news/eontopowerthefacup 1 13484 0 0 /news/FAStatement311220 1 11283 0 0 /news/551bc5df09685 1 21236 0 0 /news/551a9bafd655a 3 24926 0 0 /news/sorryfleetfallatfinalhurdle-forthirdyearrunning 1 15594 0 0 /news/ramsgate231104A.html 1 0 0 0 /isthmian-league/41 3 43587 0 0 /news/551bc5d9a5d6c 3 32598 0 0 /news/551a9c0e8e615 2 20473 0 0 /news/canterbury100119 1 14795 0 0 /news/ebbsfleet250618 1 13165 0 0 /news/letswincupshowdownforthefanssaysfarnie-exclusiveinterview 1 16657 0 0 /news/thamesmeadtown4-1heybridgeswifts-sometimesyouhavetopinchyourselfsayskeithmcmahon 1 28088 0 0 /news/wedontfearanyonesaysdoverathleticbossnickyforster 1 12829 0 0 /news/resultwellingunited1thetaxman0 1 32457 0 0 /news/ashfordunited290320 3 30476 0 0 /news/drmartens/eastern/dartford/15thaug04.html 1 0 0 0 /news/erithbelvedere2-5thamesmeadtownmeadsclassleavesrivalmanagerslostforwords 1 20313 0 0 /news/chatham031019 6 40796 2 2 /news/fisherconsiderfridaynightfootballtobringinthecrowds 1 12443 0 0 /news/snodlandtown030823 1 13610 0 0 /news/wp-includes/js/tinymce/skins/lightgray/img/index.php 1 0 0 0 /news/favershamtown4-4mersthamaetfavershamwon5-4onpenalties-anexcitingnight-saysluchford 1 31420 0 0 /news/newwhitstablebosspeternottlooksforwardtorenewpartnershipwithstevenolan 1 20109 0 0 /news/barking170905.html 1 0 0 0 /news/tunblord290322 4 135758 0 0 /news/craywandsFlamingoPark190318 3 36745 0 0 /news/18thnov05.html 1 0 0 0 /news/folkestone130820 2 25631 0 0 /news/deresstilldreamingoffairytaleclashwithgiantsleedsunited 1 16118 0 0 /news/refereesmuststampdivingoutoffthegame-foley 1 18233 0 0 /news/hernebaybosssimonhalseywantstocelebratefirstanniversarybyguidingtheclubintolast32 1 20054 0 0 /news/weveearnedtherighttofaceramsgatesayshollandsblairbosspaulpiggott 1 17092 0 0 /news/551bc5dce0939 1 12817 0 0 /news/551a96dbc5e95 2 17493 0 0 /news/lordbear301216 1 13242 0 0 /news/IsthmianLeagueStatement150121 3 48619 0 0 /news/vcdathletic3-0tunbridgewellsfordheapspraiseonbattlingrivals-exclusiveinterviews 1 18931 0 0 /news/beckvlord270304.html 1 0 0 0 /news/tunwells081115 1 14872 0 0 /news/fleetcanadianstarwellgetbackontrackforplay-offs 1 15183 0 0 /news/erithbelvedere4-2thamesmeadtown-managerofthemonthcursestrikesmcmahon 1 16417 0 0 /news/whitstabletown1-2eastbournetown-marklanesuffersheartbreakingdefeat 1 21094 0 0 /news/551a99e3463f1 1 12537 0 0 /news/crayholl030217 1 15307 0 0 /news/greenwich080319 2 24077 0 0 /news/crayvalley010917 1 12195 0 0 /news/abreathofnewlifespreadsacrosshomelands 1 14540 0 0 /news/ramsgate3-1eastbournetown-ramsmanagerjimwardhailsheroicgroundsmanmartinjeffreys 1 17022 0 0 /news/tonbridgeangels7-3gravesendnorthfleet 1 16197 0 0 /news/erithtown2-0lordswood-noteamhasbeenbetterthanussaysdockersbosstonyrussell 1 22612 0 0 /news/551bc99dbe7a4/kentleague/cray/kentleague/thamesmead/20thjuly03.html 2 15653 0 0 /news/croydon0-2erithbelvedere-imtreatingthelondonseniorcupwithrespectsaysmickycollins 1 34615 0 0 /news/bromleyrogerjohnson130518 1 17372 0 0 /news/iwantustobesuccessfulsayssevenoakstownbossdarrenanslow 1 14202 0 0 /news/drmartens/eastern/dartford/22ndoct04.html 2 0 0 0 /news/theroadtowembleyletsfinishoffthejob 1 20371 0 0 /news/phoenixsports0-3whyteleafe-jonmainistheclubsbiggestsigningbyamilesaysbeckingham 1 29892 0 0 /news/sevenoaksbeginsearchfornewmanagementteam 1 11526 0 0 /news/craywands210519 3 31737 0 0 /news/theroadtowembleyshownoheartagainandweregoingnowarewarnsfisk-exclusive 1 14036 0 0 /news/ryman/bromley/whytvbrom060104A.html 1 0 0 0 /news/craywands290318 3 37873 0 0 /news/bromley040219 2 16738 0 0 /news/551bc99dbe7a4/drmartens/premier/dover/drmartens/eastern/folkestone/hitchinvfolkefac270903.html 2 15653 0 0 /news/sct030816 1 13834 0 0 /news/favouritewarrilowlandstonbridgeangelsjob 1 11616 0 0 /news/bromley1eastthurrockunited1 2 19634 0 0 /news/angelschairmansuccesswillbestayingup-exclusiveinterview 2 19686 0 0 /news/wevegottobelievethatwecanscorefourgoalsagainstthemsaysbromleybossmarkgoldberg 1 17599 0 0 /news/ramshalsey150415 2 30936 0 0 /archive-2006-2014/72 1 20329 0 0 /news/wereplayingwellasateamsayscugley 1 16418 0 0 /news/beckhyth040323 6 188645 0 0 /news/drmartens/eastern/fisher/6thoct03.html 1 0 0 0 /news/angelshaveplentyinreserve 1 14783 0 0 /news/soccershortsithinkwecansurpriseafewpeoplesaysbeckenhambossjasonhuntley 1 50293 0 0 /news/drmartens/eastern/folkestone/folkevsitt230903.html 1 0 0 0 /news/kentfootballunited081118 1 11739 0 0 /news/doverchairmanwarnsof33budgetcutsiffansstayaway 1 13610 0 0 /news/thamesmead171018 2 44424 0 0 /news/webelievewecangetintotheplay-offsinsiststwo-goalherocade 1 22305 0 0 /news/kentleague/beckenham/7thjuly03.html 1 0 0 0 /archive-2006-2014/126 1 19285 0 0 /news/551a96dc27370 4 52620 0 0 /news/beckenhamlaunchsponsorshippackagetoraisefundsfornewstand 1 14141 0 0 /news/northleigh270805.html 1 0 0 0 /news/tunbridgewells150320 1 15851 0 0 /news/ramsunveilbutlerastheirnewfirstteamcoach-exclusive 1 12756 0 0 /news/hernebay020120 2 26879 0 0 /news/wehavetohavethatmenatlityofputtingfourorfivewinstogethersaysfavershambossrayturner 1 12558 0 0 /news/welivewithinourmeansinsistsfavershamtownbossjustinluchford 1 19793 0 0 /news/powellmakesconferencehistory 1 12270 0 0 /news/wehavenochanceofcausingcupshockadmitscotton-exclusiveinterview 1 14606 0 0 /news/hernebay280219 3 36197 0 0 /news/weoweeastleighonesaysplay-offdreamingtonyburman 1 15564 0 0 /archive-2006-2014/134 1 19564 0 0 /news/newromney030223 2 25982 0 0 /news/tonbridge161017 2 26673 0 0 /news/kentleague/sporting/sportvtun081103.html 1 0 0 0 /news/bromley241019 2 18329 0 0 /news/fiskplaysdownhythestitlechances-exclusive 1 14143 0 0 /news/3gpitchstatement260817 1 18599 0 0 /news/tunbphoe200822 4 131810 0 0 /news/upwardsof50khasbeenpaidoutforhistoricaldebtsconfirmdulwichhamletowners 1 16081 0 0 /news/8thjuly03.html 1 0 0 0 /news/kentleague/erithtown/16thsept04.html 1 0 0 0 /news/burmanaddsmoreirontohissquad 1 14165 0 0 /news/beckenhamtown1-2fisher-garylisneyadmitsweneededthatwin 1 32397 0 0 /news/dartfordchoosethurrockforfinancialreasons-exclusiveinterview 1 17091 0 0 /news/tunwells030317 1 13732 0 0 /archive-2006-2014/253 1 18998 0 0 /news/eghamvbrom060404.html 1 0 0 0 /news/everyoneslookingforwardtoplayinggillinghamsaysashfordunitedbosspaulchambers 1 12187 0 0 /news/greenoptsformovetohome-townclubdartford-doversigninnocentstriker 1 28760 0 0 /news/breakingnewsstoneswelcomenewdirector 1 13878 0 0 /sittingbourne-2003-2006 12 169193 0 1 /news/wemightbeabletohaveafewsurprisesfortonbridgeangelssaysdartsbosstonyburman 1 18116 0 0 /news/551a956b8fa78 3 24477 0 0 /news/tunbstan251022 5 150210 1 1 /news/rusthallunveilpaulmcdonaghastheirnewmanager 1 11312 0 0 /news/27thmar05.html 1 0 0 0 /news/ashfordunited200522 3 27749 0 0 /news/tunwells020518 1 14875 0 0 /news/wethriveonbeingtheunderdogssayshythetownbossscottporter 1 16430 0 0 /news/551bc99dbe7a4/drmartens/eastern/folkestone/kentleague/4thsept03.html 2 15653 0 0 /news/551a9718b8c1f 2 14691 0 0 /news/weveprovedwerenotabadfootballingsidesaysobrien 1 14524 0 0 /news/varleyruescontroversialdecision 1 12799 0 0 /news/otford220917 1 13185 0 0 /news/7thnov03.html 1 0 0 0 /news/drmartens/eastern/folkestone/kingstonian201104.html 1 0 0 0 /news/pottersbar111005.html 1 0 0 0 /news/ifwerenotcarefulwemaygothewayofotherclubswhopushtooearlywarnsbridonropeschair 1 20558 0 0 /news/craywands19042016 3 28952 0 0 /news/bromtmead220415 3 69133 0 0 /news/wingsgreenlighttostagebluesquarepremierfootball 1 10851 0 0 /news/waltwhit160316 2 55414 0 0 /news/sittingbourne1-5dartford-youveletdowntheclubblastslovell-exclusive 1 24860 0 0 /news/facupfourthqualifyingrounddrawdartforddrawbromleyinwinner-takes-allshowdown 1 14547 0 0 /news/24thsept04.html 1 0 0 0 /news/foresthillpark080319 1 13271 0 0 /news/kentfootballunited0-2orpington-theteamshouldbedoingbetteradmitssammacneil 1 26742 0 0 /news/551bc99ccd261 2 27015 0 0 /news/551bc99dbe7a4/drmartens/premier/dover/drmartens/eastern/ashford/21stoct03.html 2 15653 0 0 /news/corihebb050920 2 46926 0 0 /news/hythetown270423 2 38527 0 0 /news/tonbbren250815 2 59050 0 0 /news/clivewalkerreturnstochathamtown-1 1 12222 0 0 /news/tooting031205.html 1 0 0 0 /isthmian-league/24 3 44936 0 0 /news/19thaug05.html 1 0 0 0 /news/whitereadytoswoopintransfermarket 1 11408 0 0 /ashford-2003-2006/5 2 13394 0 0 /news/whitstable030720 2 27849 0 0 /news/thamhanw200916 2 65163 0 0 /news/551bc5db864c5 3 47779 0 0 /news/dealtown250920 1 13559 0 0 /news/ihopeimwrongbutthepitcheswilldictategamessaystonbridgeangelsbosstommywarrilow 1 16912 0 0 /news/4thsept05.html 1 0 0 0 /news/fleetwoodtownpulloutallthestopstoplayfatrophytie 1 15764 0 0 /news/deanhillwillbeagreatmentortoouryoungerplayerssaysramsgatebosstimdixon 1 11933 0 0 /news/leatherhead100905.html 1 0 0 0 /news/drmartens/premier/welling/13thjuly03.html 1 0 0 0 /news/chathamtowncraywanderersandthamesmeadtowntoplayrymanonenorthfootballnextseason 2 16348 0 0 /news/beckenhamtownfc.co.uk 1 0 0 0 /news/551bc99dbe7a4/kentcounty/drmartens/eastern/dartford/27thnov03.html 2 15653 0 0 /news/merstham270805.html 1 0 0 0 /news/dartford6-1suttonunited-everyoneinthestadiumwaspleasedwiththatsaystonyburman 1 19003 0 0 /news/tonbridge031117 2 30265 0 0 /news/eastleigh3-0dartford-ourconfidenceandbeliefisdownadmitsdartsbosstonyburman 1 21016 0 0 /news/imlookingforwardtogoingbacktoashfordsaysjohncumberbatch 1 12599 0 0 /news/551a96771cb05 2 17268 0 0 /news/dovercalltheshotsiwouldlovetofacearsenalinthirdroundsaystwo-goalheroadambirchall 1 20227 0 0 /news/phoenixsports140522 1 11885 0 0 /news/551bc99dbe7a4/ryman/kentleague/ramsgate/ramsgatevdeal071003.html 2 15653 0 0 /news/ownersdontputanypressureonmetohaveafacuprunsayswellingunitedbossjamieday 1 16063 0 0 /news/551a95b470977 2 20092 0 0 /news/551bc99ae6c4b 2 17973 0 0 /news/551a9c928e29b 3 30537 0 0 /news/craywanderers311221 3 29571 0 0 /news/551a931e92fa0 2 50136 0 0 /news/27thapr05.html 1 0 0 0 /news/ 1 2931 1 1 /news/england270616 2 31999 0 0 /news/conference/margate/wforest021004.html 1 0 0 0 /news/drmartens/eastern/tonbridge/kingstonian040904.html 1 0 0 0 /news/wellingtown090520 1 11282 0 0 /news/folkestoneinvictahelptheheroes 1 14114 0 0 /news/whitstabletown0-5croydonathletic-itwasmenagainstboysadmitsmunday 1 24042 0 0 /news/kcfaclubstochargefirstteampricesforseniorcupties 1 13896 0 0 /news/7thjuly04.html 1 0 0 0 /news/newbromleychairmanoutlineshisplansfortheyearahead 1 15461 0 0 /news/favershamappointpiggottasfirstteamcoach 1 15539 0 0 /news/fisher1-2tunbridgewells-wellkeepgoinguntilthemedalsaregivenoutsaysmartinlarkin 1 27561 0 0 /news/beckgleb080920 1 34576 0 0 /news/saturdayssoccer25thmarch2006 1 16909 0 0 /news/551a96791ea3a 2 27399 0 0 /news/sevenseven150815 2 42449 0 0 /news/drmartens/eastern/dartford/9thfeb04.html 1 0 0 0 /news/glebe090516 1 12293 0 0 /news/5thjune05.html 2 0 0 0 /news/kentleaguecupfinalreport080504A.html 1 0 0 0 /news/wingsbossfordwaitspatientlyforademola 1 13585 0 0 /archive-2006-2014/93 1 20137 0 0 /news/crayvalley280419 1 18398 0 0 /news/soccershortswhitstabletownunveilashleymillersarrival 1 24871 0 0 /ramsgate-2003-2006 13 182972 1 1 /news/everythingwedowealwaysexceedinsaysglebechairmanrockymcmillan 2 38950 0 0 /drmartens/eastern/folkestone/ramsgate200704.html 1 9955 0 0 /news/551bc5e7b448a 1 16299 0 0 /news/gillingham1-2astonvilla-defiantgillsbeatenonlybycontroversiallatepenalty 1 17545 0 0 /news/erithtown010116 1 12493 0 0 /news/win300incashatcorinthiansannualfive-a-sidetournament 1 11360 0 0 /news/bromdov070818 2 41191 0 0 /news/canterbury250219 1 18000 0 0 /news/punjab130919 1 12057 0 0 /news/pattersonreservesmustremainpatient 1 15111 0 0 /news/theresultswillcomeinsistsunder-pressuremunday 1 14139 0 0 /news/style.php 2 0 0 0 /news/mersthambird270415 2 32140 0 0 /news/asalong-timesupportericannotbeleivethatihavebeenvotedinaschairman-jessicamcqueen 1 14930 0 0 /news/bridon030816 2 18815 0 0 /news/burmanunhappywithplayerrestrictionsforrymancharityclash 1 20209 0 0 /archive-2006-2014/210 1 19699 0 0 /news/551bc5dfbcee2 1 14742 0 0 /news/doverathletic0-0tonbridgeangels-ijusthavetofindtherightmixadmitsdoverbosshayes 1 24026 0 0 /news/jamiehandsinrequesttoleavestonebridgeroad 1 20009 0 0 /news/favershamcoachingjobcomesatrighttimeformetcalf 1 12132 0 0 /drmartens/eastern/folkestone/gravesend170704.html 3 12477 0 0 /news/maidstoneunited2-0waltonhersham-wewantourunbeatenruntokeepgoingsaysjaysaunders 1 19196 0 0 /news/theplayershavegottobemoreprofessionalsaysrochesterunitedbossglenbarlow 1 16070 0 0 /news/551bc5e7be510 1 10830 0 0 /news/551a9797d48d1 1 3424 0 0 /news/dulwichhamlet280420 1 13327 0 0 /news/21stjune04.html 1 0 0 0 /news/fixtures34march2006 1 15991 0 0 /news/wardleavestonbridgeforhomecomforts 1 10851 0 0 /news/8thsept05.html 1 0 0 0 /news/fisher2-1kingsburylondontigers-mynaiveteamwillimproveinsistslisney 1 28710 0 0 /news/tunwells140816 1 14422 0 0 /news/troubledtimeshasmademeabettermanagersayswellingbossjamieday 1 19974 0 0 /news/maidstoneunitedp-phiston-anotheronebitesthedust 1 10430 0 0 /news/erithtown171116 1 12003 0 0 /news/wehavetoworkhardtoproveweretitlefavouritessaysburman 1 19643 0 0 /news/bromley300715 2 19098 0 0 /news/kentseniorcupfinal020504.html 1 0 0 0 /news/craywanderers2-1sittingbourne 1 15300 0 0 /news/tonbrom081116 2 56295 0 0 /news/greenwich280218 2 31156 0 0 /news/551bc99dbe7a4/kentcounty/kentleague/hernebay/7thjuly03.html 2 15653 0 0 /news/hernrams021121 5 176117 0 0 /news/wehavetobeatourabsolutebesttogetanythingagainstmargatesaysrayturner 1 15018 0 0 /isthmian-league/www.heineken.co.uk/ 1 5110 0 0 /news/pastadversariesburythehatchet 1 14189 0 0 /news/kentleague/maidstone/9thsept04.html 2 0 0 0 /news/theresafeel-goodfactoraroundtheclubsaysstonesbossjaysaunders 1 15976 0 0 /news/folkestone-saunderssigningisourbestforyearsadmitscugley 1 15474 0 0 /news/fisher260819 1 12133 0 0 /news/greenwich120917 2 23551 0 0 /news/frometown231220 1 11742 0 0 /news/ramsgate170716 2 30547 0 0 /news/mckimmihavetheheartanddesiretobemargatesnextboss 1 12742 0 0 /news/margatesuspendkinnearandrainewithimmediateeffect 1 11324 0 0 /news/kentseniortrophyfinalmcmahontellsvcdwecanhandlepressurecanyou-exclusive 1 15382 0 0 /news/othernews/FixOct2004.html 1 0 0 0 /news/ashfordtown1-1walthamforestaet-ashfordpaythepenalty 1 13207 0 0 /news/ryman/bromley/bromvtoot230903.html 1 0 0 0 /news/ifeltbromleymovewasrightformesaysstarstrikeradambirchall 1 15476 0 0 /news/margate300705.html 1 0 0 0 /news/gravesham080917 1 13957 0 0 /news/cray040805.html 1 0 0 0 /news/bromley1-2folkestoneinvicta-invictahumblebig-spenders 1 13989 0 0 /news/doyourshoppingwithus 1 11617 0 0 /news/ithinkitsgoingtobeanothertightkentleaguetitleracethisseasonsaysvcdathleticboss 1 14078 0 0 /news/altrinchamrelegated 2 13601 0 0 /news/leatfolk081117 2 54983 0 0 /news/hythebossfiskhappywiththecontinuitywithinhissquad-exclusive 1 12914 0 0 /news/bromvmole230803.html 1 0 0 0 /news/chathamtown4-0cheshunt-wevehadagoodstart-butitsonlyastartsayskeithlevett 1 18096 0 0 /news/dealtown201115 1 14073 0 0 /news/551bc99dbe7a4/drmartens/eastern/dartford/othernews/28thoct03.html 2 15653 0 0 /news/tonbridgeangels2tootingmitchamunited0 1 17096 0 0 /news/soccershortsbromleystrengthensquadtocontinuepromotionpush 2 58971 0 0 /news/iwaslivingaliesaysenglandgayfootballercaseystoney 1 17781 0 0 /news/threshep280223 2 67408 0 0 /news/thepressureisallonmaidstone-theresnopressureonourladssaysfolkestonebossneilcugley 1 13057 0 0 /news/charlton241116 3 28733 0 0 /news/drmartens/premier/welling/22ndjuly03.html 1 0 0 0 /news/canterburycity140322 1 12817 0 0 /news/clapton4-3bridonropes-wevehadsomeverypromisingmomentssaysgarylisney 2 34872 0 0 /news/ibelieveineverysingleoneofmyplayerssaystonbridgeangelsbosstommywarrilow 1 16190 0 0 /news/whitstabletown210322 2 29317 0 0 /news/weregoingtowembleykentmanagerstellheroicfleetnowgoonandwinit 1 17798 0 0 /news/wellingunited4-2eastleigh-leeclarkeisafantasticassetsayswingsbossjamieday 1 30603 0 0 /news/551bc5e8ad81d 1 11734 0 0 /news/therewardistherenowforbothclubssaysdartfordbosstonyburman 1 16289 0 0 /news/craywands140318 3 26397 0 0 /news/folkestoneinvicta0fisherathletic1 1 15314 0 0 /news/saundersstaysatfolkestoneinvicta-butloseoutondonovan 1 15505 0 0 /news/kentleague/cray/19thjan04.html 1 0 0 0 /news/551bc5e64f67e 1 17223 0 0 /news/favershamprepareforthebigone 1 15717 0 0 /news/breakingnewshomelandsgivengreenlighttostagefatrophytie 1 11534 0 0 /news/faverams101219 2 61749 0 0 /news/ramsgatespricefordefenderwastoohighadmitshessenthaler 1 12304 0 0 /news/millwallpreview070705.html 1 0 0 0 /news/margate3-0ashfordtown-weremissingthecuttingedgeadmitsyorath 1 23307 0 0 /news/keisterloseshisappealandmissestherestoftheseason 1 16716 0 0 /news/wedontwanttobeontheendofafatrophyshocksaysmargatebosssimonosborn 2 20391 0 0 /news/cordiceiamnotsureiftheyknowwhatittakestowintheleague 2 20776 0 0 /news/bromley100920 2 18908 0 0 /news/wellingfazakerley051215 1 16549 0 0 /news/6thjan06.html 1 0 0 0 /news/crowbseven020418 1 11885 0 0 /news/eastleigh050205.html 1 0 0 0 /bromley-2003-2006/6 2 17960 0 0 /news/breakingnews10pmburmaninshockoverdecisiontoswitchthedarts-exclusive 1 11700 0 0 /news/craywanderers0-0canveyisland-wecantbetoodownbeatifweplaylikethatsaysianjenkins 1 16373 0 0 /news/gravesham040816 1 12378 0 0 /news/folkestone190517 2 25331 0 0 /news/londonbuildingcollapse 1 12123 0 0 /news/551bc5e50a29f 2 15962 0 0 /news/kentleague/deal/7thjuly03.html 1 0 0 0 /news/551bc5e138f93 1 14673 0 0 /news/lordswoodu18050904.html 1 0 0 0 /news/10thsept04.html 2 0 0 0 /news/tonbury210315 2 54739 0 0 /news/gravesendnorthfleet0-2mkdons 1 14419 0 0 /news/551bc5e0d6c06 1 14340 0 0 /news/bridonropes120216 2 18126 0 0 /news/551a979864175 1 5337 0 0 /news/551bc5e7a1825 2 18383 0 0 /news/kentleague/sladegreen/1stdec03.html 2 0 0 0 /archive-2006-2014/28 2 25477 0 0 /news/kentleague/thamesmead/23rdjuly03.html 1 0 0 0 /news/welling270817 1 11947 0 0 /news/lovelllookingforreactionafterback-to-backdefeats 1 12646 0 0 /news/ryman/bromley/28thoct03.html 1 0 0 0 /news/croydon170920 1 12463 0 0 /news/wellingunited070120 1 11656 0 0 /news/crownalexandraacceptedintokentinvictaleague 1 11649 0 0 /news/ashfordtownunveilrecordsponsorshipdeal 1 13330 0 0 /news/favouritegames180320 2 28473 0 0 /news/bromley5-0chelmsfordcity-imnottalkingaboutwinningtheleagueorpromotion-markgoldberg 2 36766 0 0 /news/craywanderers1-2suttonunited-weveprovedtoourknockerswedeservetostayup-jenkins 1 37286 0 0 /news/551a9677de9bf 2 15489 0 0 /news/wehavetotryandgetthroughforthefacupfinancessaysfolkestoneinvictabossneilcugley 1 16692 0 0 /news/apmcontrast180915 2 16097 0 0 /news/27thoct03.html 1 0 0 0 /news/phoesitt140120 2 23029 0 0 /news/wp-includes/rest-api/wp-login.php 1 0 0 0 /news/itmeansalottotheclubtoremaininthesouthsaysfoley 1 18350 0 0 /news/soccershorts060619 2 46938 0 0 /news/29thaug04.html 1 0 0 0 /news/4thjan05.html 1 0 0 0 /news/wp-content/plugins/ioptimization/IOptimize.php 1 0 0 0 /archive-2006-2014/122 1 19711 0 0 /news/kentleague/deal/Sampson2.html 1 0 0 0 /news/thamesmead110615 3 33564 1 1 /news/wellsbossrobbinswantstopsixstability 1 18111 0 0 /news/snodland301216 1 11761 0 0 /news/play-offsemi-finalspecialimnotcontemplatingfailuresayswarrilow 1 23069 0 0 /news/551bc5e70931a 1 21007 0 0 /news/lewisham091118 1 12734 0 0 /news/whoeversgottheirshirtonthedayisplayinginacupfinalsaysalexobrien 1 22260 0 0 /news/hythashf050322 5 192675 0 0 /news/chathamtown0-1whyteleafe 1 12544 0 0 /news/itsasadstateoffaffairsifwerenotpushingtowardstheplay-offssaysobrien 1 24354 0 0 /news/kentleague/sevenoaks/beckenham131104.html 1 0 0 0 /news/phoenixsports250920 2 26757 0 0 /news/551a956c06bb8 1 3899 0 0 /news/margate030517 1 11273 0 0 /news/phoenixsports4-1bearsted-itwasagreatwinfortheclubsayssteveoboyle 1 34757 0 0 /news/wp-content/plugins/ioptimizations/king.php 1 0 0 0 /news/tunbridgewells2-0shildon-wevegotnothingtocelebratesaystunbridgewellsbossmartinlarkin 1 26833 0 0 /news/551a96789b78b 3 39814 0 0 /news/dartwell191015 2 37751 0 0 /news/crowsseven261215 1 35296 0 0 /news/551bc99a5a056 1 13631 0 0 /news/ivebeengiventhego-aheadtogooutandgetaforwardsayskeithmcmahon 1 14116 0 0 /news/lewisham291219 1 11764 0 0 /news/tunbridgewellsdreamoftriptogermany 1 12369 0 0 /news/551a9cf520792 3 41093 0 0 /news/magnificentangelschairmanpaystributetowarrilow-andheroicplayers-exclusive 1 15395 0 0 /news/551bc99e64ddd 2 89383 0 0 /news/18thmay04.html 1 0 0 0 /archive-2006-2014/191 1 19213 0 0 /news/551a956c7ccc1 3 27077 1 0 /news/551bc99b91208 2 26999 0 0 /news/FAStatement240221 3 30185 0 0 /news/beckbads080322 2 37690 0 0 /news/shorts060815 2 57500 0 0 /news/illcarryondoingthejobvowsunder-pressurebromleybossmarkgoldberg 1 13347 0 0 /news/dartford200918 2 20757 0 0 /news/551a979992a9a 1 5084 0 0 /news/551bc99d2d542 2 23367 0 0 /news/maidstoneunited1-1craywanderers-itsdefinitelyapointwonforusadmitsjenkins 1 25152 0 0 /news/erithbelvederesignstrikermarcuscassiusonfree-transferfrombromley 1 17989 0 0 /news/551bc5db42f7f 2 14076 0 0 /news/carlrookhasdroppeddownalevelasheseesourdesiresayswhitstabletownchairmangaryjohnson 1 13900 0 0 /news/alfa-rex.php7 1 0 0 0 /news/ramssetfornewadditions-exclusiveinterview 2 15550 0 0 /news/favershampasskentleaguegroundgrading 1 12374 0 0 /news/sportingbengal290105.html 1 0 0 0 /news/551a9250a00f3 1 4389 0 0 /news/phoenixsports091118 2 30745 0 0 /news/fishercrayval100815 1 30555 0 0 /news/manageresspowelllooksforwardtoherbigmomentinthespotlight 1 18791 0 0 /sittingbourne-2003-2006/5 2 27570 0 0 /news/risberit031120 4 119134 0 0 /news/ramsgate220421 5 65135 0 0 /news/tonbridgejuniordian200715 1 13885 0 0 /news/dealcs130617 3 27335 0 0 /sevenoaks-2003-2006/3 3 24341 1 0 /maidstone-2003-2006/2 1 14464 0 0 /news/chelmsford200905.html 1 0 0 0 /news/vcdathletic2-3southendmanor-transitionalvickersonthehuntforexperience 1 35506 0 0 /news/lydd190915 1 11967 0 0 /news/ashbyunveilshickmansigning 1 13695 0 0 /news/whitstabletown2-1chathamtown-itsamassivethreepointsbutthejobsnotdone-peternott 1 33251 0 0 /news/551a9c9163138 2 17691 0 0 /news/551bc5e7ea10d 1 16258 0 0 /news/soccershorts160516 3 49386 0 0 /archive-2006-2014/217 1 18950 0 0 /news/551bc5e2edf38 1 15646 0 0 /news/fourpointsovereasterwillnaildownourplay-offplacesayswellingunitedbossjamieday 1 19809 0 0 /news/canterbury080617 1 12749 0 0 /news/ramsgate230216 2 24884 0 0 /news/princesparkwinsprestigiousaward 1 13159 0 0 /news/tonbridgeangels0-4afcwimbledon-wilfortsayssorryforhiscostlydoubleblunder 1 22592 0 0 /news/lewglekfu101215 1 14265 0 0 /news/lordswoodcouldbeseriouscontenderssaysjasonlillis 1 13508 0 0 /news/topfiveistheaimsaysrusthallmanagergarysharman 1 14461 0 0 /news/theresarealfeel-goodfactoraroundtheclubsaysashfordunitedownertonybetteridge 1 14087 0 0 /news/551bc99dbe7a4/drmartens/premier/dover/kentleague/cray/15thaug03.html 2 15653 0 0 /news/butlerfrustratedwiththeelements 1 17951 0 0 /news/craywanderers0-5maidstoneunited-a5-0defeatdoesntlookgoodadmitspaulblade 1 30508 0 0 /news/551bc99dbe7a4/drmartens/premier/dover/othernews/13thsept03.html 2 15653 0 0 /news/doverathleticsnapupdavisonone-yeardeal 1 12781 0 0 /news/drmartens/eastern/sittingbourne/corbvsitt131203.html 1 0 0 0 /news/itwasclearfromtheoutsetthatsuttonathleticareanambitiousclubsaysnewbossjamescollins 1 12988 0 0 /news/23rddec05.html 1 0 0 0 /news/kentfootballunited090919A 1 15367 0 0 /news/frenchpairawaitforcugleysdecision 1 16945 0 0 /news/wp-admin/xleet-shell.php 1 0 0 0 /news/551a956b95435 1 5340 0 0 /news/meridianvp0-1sevenacresidcup-weneedtoimprovebigtimesaysleehill 1 28838 0 0 /news/oneswallowdontmakeasummersaysdaish 1 16586 0 0 /news/erithtownunveilroystonasplayer-coach 1 14313 0 0 /news/canterbury170617 2 16377 1 1 /news/vacancycommercialmanager 1 10107 0 0 /news/ashfordunited240818 3 29162 0 0 /news/oconnellreflectsonhistimeinkent 1 22802 0 0 /news/tunbridgewells1-0holmesdale-wereveryluckytohavekeelanmooneyadmitswellsbosslarkin 1 26471 0 0 /news/soccershorts170621 2 37193 0 0 /news/craywands161116 3 29250 0 0 /news/whitstable041204.html 1 0 0 0 /news/wp-content/themes/pridmag/db.php 1 0 0 0 /news-conference-2003-2006 24 161206 2 6 /news/drmartens/eastern/ashford/2ndaug04.html 1 0 0 0 /news/tonbridgeangels1-0oxfordunited-bestdayinclubshistory-warrilow 1 24367 0 0 /news/551bc5e0d9975 1 14578 0 0 /news/sheppey120617 1 12699 0 0 /news/wevegottodobetterthanlastyearsayscrockenhillcoachdarrellqueeley 1 16658 0 0 /news/fleetseeknewdevelopmentpartner 1 12505 0 0 /news/wecanhandlethepressureduringgamessaysburman 1 12147 0 0 /news/ramsgatebeginsearchforambitiouscoach-exclusive 1 11899 0 0 /news/jamespeacockbecomespeternottsfirstsigningforwhitstabletown 1 15195 0 0 /news/craywanderersappointtommywarrilowtokeeptheclubintherymanleague 3 31610 0 0 /news/edwardswillbebackinsistsford 1 14068 0 0 /news/drmartens/eastern/sittingbourne/tonvsitt060304.html 1 0 0 0 /news/myremitistobuildtheclubsayserithbelvederebossmattlonghurst 1 14812 0 0 /news/burgfolk070115 2 49521 0 0 /news/crayashf260818 1 29774 0 0 /news/conference/gravesend/17thjuly03.html 1 0 0 0 /news/lordswood180718 1 12551 0 0 /news/551a9799872c1 1 5746 0 0 /news/glebe010920 1 12979 0 0 /archive-2006-2014/6 3 45058 0 0 /news/hythetown251121 5 61010 0 0 /news/tonbridgeangelswillbeatoughnuttocrackwarnsdartfordbosstonyburman 1 12977 0 0 /news/webelievewearemakingbestuseofourbudgetsaysbromleybossmarkgoldberg 1 12638 0 0 /news/kentleague/beckenham/27thoct03.html 1 0 0 0 /news/wp-includes/repeater.php 2 0 0 0 /news/5thjuly05.html 1 0 0 0 /news/551bc5e3c3f2b 1 11813 0 0 /news/fansflocktocountyplay-offfinal 1 12012 0 0 /news/ebbsfleetunited2-1stevenageborough-daishpleasedwithshockhomewin 1 19600 0 0 /news/kentleague/erithtown/7thjuly03.html 1 0 0 0 /news/dulwtonb190216 2 24564 0 0 /news/wp-content/plugins/wp-engine-module/a57bze8931.php 1 0 0 0 /news/bromley140617 1 16230 0 0 /news/551bc99dbe7a4/othernews/conference/margate/29thnov03.html 2 15653 0 0 /news/kentleague/tunbridgewells/26thaug04.html 1 0 0 0 /news/burmanwantshissidetocontinueimpressiveform 1 12607 0 0 /news/NationalLeague230121 2 26455 0 0 /news/leyton0-0folkestoneinvicta 1 15300 0 0 /isthmian-league/7 5 85784 0 0 /news/stansfeld131220 1 17746 0 0 /news/wewanttoputonagreatgameoffootballsaysburman 1 19229 0 0 /news/sutterit110423 3 84573 0 0 /news/bromley270718 2 16050 0 0 /news/drmartens/eastern/sittingbourne/KLvsitt210204.html 1 0 0 0 /news/ashfordtown4-0whitstabletown-wevesetourstandardsnowsayslovell 1 17255 0 0 /news/551bc5e50cf48 1 13635 0 0 /news/craywanderersnewstadiumwillbeeco-friendly-andbuilttoconferencestandards 1 15171 0 0 /news/gatebrom240318 1 25129 0 0 /news/wehavetokeepmidfieldgeneraljamesscowcroftquietsaysmargatebossiainoconnell 1 14756 0 0 /news/chathamunveildoublesigning 2 16099 0 0 /news/lordswood2erithbelvedere2 1 12786 0 0 /news/kentyouthleaguetointroduceapremierleaguenextseason 1 14732 0 0 /news/ihopetoseedeanhillinaramsgateshirtagainsayschairmanphilfennell 2 27182 0 0 /news/phoenixsports110119 2 29367 0 0 /news/itswhathappensonthepitchthatcountssayslovell 1 14594 0 0 /news/ebbsfleetunitedsnapupshanehuke 1 12150 0 0 /news/dealvcray011103.html 1 0 0 0 /news/bromsutt280717 1 24219 0 0 /news/resultsfeb2016 2 104212 0 0 /news/doverarrangefriendlytogetkeyplayersfit 1 11175 0 0 /news/jamieleggettleavesbexleyboroughforanewchallenge 1 11311 0 0 /news/shirleyrose141019 1 11513 0 0 /archive-2006-2014/138 1 19720 0 0 /news/ColinBoswell230520 5 43194 2 2 /news/margate280619 2 23521 0 0 /news/dartfordcouncilitsgoodtoshare 1 15464 0 0 /news/dartford010216 2 16749 0 0 /news/5thmay05.html 1 0 0 0 /news/hollands230916 1 12158 0 0 /news/lordswood201023 2 23268 0 0 /news/craywabb140415 3 72162 0 0 /news/floodlightcollapsecausespostponement 1 10768 0 0 /news/551bc5e66c4d3 1 18736 0 0 /news/ramsgate210519 2 23512 0 0 /news/metrogas300317 1 12769 0 0 /news/551bc99dbe7a4/kentleague/tunbridgewells/southernyouth/12thjuly03.html 2 15653 0 0 /news/eritoakw150919 1 34005 0 0 /news/dartfordunveil30000sponsorshipdeal 1 10871 0 0 /news/getbehindtheteamdoverchairmantellsfans 1 16445 0 0 /news/iwantmoregoalsfromfazakerleysaysday 1 11506 0 0 /news/551bc5dcb171c 3 39347 0 0 /news/551a931e8ab80 2 43196 0 0 /news/doverexpectphysicalbattleathornchurch 1 13893 0 0 /news/551a967797d54 2 16356 0 0 /news/walkersettounveilmorenewsignings 1 13281 0 0 /news/551bc99b09843 1 3118 0 0 /news/brickieswillbetoughwarnshessenthaler 1 13017 0 0 /news/butlerpreparesforhishardestgameinchargeofmargate 1 19013 0 0 /news/holmesdaleseeknewownertotakeclubtonextlevel 1 16613 0 0 /news/wevegot12gamestodecideourseasonsaysmaidstoneunitedbossjaysaunders 1 15951 0 0 /news/faversham070721 5 58495 0 0 /news/bansteadathletic0-2phoenixsports-ithinkitwastooeasyforusattimessayssteveoboyle 1 27364 0 0 /news/iveneverbeeninvolvedinsuchatightleaguesaysangelsstrikeradrianstone 1 16164 0 0 /news/wehavetobeontopofourgamesayslangton 1 13285 0 0 /news/idontreallywanttobestuckinthekentinvictaforthenextfiveyearssaysseanglover 2 22382 0 0 /news/soccershortsdaneasoncangoonandprovehimselfintherymanleaguesayssimonhalsey 1 13832 0 0 /news/princesparktelluswhatyouthink 1 12422 0 0 /archive-2006-2014/65 1 20929 0 0 /news/imreallydisapointedthatwerenotpushingforpromotionreflectsianjenkins 1 17200 0 0 /news/therewillalwaysbehiccupsandbumpsalongthewaywarnswellsbossmartinlarkin 1 18924 0 0 /news/551bc5db318a9 4 42570 1 0 /news/gillsold190516 2 54968 0 0 /news/fleetunveillucrativethree-yearsponsorshipdealwitheurostar 1 13608 0 0 /news/foresthill060917 2 15785 0 0 /news/gibbonspraiseswhitstablefortheirgood-willtowardsinjuredkeeper-exclusiveinterview 1 18050 0 0 /news/3rdjune05.html 1 0 0 0 /news/weveachievedwhatwesetouttodothisyearsayserithbelvederebossmickycollins 1 17880 0 0 /news/greenwichboroughunveilianjenkinsastheirnewmanager 1 15652 0 0 /news/doverssecondstringrelishmidweekaction 1 14281 0 0 /news/551bc5db116bb 3 37071 0 0 /news/14thjan05.html 1 0 0 0 /news/craywanderers3burgesshilltown0francisoneswallowdoesntmakeasummerexclusive 2 25201 0 0 /news/beckenhamsuccessfulwithfaappeal 2 13550 0 0 /news/wp-admin/network/wp-login.php 1 0 0 0 /news/hbaybirchard130515 2 25924 0 0 /news/burmanletsbecomerymankingsonsaturday 1 20072 0 0 /news/kfu180617 1 15317 0 0 /news/fisher1-0rochesterunited-ijustcantcommittorochesterunitedsaysdarrenphillips 1 27688 0 0 /news/craywands180119 3 33431 0 0 /news/lewisham150419 1 13314 0 0 /news/eritholm010322 2 58084 0 0 /news/croydonath120118 1 12257 0 0 /news/drmartens/premier/dover/wimbledon180904.html 1 0 0 0 /news/551a96db3f4a4 1 3797 0 0 /news/whitstablebay260617 1 14747 0 0 /news/sampsontostartextensivephysioprogrammetoaidreturnhome 1 12429 0 0 /news/fisher091020 1 12371 0 0 /news/FAStatement120421 3 38954 0 0 /news/tunbridgewells0-2hernebay-wevegottostayfocusedanddisciplinedsayssimonhalsey 1 24305 0 0 /news/humehasfaithinhisyoungsters 1 19237 0 0 /news/croydonexplaintompkinsdeparture 1 12770 0 0 /news/wemuststayintouchwiththeleaderssaysfrancis 1 13594 0 0 /news/wellheme100418 1 24622 0 0 /news/maidstoneunited101220 1 15411 0 0 /news/erith231004.html 1 0 0 0 /news/sevenoaks171218 2 23632 0 0 /news/fisher090218 1 12524 0 0 /news/ebbsfleetunited2-4thatchamtown-weretremendouslyproudofouryoungkidssaysmccarthy 2 35435 0 0 /news/afcwimbledon3-4craywanderers-iwanttogettoacupfinalsaysianjenkins 1 28803 0 0 /news/staplehurst180521 1 13535 0 0 /news/folkestoneinvicta2-0metropolitanpolice-cugleyallgoodsidesbouncebackfromdisappointments 1 21344 0 0 /news/bumpercrowdwillhelpoutcash-strappedfolkestoneinvicta 1 22133 0 0 /news/30thsept03.html 1 0 0 0 /news/551a9798ad395 2 30113 0 0 /news/tonbridge260118 2 25550 0 0 /news/lordswood4-1sportingbengalunited-weveplayedbetterandlostsayslillis 1 18043 0 0 /news/chatgill190719 1 32242 0 0 /news/chathamlookforwardtobumperpayday 1 13847 0 0 /news/maidstone200720 1 13594 0 0 /news/mersbird030515 3 41108 0 0 /news/551a9c92d0ab3 2 22876 0 0 /news/wellingunited0-1chelmsfordcity-wecancompetewiththebiggerteamsinourleaguesaysday 1 26584 0 0 /news/foresthillpark260518 1 11609 0 0 /news/thamescray121015 2 64807 0 0 /news/551bc99dbe7a4/kentleague/tunbridgewells/drmartens/eastern/folkestone/folkvhavantfatreplay021203.html 2 15653 0 0 /news/tonbridgeangels3-2harrowborough-wereincontrolofourdestinysayswarrilow 1 33126 0 0 /news/craywanderers0-1crystalpalace-wearedowntothebarebonesagainsaysjoefrancis 1 20948 0 0 /news/drmartens/eastern/sittingbourne/13thaug03.html 1 0 0 0 /news/551bc5e8b8515 1 11575 0 0 /news/bromleyunveilthereturnofmidfieldacealifuseini 2 18238 0 0 /news/worldcupstarsarecomingtostonebridgeroad 2 16551 0 0 /news/isthmian170617 3 27644 0 0 /news/cugleyexpectedtodraftinwork-experiencepair 1 18333 0 0 /news/551a9b482107b 4 29376 0 1 /news/dartford030517 2 19319 0 0 /news/551bc5e2b86e1 1 12116 0 0 /news/drmartens/eastern/ashford/4thnov03.html 1 0 0 0 /news/drmartens/eastern/fisher/6thfeb04.html 1 0 0 0 /news/folkestoneinvicta1-1margate 1 9835 0 0 /news/wewillflypasttheangelssaysburman 1 16004 0 0 /news/551a97b112dd2 2 29630 0 0 /news/maidstone040619 1 12637 0 0 /news/theresnopointholdingbackatcarshaltonathleticsayswhitstabletownbossnickysouthall 1 14942 0 0 /news/chathamtown1barkingeasthamunited1 2 17951 0 0 /news/thetargetissimple-tofinishhigherthanlastyearsayscrayvalleybossstevechapman 1 13914 0 0 /news/ksports291216 1 13843 0 0 /news/crowborough090720 1 11010 0 0 /news/beckenhamappointnewmanagementteam 2 13863 0 0 /news/wewouldloveagoodturnoutfromthepuntersforourcupfinalsaysgillinghambossjamesmarrs 1 14961 0 0 /news/greenwich171116 2 24205 0 0 /news/cvalley230615 1 18609 0 0 /news/soccershorts010820 2 30131 0 0 /news/551bc5e911e9e 1 13929 0 0 /news/ebbsfleet080719 2 15252 0 0 /news/551bc99dbe7a4/drmartens/eastern/tonbridge/drmartens/eastern/folkestone/havantvfolkfat291103.html 2 15653 0 0 /news/anotherseasonlikethelastwillnothappenagaininsistslewishamboroughchairmanraysimpson 1 12597 0 0 /news/spenbrom270218 1 14293 0 0 /news/wefinishedinafalsepositionsayslordswoodbossjasonlillis 1 13682 0 0 /news/theclubislookingtogointherightdirectionsaysnewmiltonfulstonbossaaronperry 1 13772 0 0 /news/facarlsbergtrophysecondrounddrawebbsfleettraveltodroylsden 1 15481 0 0 /news/551a956c09b84 1 3468 0 0 /news/551a956b6cc8b 1 3518 0 0 /news/551bc5e570056 2 25320 0 0 /news/conference/gravesend/28thjuly04.html 1 0 0 0 /news/551a99e4e31b0 2 44466 0 0 /news/therewillbenoquickfixwarnsjulianleigh 1 19836 0 0 /news/greenlord160815 1 33383 0 0 /news/551bc99be0cbb 2 21851 0 0 /news/farnboroughsnapuptwoformerfleetdefenders 1 27687 0 0 /news/551a931e6d035 1 11722 0 0 /news/crayvglebe090916 2 34520 0 0 /news/conference/margate/8thoct04.html 1 0 0 0 /news/paulbowden-brownhascomeintopointtheclubintherightdirectionsaysmeadbosskeithmcmahon 1 16196 0 0 /news/551a96786d942 3 28728 0 0 /news/soccershortswembleyboundfleetfreezetheirseasonticketprices 1 26962 0 0 /news/thamwith070915 2 59032 0 0 /archive-2006-2014/132 1 19460 0 0 /news/551bc99dbe7a4/drmartens/premier/dover/kentleague/deal/1stjuly03.html 2 15653 0 0 /news/551a96db69375 4 42836 0 0 /news/seagersignsexperiencedpairaheadoftheirrymanadventure 1 13442 0 0 /news/551a97b1d7b03 1 17996 0 0 /news/punjabunited240921 1 12122 0 0 /news/margate230620 2 25691 0 0 /news/lovellexpectsatoughchallengefromfolkestonesyoungsters 1 14683 0 0 /news/551bc99d99cd2 2 26527 0 0 /news/margate180620 2 24053 0 0 /news/NationalLeagueStatement160421 2 14916 0 0 /news/langtonsearchingforthatelusiveleaguewin 1 15021 0 0 /news/551bc5dd64000 2 20787 0 0 /news/hythetown160522 2 24791 0 0 /news/wevegottogetfisherbacktowhatitwassaysjoint-bossbillywalton 3 26812 0 0 /news/wejustneedtobeconsistentsayserithtownbossenniogonnella 1 12369 0 0 /news/551a956c32659 3 23868 1 0 /news/551a96772b949 3 38053 0 0 /news/16thoct.html 1 0 0 0 /news/kentleague/thamesmead/18thnov04.html 1 0 0 0 /news/10thjune05.html 1 0 0 0 /news/holdersconfidentofavoidingquarter-finalexit 1 15882 0 0 /news/wevegottogetouracttogetherathomesaysward 1 13312 0 0 /news/whitstabletaketheirtimetogettherightperson 1 11826 0 0 /news/sheppey230916 1 12944 0 0 /news/wevegotagreatchanceofprogressingsaysthamesmeadbosskeithmcmahon 1 19199 0 0 /news/sevenoaks070916 1 15026 0 0 /news/551bc99dbe7a4/drmartens/eastern/dartford/drmartens/eastern/ashford/30thDec2003.html 2 15653 0 0 /news/wellingunitedunveiltheloansigningoftyronemarsh 1 20075 0 0 /isthmian-league/53 3 44098 0 0 /news/bromleians270918 2 19478 0 0 /news/itssuchashametohavetoletsomanyplayersgosaysfisherbossdeanharrison 2 39160 0 0 /news/EFLStatement180320 3 33021 0 0 /news/folkestoneinvicta4-2horsham-cugleyhasstrikeronhiswish-list 1 36985 0 0 /news/drmartens/premier/dover/28thjuly04.html 1 0 0 0 /news/warrilowsettoendkeepersearch 1 16493 0 0 /news/invictafacedog-fightintheirlasttwogames 1 20695 0 0 /news/NationalLeague170920 2 16129 0 0 /news/551a931d9f28b 1 11812 0 0 /news/othernews/5thfeb04.html 1 0 0 0 /slade-green-2003-2006/3 1 14605 0 0 /news/nationwide/gillingham/1stjuly03.html 1 0 0 0 /news/drmartens/eastern/folkestone/newpvfolk060304.html 2 0 0 0 /news/idbedisappointedifwedontgetaplay-offspotsayscraywanderersbossianjenkins 1 16455 0 0 /news/sevensitt280815 2 68857 0 0 /news/wakelinggreenwaycandowellforhimselfinthefutureexclusiveinterview 1 16328 0 0 /news/experiencewillgiveustheedgesayscugley-exclusive 1 15735 0 0 /news/sittingbourne2-3whitstabletown-laneihavenoideawherethatstartcamefrom 1 23711 0 0 /news/ramsgate050205.html 1 0 0 0 /news/23rdnov05.html 2 0 0 0 /news/hollands030617 1 13296 0 0 /news/afcwimbledon2-0doverathletic-doverruetheirmissedopportunity 1 22655 0 0 /news/mitchellmakeshernebayskipperoconnorhisfirstsigning-exclusive 1 15064 0 0 /news/551bc99ba215f 2 45493 0 0 /news/thefanswillmakeitacrackingatmosphere-lovell 1 14107 0 0 /news/wp-content/wp-links.php 1 0 0 0 /news/wellingtown011119 1 13575 0 0 /news/drmartens/eastern/folkestone/billericay040904.html 1 0 0 0 /news/551a96782dade 3 32727 0 0 /news/551a97189eb81 3 32452 0 0 /news/aslongasweputingoodperformanceswellwinmoregamesthanwelllosesaysvickersboss 1 16578 0 0 /news/ivebeenaskedtosteadytheshipsayshughes 1 16122 0 0 /news/ramsgatewinfirstthanettussle 1 13396 0 0 /news/wevecertainlygotroomforimprovementsaysmargatebosssimonosborn 1 14699 0 0 /news/icertainlydontwanttofinishbottomsayscrayvalleybossstevechapman 1 14477 0 0 /news/maidvwhit170204.html 1 0 0 0 /news/play-offheroesfolkestoneinvicta2-1godalmingtown-jeverittweveprovedthemallwrong 2 99852 0 0 /news/551bc5e45013e 1 10774 0 0 /news/stanselt140716 1 14593 0 0 /news/551bc99dbe7a4/drmartens/eastern/tonbridge/nationwide/gillingham/10thjuly03.html 2 15653 0 0 /news/pottersbartown4-1thamesmeadtown-itstimeforafewtomoveonsaysmeadbosskeithmcmahon 1 32642 0 0 /news/551a925043978 1 3685 0 0 /news/maidstone260520 1 14099 0 0 /news/hessenthalermakeschangesforleaguecupclash-exclusive 1 13128 0 0 /news/corialre121116 4 103690 2 2 /news/themessageisclear-wewantpromotionsaysdoverathleticchairman 1 14473 0 0 /news/551a9bafd7dfb 3 27784 0 0 /news/bridgrav100216 2 45105 0 0 /news/margate091118 2 24320 0 0 /news/valleybouncebackafterabbohreadsriotact-mctaggartscoresthegoalsforminnowstudorsports 1 15157 0 0 /news/beckenham250919 1 12392 0 0 /news/sladegreenconfirmkentleaguewithdrawal 1 14714 0 0 /archive-2006-2014/17 2 25170 0 0 /news/wecanreplicatewembleyglorysaysrecordbreakercharles 1 14705 0 0 /news/jamesshermanwillbearamnextseasonsaysbossjustinluchford 1 12524 0 0 /news/fisher070718 1 12664 0 0 /news/551a97996dab3 1 4771 0 0 /news/folkestoneinvicta0-1sittingbourne-cugleywarnsofplayercutsfollowingcupexit 1 24288 0 0 /news/551a99e53bc2e 1 18993 0 0 /news/erithtownbosstonyrussellunveilsthecaptureofelstomdie 1 23248 0 0 /news/kentleague/cray/crayvdeal200304.html 2 0 0 0 /news/fisher281116 1 14804 0 0 /news/itwouldbefantasticifwecanwintheleaguesayswellingunitedskipperjackparkinson 1 17538 0 0 /news/werebeingpunishedforourmistakessayshernebaybosssimonhalsey 1 16660 0 0 /bromley-2003-2006/www.heineken.co.uk/ 1 3221 0 0 /news/wellingtown100921 1 13194 0 0 /news/fcelmstead081015 1 12405 0 0 /news/chathamtown2-2dorking-averypreventsembarrasingdefeat 1 19173 0 0 /news/hernebay200718 2 23405 0 0 /news/idontknowtoomuchaboutclubsoff-the-fieldproblemsadmitschalmers-stevens 1 15919 0 0 /news/drmartens/premier/dover/17thnov03.html 1 0 0 0 /news/551bc99d7c934 2 20313 0 0 /news/13thnov05.html 1 0 0 0 /news/drmartens/eastern/chatham/11thaug03.html 1 0 0 0 /news/dartfordreinstatedintoconferencepremieraftertroubledsalisburycityarethrownout 2 23343 0 0 /news/ramsgate291216 2 25751 0 0 /news/iwillgethernebayintorymansouthsayssimonhalsey 1 16752 0 0 /southern-counties-east-football-league/6 2 40056 0 0 /news/margate230217 1 13429 0 0 /news/kentleague/maidstone/15thdec03.html 1 0 0 0 /news/551a96790da41 2 26412 0 0 /news/dealtown190822 4 53762 0 0 /news/thebigkickoffsittingbournewithouteightfortriptofanciedsideworthing-exclusive 1 15173 0 0 /news/imlookingforwardtomoreexcitingtimeswithstonessaysreturningstrouts 1 11306 0 0 /news/webelieveintheboysthatwecandoitsaysbromleycoachneilsmith 1 17323 0 0 /archive-2006-2014/26 2 25655 0 0 /news/tonbridgeangels130221 1 12453 0 0 /news/SCEFL040521 2 14520 0 0 /news/28thdec04.html 1 0 0 0 /news/wp-content/plugins/formcraft/file-upload/server/php/files/king.php 1 0 0 0 /news/551bc5e768691 1 13328 0 0 /news/imlookingforwardtothechallengesaheadsaysnolan-exclusive 1 13301 0 0 /news/maincompletstransfertoafcwimbledon 1 14838 0 0 /news/soccershortsjamiekempsterreturnstocraywanderers 1 17574 0 0 /news/sevenoaksbossjohnjameshailsstrikeforceafterclinchinglesleckiecupagain 1 12487 0 0 /news/dover221015 1 14940 0 0 /news/bromley3-2bishopsstortford-myconfidencewilltakeapositivestepforwardsaysadambirchall 2 36265 0 0 /news/kentderbiesgiverymanleagueaddedspice 1 20126 0 0 /news/ryman/bromley/bansvbrom170104.html 1 0 0 0 /news/ramscrys130719 2 55724 0 0 /news/551a956bd81dc 1 5905 0 0 /news/weveworkedhardoverthelast18monthstogetourgrounduptoscratchsayspaulpiggott 1 16060 0 0 /news/resultsfebruary2023 4 151542 0 0 /news/tonbridgeangels5-1tunbridgewells-wewanttoclosethegapbetweenthetwoteamssayslarkin 1 32760 0 0 /news/tunbridgewells090123 1 11939 0 0 /news/hythasco040921 5 141980 0 0 /news/werehungrytoreachtheplay-offsthisseasonsaystrott-exclusive 1 14333 0 0 /news/fleetappointatthetop 1 12676 0 0 /news/wecantdoanymorefortheplayersintermsofpreparationsaysnickysouthall 2 21541 0 0 /news/crayvalley240320 3 38938 0 0 /news/letshopewecangoandclaimamassivescalpsaysbromleymatch-winnerdannywaldren 1 18074 0 0 /news/deal070817 1 12759 0 0 /news/bromweston180415 2 33024 0 0 /news/wedontwantramsgatetobethefirstsidetodothedoubleoverussaysneilcugley 1 13687 0 0 /news/oursuccessisdowntohardwork-notmoneysayshessenthaler 1 14280 0 0 /archive-2006-2014/128 1 20190 0 0 /news/hythgree111218 2 69811 0 0 /news/phoenixsports1-0erithbelvedere-ijusthopeourformlastsuntilaprilsayssteveoboyle 1 32590 0 0 /news/iamsurefraserfrankswillcontinuetodevelopintheconferencepremiersaysjamieday 1 13077 0 0 /news/erithbelvedere2-0sittingbourne-deresstunoverconfidentbrickies 1 14615 0 0 /news/craywands281217 3 30527 0 0 /news/tonbridge110618 2 25291 0 0 /news/croydon270919 1 13121 0 0 /news/seagersnapsupkentleaguestars 1 13912 0 0 /news/horsash030519 2 54654 0 0 /news/551a97b201d0f 1 13368 0 0 /news/longhurstbringssevennewplayerstosladegreen 1 11565 0 0 /news/hayesyeadingunited0-0tonbridgeangels-wehavetoputourchancesawaysaystommywarrilow 1 23391 0 0 /news/helpustosupportkentfootball 1 11773 0 0 /news/551a9c0e69d58 2 14874 0 0 /news/ashfordtownmiddx0-1dartford-weveduginandgotaresultaftercriticismsaystonyburman 1 24993 0 0 /news/charltonathletic170619 3 32045 0 0 /news/tootingbec200523 2 26762 0 0 /news/itsallquietonthekentishtransferfront 1 25337 0 0 /news/eastbourneborough240920 2 20619 0 0 /news/fcelmstead030120 1 12822 0 0 /news/warrilowtargetshomeplay-offsemi-final 1 15435 0 0 /news/551bc5dc1fbe0 3 34391 0 0 /news/cuprunhelpsmytransferkittyrevealspennock-exclusiveinterview 1 16116 0 0 /news/othernews/13thsept03.html 1 0 0 0 /news/drmartens/premier/dover/eastbournedover250803.html 1 0 0 0 /news/dartford0-3southendunited-playingagainsttheprosidesishardworkadmitstonyburman 1 18077 0 0 /news/drmartens/eastern/folkestone/wealdstone110904.html 1 0 0 0 /sittingbourne-2003-2006/3 2 29640 0 0 /news/sportingbengalunited1-7thamesmeadtown-senegalstopperpreventsfrighteningscoreline 1 18653 0 0 /news/20thoct05.html 1 0 0 0 /news/deal061104.html 1 0 0 0 /news/kentleague/lordswood/sevenoaks071204.html 1 0 0 0 /news/bromchelt131015 2 40167 0 0 /news/daishupbeatgoingintooxfordtrip 1 12844 0 0 /news/sittingbourne1-0doverathletic-youhavetofightforyourplaceback-hessandabbott 1 29265 0 0 /news/drmartens/eastern/dartford/26thoct03.html 1 0 0 0 /news/abbottkeentomakeupforlosttime 1 13528 0 0 /news/hollands101118 1 13619 0 0 /news/abruzi.php4 1 0 0 0 /news/imayhavetocutthebudgetwarnscraychairman 1 17844 0 0 /news/551bc99dcdbd9 2 12725 0 0 /news/deanpooleywillmakeanexcellentadditiontooursquadsaysfleetbossstevebrown 2 15421 0 0 /news/bromleyinvestors100415 2 17086 0 0 /news/551bc5de83f4f 1 12039 0 0 /news/weletdownthefansbigtimeadmitsbrowne 1 11971 0 0 /news/551a97b14bcb5 1 15064 0 0 /kent-county-league/14 2 22476 0 0 /news/livecoveragetonbridgeangels1-0craywanderers-craneheaderclinchescup 1 25107 0 0 /news/longsignsforfleet-saturdayspre-seasonround-uplastupdated1310 1 18217 0 0 /news/chathamtown2-4merstham-wejustdidntperformthewaywecanadmitskeithlevett 1 17552 0 0 /news/551a92506126f 4 34351 0 0 /news/551bc99b99777 2 21989 0 0 /news/selsey011005.html 1 0 0 0 /news/551a99e441a90 2 28508 0 0 /news/glebe031121 1 12202 0 0 /news/ashfordtownfacebattletoland10000striker 1 14884 0 0 /news/weneedtocutoutthesillydrawstogetoutofthekentleaguesaysbeckscoachjasonclews 1 15259 0 0 /news/fisher310820 1 12550 0 0 /news/doublewinningminnowswewanttomoveonfurther-exclusiveinterview 2 20996 0 0 /news/suttonwillbeatoughgamesayswellingunitedbossjamieday 1 14385 0 0 /news/wellingunited0-0thurrock-ineedmoneytobringsuccesssaysford 1 20291 0 0 /news/551bc5e8212ee 2 27956 0 0 /archive-2006-2014/85 1 20914 0 0 /news/favershamtownunveilreardonastheirnewreserveteamboss 1 15961 0 0 /news/dulwichhamlet280720 1 11304 0 0 /news/imveryproudtohavebeenpartoftheangelspromotionthisyearsayscameramantrevorarnold 1 16329 0 0 /news/551bc99dbe7a4/kentleague/thamesmead/conference/margate/29thnov03.html 2 15653 0 0 /news/551bc99dbe7a4/drmartens/eastern/tonbridge/kentleague/sladegreen/3rdnov03.html 2 15653 0 0 /news/illcertainlybemakingabigchargefortheleaguenextyearsaysmickyhazard 1 16651 0 0 /news/sevenlong211017 1 32148 0 0 /news/margate280218 3 34226 0 0 /news/551bc5deb131d 1 11706 0 0 /news/tunbridgewells0-2dartford-farniesomeplayersarentgoodenough-exclusive 2 17932 0 0 /news/wandscouldgooutofexistenceifplanningconsentisnotgrantedwarnssecretarykerryphillips 1 17379 0 0 /news/doverreleasefiveoftheirchampionshipwinningsquad 1 12361 0 0 /news/kentleague/ramsgate/23rdoct03.html 1 0 0 0 /news/kentleague/cray/francis060804.html 2 0 0 0 /news/fisher01112019 2 23996 0 0 /news/thefutureoftheclubisbrightinsistscriticisedwellsboss-exclusiveinterviews 1 15808 0 0 /news/facupspecialwehavenothingtofear 1 14828 0 0 /news/551a931dcc6b2 1 12323 0 0 /news/551bc99b17774 2 19608 0 0 /news/craygleb130419 1 33708 0 0 /news/stoneschairmanpaystributetofund-raisingfans 1 12770 0 0 /news/hounrust080817 1 25226 0 0 /news/wewouldliketothankeveryonefortheirsupportsaysdealtowndirectorphillipmoore 1 12796 0 0 /news/doverathleticunveilrosskitteridgesigning 1 11970 0 0 /news/thefleetatwembleymadrushforfivethousandticketsonmatchday 1 11158 0 0 /news/coneyhall2-2afccroydonathletic-wevehadtocomebacktogoforwardadmitschristucker 2 32196 0 0 /news/othernews/21stsept03.html 2 0 0 0 /news/bromley010420 2 16703 0 0 /news/everythingsinplaceforustodeliversaystunbridgewellsbossmartinlarkin 1 18043 0 0 /news/hopefullywecancarryonwhereweleftoffvowsdartfordbosstonyburman 1 14869 0 0 /news/schulzandelmeswillscore30-goalsbetweenthempredictsmiles-exclusive 1 15053 0 0 /news/lordswoodbossjasonlillisaimingtocausecupshockovershininglightshythetown 1 19759 0 0 /news/neilcugleyhopefultomakenewsigningannouncementnextweek 1 18860 0 0 /news/soccershorts160623 4 54823 0 0 /news/kentsidesjusttwowinsawayfrompotentialtriptogiantsleedsunited 1 15126 0 0 /news/iwantanexperiencedbackbonetomyteamsayserithtownbosstonyrussell 1 14827 0 0 /news/englandfansfacetravelchaos 1 15808 0 0 /news/chathamstalwartawardedforhisefforts 2 14866 0 0 /news/beckenhamtown1-2fisher-billyhensmansgotafantasticfutureinfrontofhimsaysmartinford 1 33211 0 0 /news/warrilowmakeshispromotionintentionsknown 1 14593 0 0 /news/pennockenjoyscompetitionforplaces 2 15045 0 0 /news/tunbridgewells2-0vcdathletic-weredreamingaboutwembleysayswellsbossmartinlarkin 1 28865 0 0 /news/551a99e3b784f 2 36872 0 0 /news/weretreatingbearswithrespectsaysmoore-exclusiveinterview 1 15874 0 0 /news/preseason2023 7 198903 0 0 /news/chercray190519 2 41259 0 0 /news/30thdecember2003.html 1 0 0 0 /news/smithbeginssearchfornewclub 1 15165 0 0 /news/wecanlookupandfightourwayintothelightssaysbromleydefendertutuhenriques 1 18138 0 0 /news/551bc5dd4e603 2 17826 0 0 /news/ramsgate310119a 2 28057 0 0 /news/dartford6-1whitstabletown-wecouldhavegivenabetteraccountofourselvesadmitsnott 1 32507 0 0 /news/lordswood310818 1 12344 0 0 /news/listenwellpickourselvesupinsistsdartfordbosstonyburman 1 19628 0 0 /news/bromley221015 2 19081 0 0 /news/vcdvcray240404.html 1 0 0 0 /news/551a9c0e7e260 4 39991 0 0 /news/wehavetopickourselvesupfornortonsportssaysguttedhernebayskipperlukeharvey 1 24559 0 0 /news/551a97b1d3334 1 15607 0 0 /news/lovellrueshisluckduringseven-goalramraid 1 16675 0 0 /news/stevenageborough4-1doverathletic-someofmyplayersgotfoundouttodayadmitshessenthaler 1 30268 0 0 /news/sevenoaks290418 1 15910 0 0 /news/lingdeal021223/ 1 13054 0 0 /news/sheppeyunited100921 1 12758 0 0 /news/551bc5e67744f 1 14498 0 0 /news/lymington040904.html 1 0 0 0 /news/teamworkhashelpedwithoursuccesssaysaward-winninglovell 1 17408 0 0 /news/ryman/bromley/bromvgraysfr090803.html 1 0 0 0 /news/kentleague/cray/15thaug03.html 2 0 0 0 /news/thefacupprizemoneyonofferismassivetolordswoodsaysbossjasonlillis 1 12611 0 0 /news/woking5-1hythetown-thegamewasnevereasyadmitswokingbossbaker 1 24818 0 0 /southern-counties-east-football-league/47 1 19718 0 0 /news/mcmahonworkingonloverdeal 1 15072 0 0 /news/551bc5e47ec61 1 10592 0 0 /news/weoweharrowafavoursaysburman 1 12678 0 0 /news/maidstoneunited0-5brightonhovealbion-thepitchwasmagnificentsaysbrightonbossguspoyet 1 18773 0 0 /news/itsabouttimethatwegotintothefacupsecondroundsaysdartfordbosstonyburman 1 14810 0 0 /news/cray210917 3 30289 0 0 /news/eritsutt130519 1 33514 0 0 /news/kessellrejectsdovermove 1 19782 0 0 /news/wellingDay241116 1 15108 0 0 /news/551bc5e5ea167 1 11815 0 0 /news/folkestonechappell060715 3 31224 1 1 /news/dulwichhamlet0-1tunbridgewells-martinlarkinveryproudofhisresilientfacupgiant-killers 1 35686 0 0 /archive-2006-2014/54 1 20567 0 0 /news/hollands070716 1 12157 0 0 /news/idlovetohavegivenitacrackandtestedourselvessayshildenboroughbossandrewmakechnie 1 16691 0 0 /news/551bc99d9534b 2 25074 0 0 /news/howtomakeadonationtoassistwithrunningcosts 1 10009 0 0 /archive-2006-2014/8 3 44603 0 0 /news/ebbsfleet021119 1 14186 0 0 /news/2ndjune05.html 1 0 0 0 /news/resultsaugsept2022 1 0 1 1 /sevenoaks-2003-2006 11 164894 0 0 /news/551bc5e10e365 1 19766 0 0 /news/fishbear120119 1 36340 0 0 /news/dealtown020122 4 58194 0 0 /ramsgate-2003-2006/3 2 17655 0 1 /news/crayvalley1-2lingfield-itwouldhavebeennicetorepaythechairmanwithavaserun-chapman 1 26183 0 0 /news/tonbridgeangels5corinthiancasuals1-exclusiveinterview 1 16511 0 0 /news/wethriveonbeingtheunderdogssayshythetowndefendertomparkinson 1 15597 0 0 /news/idontwanttoloseoverthefestiveperiodsaysabbott 1 17865 0 0 /news/rossflitneyismynumberonekeepersayshessenthaler 1 14280 0 0 /news/abbottruesbradbrookslong-terminjury 1 20821 0 0 /news/551a956ba15db 1 3741 0 0 /news/sheppey220917 1 11894 0 0 /archive-2006-2014/40 2 25408 0 0 /news/beckenham300819 1 12156 0 0 /news/551bc5e652e93 1 13184 0 0 /news/hollfish010523 4 144902 0 0 /news/dulwichhamletreassurefansofapositivefuturefortheclub 1 15944 0 0 /news/551bc5da242e6 4 34570 0 0 /news/hernebay040919 2 26219 0 0 /news/cugleymakeschangesforhamptonsvisit 1 14240 0 0 /margate-2003-2006 13 170993 0 1 /news/29thjan05.html 1 0 0 0 /news/kentleague/ramsgate/29thsept03.html 1 0 0 0 /news/30thoct05.html 1 0 0 0 /news/lewisham171119 1 12869 0 0 /news/iexpectustobechallengingforthetitleinthreeyearstimesaysderesbosslonghurst 1 13298 0 0 /news/soccershorts270522 2 52139 0 0 /news/wingsunveildayastheirnewmanager 1 20273 0 0 /news/soccershorts180516 1 13769 0 0 /news/weknowitsgoingtobeadifficultseasonaheadwarnscugley 1 18098 0 0 /news/othernews/padwood29thjune03.html 1 0 0 0 /news/551a97b0c259b 2 31232 0 0 /news/littlewarnsthattigershaveimprovedthisseason 1 27295 0 0 /news/battleofcrayfordopenskentinvictaleague-tonyreynoldsquitsashfordunited 1 24893 0 0 /news/551bc5e1c6637 1 15045 0 0 /news/werenotarelegationsideinsistsfleetstoppercronin 1 13705 0 0 /news/threebridges1-4favershamtown-weveshownagooddegreeofcharactertonightsaysrayturner 1 28840 0 0 /news/greenwich261020 1 12929 0 0 /news/551bc99dbe7a4/kentleague/hernebay/ryman/bromley/9thjuly03.html 2 15653 0 0 /news/berkhamsted161104.html 1 0 0 0 /news/soccershortswarrilowandboardoutlineplansfornextseasonatfansmeeting 1 31541 0 0 /news/551a931dc200c 1 12401 0 0 /news/fordcriticiseskcfaforhiscupfinalban 1 14874 0 0 /news/burgesshilltown2-1chathamtown 1 13187 0 0 /news/dartford050820 4 21030 2 0 /news/drmartens/eastern/fisher/19thfeb04.html 1 0 0 0 /news/wembleywoemcclarenpaysthepriceforenglandsembarrasingexit 1 15235 0 0 /news/greenwichborough3-1erithbelvedere 1 13414 0 0 /news/hanscombestepsdownascraysreserveteammanager 1 12453 0 0 /news/ashfordtownfaceuncertainfuture 1 17120 0 0 /news/551bc99dbe7a4/kentleague/hernebay/kentleague/lordswood/eastbournevlordsfac230803.html 2 15653 0 0 /news/551bc5e80424b 1 11723 0 0 /news/drmartens/eastern/erith&belvedere/29thnov03.html 1 0 0 0 /news/551bc5dced61e 1 14263 0 0 /news/maidstone020719 2 18967 0 0 /news/ashford220518 3 27941 0 0 /news/soccershorts010616 2 34935 0 0 /news/favershamtown280923 1 13715 0 0 /news/welookforwardtocontinuingsupportfromalloursponsorssaysdoverchief 1 11950 0 0 /news/itsnotallwhiteonthenight-latestprincesparkpics 1 13890 0 0 /news/551a9250f260d/16thjune04.html 2 6643 0 0 /news/chipstead090716 1 11889 0 0 /news/corinthian020819 1 13271 0 0 /news/ashfordtown0-1croydonathletic 1 12705 0 0 /news/phoenixsports101019 3 31226 0 0 /news/551bc99dbe7a4/drmartens/eastern/tonbridge/ryman/bromley/26thoct03.html 2 15653 0 0 /news/crowling040817 1 26339 0 0 /news/crowuckf271222 6 139358 0 0 /news/ryman/bromley/8thaug04.html 2 0 0 0 /news/moorelookingforwardtobigstonesshowdown 1 12415 0 0 /news/theweekaheadwc3rdapril2006 1 22202 0 0 /news/holmesdalemaintaintheirkentleaguestatuswithfloodlightinggrant 1 13337 0 0 /news/leatherhead1-2favershamtown-wewereoutstandingsaysfavershamassistantclivewalker 1 29399 0 0 /news/margate061223/southern-counties-east-football-league 1 3891 0 0 /news/551a9678beb01 3 43096 0 0 /news/wenormallydoverywellathomeinthekentderbiessaysramsgatebosstimdixon 1 14355 0 0 /news/551bc99dbe7a4/drmartens/eastern/folkestone/kentleague/sevenoaks/16thaug03.html 2 15653 0 0 /news/551bc5e44de7c 1 11300 0 0 /news/harwoodshunsmargatetoreturntocarshalton 1 11812 0 0 /news/underpressuremileswieldstheaxe-exclusiveinterview 1 22852 0 0 /news/maidstone180619 1 11919 0 0 /news/alfanew2.php7 1 0 0 0 /news/overlandgetsthenod-exclusiveinterview 1 15891 0 0 /ashford-2003-2006/www.heineken.co.uk/www.heineken.co.uk/ 1 3130 0 0 /news/tonbridgeangels2-1hendon-angelswinmarredbyscottgoodinginjury 1 19552 0 0 /bromley-2003-2006/8 2 16753 0 0 /news/angelsallgearedupforpromotionpush 1 15656 0 0 /news/551bc99dbe7a4/kentleague/hernebay/drmartens/premier/welling/17thsept03.html 2 15653 0 0 /news/dayaddslong-termtargetstohissquad 1 13114 0 0 /news/551bc99adf9d8 2 20172 0 0 /news/favershamtown2-2margate-imdisappointedthatwethrewawaytwoleadssaysrayturner 1 19376 0 0 /news/folkestonearebuzzingwithnewdirectorsatthehelm 1 21830 0 0 /news/wehavetomakesureoutgoodfootballtranslatesintopointssayssevenoakstownbosslevett 1 15845 0 0 /news/551a979a54495 1 5636 0 0 /news/itsbeenatoughseasonadmitschathambosspaulfoley 1 30908 0 0 /news/iliketothinkwellachieveourtopsixtargetbutwemustbemoreconsistentsaysstevechapman 1 13842 0 0 /news/hernebay3-2favershamtown 1 15743 0 0 /news/cordicewantstogetbacktowinningways 1 14164 0 0 /news/bearsted210417 1 14255 0 0 /news/chatham151005.html 1 0 0 0 /news/19thoct04.html 1 0 0 0 /news/borehamwood011005.html 1 0 0 0 /news/551bc99dbe7a4/kentleague/sladegreen/drmartens/eastern/tonbridge/15thjuly03.html 2 15653 0 0 /news/wellingunited7-1folkestoneinvicta-wingsaddtoinvictaswoes 1 17754 0 0 /news/kentleague/tunbridgewells/23rdjuly03.html 1 0 0 0 /news/551a95b43c0ae 2 18359 0 0 /news/sittingbourne210917 2 24754 0 0 /news/tonbrigeangels2-0chathamtown-werenotplayingwellenoughadmitswarrilow 1 18358 0 0 /news/9000raisedforsewell-dartsapproachinvictadefender-invictainsisttheypaytheirteam 1 13740 0 0 /news/551bc5e27b41b 1 11775 0 0 /news/551a97b179881 1 18360 0 0 /news/weregoingtogivesomeoneahidingwarnsbinks 1 12881 0 0 /news/soccershortswehavenothingtolosesotheresnopressureonussaysjohnovard 1 28246 0 0 /news/551bc5e7e1942 2 18641 1 0 /news/hernebay1-2whitleybay-wewerethebettersidebutweswitchedofffor10seconds-halsey 1 24817 0 0 /news/fleetdown280715 1 18018 0 0 /news/tunbridgewellsditchreserveside 1 14513 0 0 /news/hollands040816 1 13136 0 0 /news/iwouldlovetoplayinthepremierleaguesaysambitiouslegge 1 24709 0 0 /news/tonbridgeangels280220 1 14522 0 0 /news/phoenix071018 2 30924 0 0 /news/thebigkickoffdolbyfacesselectionheadacheforswansopener 1 15298 0 0 /news/seagerpraisesmarathonmanparker 1 13912 0 0 /news/facarlsbergvasethirdrounddrawkentleaguerivalsfaceeachotherforaplaceinthelast32 1 12840 0 0 /news/lordsutt261122 1 29641 0 0 /news/othernews/12oct03.html 1 0 0 0 /news/theweekahead-4 1 13704 0 0 /news/fiskjoinsboardathythetown 1 12257 0 0 /news/soccershorts050216 2 39829 0 0 /news/imgivingbeckenhamplentyofrespectsaysthamesmeadbosskeithmcmahon 1 22581 0 0 /news/551a9718ae02d 2 15393 0 0 /news/idontreallyknowwhattoexpectinthisdivisionadmitshernebaybosssimonhalsey 1 18032 0 0 /news/collintargets25goalsforpromotionchasingwhites 1 11803 0 0 /news/551a97b0d432c 2 29668 0 0 /news/551bc5d96bbb7 2 16616 0 0 /news/ashfordtownunveillangleyasnewreserveteamboss 1 12451 0 0 /news/551bc99dbe7a4/kentleague/erithtown/ryman/bromley/horsvbrom091203.html 2 15653 0 0 /news/kentleague/tunbridgewells/tunvslade130903.html 2 0 0 0 /news/openingdayyoudecide 1 11356 0 0 /news/burmanrelishesfirstfacupclashatprincespark 1 12993 0 0 /news/wivenhoe290105.html 1 0 0 0 /news/wellingtown200117 2 15047 0 0 /news/551bc5dc2fa36 3 38326 0 0 /news/drmartens/eastern/sittingbourne/leightontown110904A.html 1 0 0 0 /news/ashford150815 1 12955 0 0 /news/22ndapr04.html 1 0 0 0 /news/bromley260719 2 14504 0 0 /news/theroadtowembleytimetocastyourvoteonourmainmatch 1 11651 0 0 /news/heroroylarner070617 2 27489 0 0 /news/seldongetsangelsbacking 1 14896 0 0 /news/robbinswantstoavoidcuphangover 1 12217 0 0 /news/wellingunitedsellstrikerandypughtocambridgeunitedfor15000 1 12752 0 0 /news/wewanttofinishashighaswepossiblycansayshernebaybosssimonhalsey 1 17211 0 0 /news/staceylonghastakenasignificantdropinwagestore-signforebbsfleetsaysbossstevebrown 1 14343 0 0 /news/nationwide/7thjuly03.html 1 0 0 0 /news/551a96778c233 2 16198 0 0 /news/551a99e537472 1 17752 0 0 /news/iamlookingforagoodresponseagainstbarnetsayswellingunitedbossjamieday 1 12472 0 0 /news/kentleague/whitstable/18thsept03.html 1 0 0 0 /news/cash-strappedsittingbournefacefighttokeeptheirbestplayers 1 11727 0 0 /news/sevenoakstown1-1beckenhamtown-wevejustbeenrobbedoffthreepointsclaimsdarrenanslow 1 24839 0 0 /news/551a956bc69be 1 3882 0 0 /news/bromley5-0graysathletic-wevegotonehellofadifficulttieinthenextroundsaysgoldberg 2 34294 0 0 /news/ifimtopwithonegametogothenillbeverypleasedsayssittingbournebossmattwyatt 1 14830 0 0 /news/bromley1waltonhersham0 2 16150 0 0 /news/30thjuly04.html 1 0 0 0 /news/november2007results 1 25263 0 0 /news/thefavasefinal2013idontwanttobetheonlyonetowinatwembleysaystommysampson 1 18914 0 0 /news/holmtunb151221 4 45706 0 0 /news/torqbrom100115 1 27270 0 0 /news/wewillbemakingsometoughdecisionsoverthenextweeksayswellingunitedbossjamieday 1 12103 0 0 /news/551bc5dca96ee 3 37106 0 0 /news/ourgateswillbefineinthenorthsaysfoley 1 14816 0 0 /news/551a96dbdd458 1 5674 0 0 /news/welldart221116 1 31725 0 0 /news/canterbury310517 1 13213 0 0 /news/kentleague/sladegreen/greenwich131104.html 1 0 0 0 /news/theclubisdefinatelygoingtherightwaysaysmaidstoneunitedacademymanagerjackparkinson 1 18412 0 0 /news/everythingseemstobegoingtherightwaysayslordswoodbossjasonlillis 1 14114 0 0 /news/facupspecialdaishisfleetsbest-edwards 1 15539 0 0 /news/ashford230218 2 17223 0 0 /news/doverathletic3-5eastleigh-wedontbecomeabadsideovernight-hessenthaler 1 44261 0 0 /drmartens/eastern/folkestone/folkvmarkscfinal280404.html 1 9955 0 0 /news/fisher191016 1 14569 0 0 /news/othernews/AEI041004.html 1 0 0 0 /news/wehavetofightandscrapforeverythingandbelievewecanstayup-nott 1 16214 0 0 /news/luchfordbacktofull-strengthforhernebayshieldclash 1 15529 0 0 /news/gravesham230517 1 14129 0 0 /news/hayescanwinusthegamesaysflanagan-exclusive 1 17443 0 0 /news/551a92506e12b 2 17640 0 0 /news/wellgiveagoodaccountofourselvessaysdoverathleticbosschriskinnear 1 17872 0 0 /news/theweekahead-5 1 14823 0 0 /news/sevenoakstown1-5tonbridgeangels-coachesshouldsetagoodexampletokidssaysmickyhazard 1 26359 0 0 /news/soccershorts160721 2 37715 0 0 /news/551a9c0ea4090 4 42098 1 1 /news/morekentleagueclubswillgoamateurascrowdsdontwarrantwagebillswarnsfisherboss 1 18929 0 0 /news/glebe101123 2 30040 0 0 /news/maidstoneunited0-2carshaltonathletic-lackofbeliefisworryingadmitshume 1 14391 0 0 /southern-counties-east-football-league/61 1 19533 0 0 /news/bromley090618 2 23082 0 0 /news/wehavehadanoverwhelminglevelofsupporttocomehomesayscraywandererschairmangaryhillman 1 15710 0 0 /news/sevenpointsfromtitlemyplayersmustplaylikeobriensaysburman-exclusive 1 16623 0 0 /news/bromsutt290220 2 38788 0 0 /news/lydd060917 8 38888 6 6 /news/starsturnoutinforcetosupporthughescause 1 13156 0 0 /news/551a97b12e9bb 1 20778 0 0 /news/551a979a74192 1 4152 0 0 /news/wellingspreadtheirwingsintheirlocalcommunity 1 11318 0 0 /news/ashford281016 1 11952 0 0 /news/imconfidentthatwecanputafewthingsrightsayshernebaybosssamdenly 1 14531 0 0 /news/fanshelpfolkestonespromotionbid 1 13297 0 0 /news/lewes101220 1 14790 0 0 /news/icannotreturntokentleaguefootballvowssampson 1 16717 0 0 /news/551bc99c9df92 2 24423 0 0 /news/wereoneoftensidesgoingforthetopfivesaysdoverbossmartinhayes 1 19283 0 0 /news/openingdayresults 1 40159 0 0 /news/kinchwillstrengthenmymidfieldsaysjenkins 1 12993 0 0 /news/corifish230219 2 47717 0 0 /news/seagerhailstrioforupturninform-exclusive 1 14682 0 0 /news/becksenb091015 1 14875 0 0 /news/injury-hitstonessigndefenderswattsandroyston 1 12138 0 0 /news/leyton1folkestoneinvicta1 1 14546 0 0 /news/cugleysettosealstrikerthisweek-exclusive 1 14616 0 0 /news/downbeatwardplaysdownplay-offhopes-exclusiveinterview 1 13806 0 0 /news/551bc99aea666 2 16708 0 0 /news/doverathletic081018 1 11513 0 0 /news/soccershortskentsidesgiveyouthachancetoimpress 1 13899 0 0 /news/afcwimbledon291105.html 1 0 0 0 /news/hessenthalerdropsbombshellbyreleasingcollin 1 15561 0 0 /news/kentleague/cray/6thdec04.html 1 0 0 0 /news/dockersmakebradshawsstaypermanent 1 13231 0 0 /news/wehavetogiveourselvesachancesaysoconnell 1 16101 0 0 /news/rivalmanagerscondemnhillingdonovertheiramaterishantics 1 14622 0 0 /news/craycroy270219 1 31170 0 0 /news/werenotgoingtosit-backtoprotectourtwo-goalleadsaysmcphee 1 13397 0 0 /news/bearfave101023 14 145341 10 10 /news/wehaveaspirationstomoveoninthefacupsayschathamtownbosskevinwatson 1 12848 0 0 /news/farnierelishingfacupclashagainsthisformerclub-exclusive 1 23488 0 0 /news/551bc5e175dd1 1 16701 0 0 /news/itsamassivegamefortheclubsayserithtownbossmarktompkins 1 20886 0 0 /news/10thaug05.html 1 0 0 0 /news/theresmoretocomefromussaystable-toppinghessenthaler 1 15952 0 0 /news/iveneverwalkedawayfromachallengesayshugolangton 1 17914 0 0 /isthmian-league/23 3 45834 0 0 /news/kspodeal070920 1 25763 0 0 /news/551bc5e442173 1 3943 0 1 /news/folkeast191021 5 161780 0 0 /news/foleyreflectsonsuccessfulseason 1 16757 0 0 /news/551bc5e6452cc 1 14365 0 0 /news/551bc5dde7aab 1 13094 0 0 /news/551bc5db7da8c 2 14026 0 0 /news/weneedfourwinsfromourlastsevengamestosecureplay-offplacesayswingsbossjamieday 1 14003 0 0 /news/wellingtown170120 1 13086 0 0 /news/551a9250da3c1 4 48075 0 0 /news/itsverymuchhythestitlenowadmitshernebaybosssimonhalsey 1 18860 0 0 /news/551a9718b4dcc 2 15026 0 0 /news/favershamtown0-4maidstoneunited-wecantfeelsorryfourourselvessaysrayturner 1 20888 0 0 /news/bromley3-1craywanderers-icantwaittogetstartedsaysjenkins 1 21152 0 0 /news/551a9799c2ae4 1 5233 0 0 /news/ifeltitwastherighttimetocallitadaysaysfrustratedkeithlevett 1 16880 0 0 /news/sheernesseast4-4lewishamborough 1 19961 0 0 /news/sittingbourne1-3craywanderers-thetitleisinourhandsnowsaysjenkins 1 16980 0 0 /news/kingstonianholdthecardsintitleraceadmitskempster 1 14855 0 0 /kent-invicta-league/13 2 25783 0 0 /news/missedchancesarecostingusdearlyadmitssittingbournebossjoedowley 1 13525 0 0 /news/kentleague/sladegreen/whitstable210804A.html 1 0 0 0 /news/erithbelvedere2-0ashfordtown-imfindingrymanfootballhardadmitswhincup-exclusive 1 21204 0 0 /news/wellbecapableofdealingwitheithersectionoftheleagueinsistsfoley 1 14564 0 0 /news/moneynotanissueforstrikercass 1 15059 0 0 /news/season2013-2014faplacefourkentclubsinrymanleaguedivisiononenorth 1 20591 0 0 /news/myplayerswillputthingsrightsaysdartsbosstonyburman 1 18467 0 0 /news/wedofancyourchancesagainsthorshamsaysvickersassistantandysilk 1 16530 0 0 /news/doverdonnelly070515 2 17692 0 0 /news/551a931e4c8b2 1 17528 0 0 /news/551a95b3a68e9 2 14816 0 0 /news/551a97b051e2f 1 18433 0 0 /news/stonesmanagementduoagreetermstostaywiththeclub 1 13588 0 0 /news/icanabsolutelyguaranteeoursupportersthatourperformanceswillbebettersaysfisherboss 1 14672 0 0 /news/folkestoneinvictamustcleardebtsbeforetheycanmoveforwardsayschairmanmarkjenner 1 15760 0 0 /news/551bc99b6457c 2 20473 0 0 /news/kentleague/beckenham/greenwich071204.html 1 0 0 0 /news/weshouldhavemorepointsadmitsinjuredskipperdenly 1 14164 0 0 /archive-2006-2014/157 1 19168 0 0 /news/eritcher050921 4 107434 0 0 /news/hopefullywecanmakeourgroundabitofafortresssayscharltonathleticstrikersampittuck 1 16049 0 0 /news/wehavetokeepgoingandkeepamongtheplay-offmixsaysramsgatebosstimdixon 1 15709 0 0 /news/sheringhamwilldothebusinesssaysburman 1 18892 0 0 /news/551a96790232c 3 26810 0 0 /news/facuprunwillbringabitofglorytotheboyssaysvcdassistantandysilk 1 12702 0 0 /news/1VNQfMTb 1 9694 0 0 /news/westillhaveachancetoresurrectourseasonsayswarrilow 1 18257 0 0 /news/sittingbournemeetwithcounciltodiscusstheirfuture 1 14280 0 0 /news/crayvalley231015 1 11768 0 0 /news/margate050521 2 26523 0 0 /news/sevenoaks070719 2 27785 0 0 /news/othernews/22ndjune03.html 1 0 0 0 /news/craywanderers1-3tonbridgeangels-wewereoutclassedadmitsfrancis 1 26555 0 0 /news/imsurewewillturnthingsaroundsayscrayvalleybossstevechapman 2 18242 0 0 /news/wevebanishedallthoughtsonrelegationsayswhitstablechief-exclusive 1 14384 0 0 /news/redbridge2-3sittingbourne 1 14122 0 0 /news/ashford241117 2 19749 0 0 /news/phoenix010917 2 24515 0 0 /news/551bc99d68788 2 20756 0 0 /news/551a95b39f840 2 15072 0 0 /ramsgate-2003-2006/2 2 17744 0 0 /news/resultsaugsept2017 2 151511 0 0 /news/soccershorts050816 2 51935 0 0 /news/kickitoutisproudtoberepresentedatthefixturebetweenbromleyandwellingsayspaulelliott 1 13228 0 0 /news/lilliswantsrymanfootballathernebayexclusiveinterview 1 15602 0 0 /news/walkerpartscompanywithdoverathletic 1 11604 0 0 /news/551a95b434afe 2 22592 0 0 /news/wingsmakeswiftoffertohelpoutdockers 1 11948 0 0 /news/goodfridayfamilyfunatfolkestone 1 12135 0 0 /news/punjabunited2500322 1 12630 0 0 /news/551a9c0e791ae 4 35671 0 1 /news/mysquadisgoodenoughandcapableofwinningsomethingsaysvcdathleticbossrickybennett 1 12622 0 0 /news/idontwanttogetbeatbythesameteamtwiceinaseasonsaysjamieday 1 15159 0 0 /news/resultsjan2017 2 143420 0 0 /news/othernews/2ndaug04.html 2 0 0 0 /news/bromley0-0thurrock-werenotsafeyetandthatsmybiggestdisappointmentsaysmarkgoldberg 1 22710 0 0 /news/wemuststayintouchwiththeleaderssaysjenkins 1 15373 0 0 /news/551bc99dbe7a4/drmartens/premier/dover/ryman/bromley/bromvdartksc071003.html 2 15653 0 0 /news/glebe221021 1 12581 0 0 /chatham-2003-2006/2 3 32245 0 0 /news/rustshep260322 1 37833 0 0 /news/lewesladies5-0gravesendnorthfleetladies 1 15214 0 0 /news/weregoingintherightdirectionsayshalsey 1 13180 0 0 /news/specialofferadvertisehereforthenewseason 1 10088 0 0 /news/551a9c9272e33 3 47031 0 0 /news/551a97992f193 1 8912 0 0 /news/551a95b3c632f 2 16569 0 0 /news/551a99e4c5822 2 35098 0 0 /news/wewanttostayinthetrohpyforaslongaswecanvowsdartfordbosstonyburman 1 15286 0 0 /news/erithtown201104.html 1 0 0 0 /news/weneedsupportfromlocalbusinessesifweretopushforthetitle-dealtownbossderekhares 1 12318 0 0 /news/first50fanswatchfisherforfreethankstopopularyoutubechannelcopa90 1 15759 0 0 /news/westwickhamrelishbeckenhamexamination 1 14663 0 0 /archive-2006-2014/195 1 18867 0 0 /news/resultsapril2016 2 135019 0 0 /news/seagerrelishestheunderdogtag-exclusive 1 15881 0 0 /news/kentleague/hythe/22ndaug04.html 1 0 0 0 /news/551a9798a9264 2 31217 0 0 /news/itwasprobablytheworstinjuryiveeverseenonapitchclaimskevinwatson 2 37488 0 0 /news/erithtown2-3beckenhamtown-myplayersmustfightfortheirplacesayshuntley 1 40985 0 0 /news/maidstoneunited0-2accringtonstanley-humehappywithopeningwork-out 1 21650 0 0 /news/stoneschairmanweneedyoursupport 1 15068 0 0 /news/thamvslad210204.html 1 0 0 0 /news/thebigfreeze-lastupdated1200 1 13057 0 0 /news/sundaysfixturelist-lastupdated1045 2 43388 0 0 /news/folkestone040318 2 28090 0 0 /news/weneedtokeepincontentionforaplay-offplacesayswellingstarjamieday 1 13503 0 0 /news/551a9bb014974 3 32786 0 0 /news/wehavetobereadyforabattlewarnswellingunitedbossjamieday 1 13065 0 0 /news/wp-content/plugins/ioptimizations/xo.php 1 0 0 0 /news/safetyconcernscausepostponementofrelegationbattle 1 11924 0 0 /news/lordswoodopenthegatesforthevisitofinjury-hittunbridgewells 1 14121 0 0 /archive-2006-2014/44 2 25788 0 0 /news/551bc99a69617 1 14175 0 0 /news/551a95b47d027 2 20597 0 0 /news/folkestoneinvictaswoopforteenagepairfromgillingham 1 17854 0 0 /news/humelooksforwardtodartsderbyshowdown-exclusiveinterview 1 28203 0 0 /news/tonbridge230917 2 24420 0 0 /news/greenholl120415 1 34660 0 0 /news/beckenhamtown190922 3 36090 0 0 /news/hythe240217 2 29919 0 0 /news/EFLStatement160320 3 28902 0 0 /news/dereswarmingupaheadoftitlebid 1 12901 0 0 /news/551a931eaf03e 2 30082 0 0 /news/imnotputtinganypressureontheladssaysfisherbossstevefirkins 1 13704 0 0 /news/10thjuly03.html 1 0 0 0 /news/dalersunderdogsfortheirhistoricnightclaimsbeckingham 1 17840 0 0 /news/fisherbossgarylisneypullsoffdanyoungtransfercoup 1 13430 0 0 /news/gillinghamplayfolkestoneinvictaformickydixsbenefitmatch 1 12764 0 0 /news/bromyeov071120 5 132787 0 0 /news/ryman/bromley/bromvhamp251003.html 1 0 0 0 /news/theendofthelineforsladegreen 1 21094 0 0 /news/551bc5dccbf7e 1 13560 0 0 /news/holmesdaleconfirmvenueswitchforcrayfriendly 1 11547 0 0 /news/itsimportantjustliketheolympicgamesour130thbirthdayleavesalegacysayschathamchairman 1 12677 0 0 /news/stanlark120422 5 162797 0 0 /news/greenwich210518 2 21748 0 0 /news/ouraimistogetpromotedsaysphoenixsportsjoint-managersteveoboyle 1 14297 0 0 /news/sampsonexpectedtomakefullrecoverysaysward 1 11096 0 0 /news/margate120118 2 25058 0 0 /news/551bc99dbe7a4/kentleague/erithtown/ryman/24thjune03.html 2 15653 0 0 /drmartens/premier/welling/19thmay05.html 1 9955 0 0 /news/itwasadifficultdecisiontoleavesittingbourneforleatherheadsaysrichardbrady 1 13121 0 0 /news/chipstead1-4chathamtown 1 13887 0 0 /archive-2006-2014/50 1 20685 0 0 /news/lewes250321 2 26161 0 0 /news/wehavetocutourclothaccordinglysaysnewwhitstabletownchairmangaryjohnson 1 19264 0 0 /news/margate020621 2 23949 0 0 /news/margatebossiainoconnelllwantsgoodpre-seasonhabits 1 15694 0 0 /news/tauntontown101220 1 17667 0 0 /news/kentleague/lordswood/1stjuly03.html 1 0 0 0 /news/trotttellsboo-boyslookatthebiggerpicture 1 18183 0 0 /news/ramsgate171116 2 24276 0 0 /news/saturdaysmatchreports-2 1 10619 0 0 /news/551a96dc10106 2 19596 0 0 /news/tonbridge271017 2 26572 0 0 /news/551a97b281dfc 1 15239 0 0 /news/horsham1-3dartford-thatsansweredafewofourcriticssaysburman 1 20686 0 0 /news/wewilltakethegametothempromiseshessenthaler 1 21881 0 0 /news/ResultsOctober2020 3 131682 0 0 /news/ashfordtown0-1waltoncasuals-pressuremountsonunderperformingashford 1 15154 0 0 /news/bromley020821 2 19245 0 0 /news/cugleypraiseslocalplayersforsteadyingtheship 1 17857 0 0 /news/craywanderers261121 3 33408 0 0 /news/glebe031220 1 13092 0 0 /news/lydd290718 7 42482 6 6 /news/resultsoctober2016 2 129204 0 0 /news/afcwimbledonarefavouritestolandtitleadmitsramsgateboss-exclusiveinterview 1 14588 0 0 /news/staines230405.html 1 0 0 0 /news/551bc5e5363c8 2 22357 0 0 /news/ashfordtownunveilnewsignings 1 12108 0 0 /news/weregoingtoenjoyourlastninegamessaysramsgatebossjimward 1 12372 0 0 /news/551bc99dbe7a4/ryman/drmartens/premier/dover/6thaug03.html 2 15653 0 0 /news/daishcontinuestobuildfornextseason 1 10860 0 0 /news/sloughtown2bromley2 1 13671 0 0 /news/rustkspo290921/ 2 10248 0 0 /news/chathamtown0-3romford-itwasourworstperformanceoftheseasonadmitskevinwatson 1 15654 0 0 /news/theunityisbeginningtoshowthroughandweregonigtoneedthatsaysrayturner 1 12666 0 0 /news/glebeelms301015 1 32250 0 0 /news/551bc5db6544c 3 44219 0 0 /news/sittingbourne070420 2 26067 0 0 /news/folkestoneinvicta1-0afcwimbledon 1 17808 0 0 /news/4thnov05.html 1 0 0 0 /news/sittingbourne3-1chathamtown 1 19550 0 0 /news/angelsconfidentofbeatingtitlechasingbromley-exclusiveinterview 1 13457 0 0 /news/maidstoneunitedshouldbeaconferencesouthclubsaystwo-goalheroroyston-exclusiveinterview 1 14178 0 0 /news/folkestoneinvictatakedrydenofftransferlist 1 12868 0 0 /news/glebe270716 1 14193 0 0 /news/burmansettomakechangesdespiteawesomedisplay 1 16550 0 0 /news/551a9c93399c7 3 34647 0 0 /news/refmarshall230717 2 23156 0 0 /news/wevegottobuildonourrecentformsaysyorath 1 12135 0 0 /news/551a979915e21 1 4769 0 0 /news/ryman/bromley/croydonvbrom160803.html 1 0 0 0 /news/deal161004.html 2 0 0 0 /news/doverathleticopenthegatesforchristmasbash 1 12116 0 0 /news/cumberbatchreturnstohomelands 2 14049 0 0 /news/551a9c92eba3d 2 15619 0 0 /news/craywanderers0-3crystalpalace-itsgreattoseetheirnextgenerationsaysjoefrancis 1 25662 0 0 /news/ihopewecanmoveforwardandmaketheseplansarealitysayscraywandererschairmangaryhillman 1 13359 0 0 /news/wedbearealassettothekentleagueinsistsfavershamboss 1 14899 0 0 /news/whitstabletown140619 2 23896 0 0 /news/aclondon130615 4 34608 1 1 /news/crayvgree061203.html 1 0 0 0 /news/wevejustbeennowhereconsistentreallysaysfolkestoneinvictabossneilcugley 1 14295 0 0 /news/doverathletic2-3cambridgecity-hessenthalervowstobouncebackfromtrophyexit 1 16535 0 0 /news/bromley181120 2 16700 0 0 /news/darrenphillipspicksnineteenplayerstocarrythekentflagagainstrivalssussex 1 15026 0 0 /news/551bc99dbe7a4/kentleague/lordswood/othernews/30thjune03.html 2 15653 0 0 /news/horleytown1-3greenwichborough-wewillgetstrongerastheseasongoesonsayspaulblade/ 2 60542 2 1 /news/favershamtown301020 2 26861 0 0 /news/wearenowlookingtoemulatelastseasonsrunsaysramsgatebosstimdixon 1 13996 0 0 /news/bromley120318 1 12095 0 0 /news/rustfore140320 3 121533 1 2 /news/.well-known/index.php 1 0 0 0 /news/saturdaysmatchreportsinvictaexpecttolosenormantodartford 1 18612 0 0 /news/kentleague/hernebay/18thaug03.html 1 0 0 0 /news/551a9c0e85a63 3 20897 1 1 /news/jamesmarrsrelishesgillinghamreturn 1 13444 0 0 /news/maidstone290915 2 17261 0 0 /news/fordgetbehindourboysandcutoutwokingabuse 1 15163 0 0 /news/551a9798efa36 1 6965 0 0 /news/weregoodenoughtogetintotheplay-offssaysday 1 16029 0 0 /news/hydefacesaraceagainsttime-exclusive 1 11038 0 0 /news/ashford091104.html 1 0 0 0 /news/wemustliveuptoexpectationssaysburman 1 13685 0 0 /news/kentleague/deal/Sampson14.html 1 0 0 0 /news/dalersbossasksforimprovement 1 13367 0 0 /news/26thsept05.html 1 0 0 0 /news/eastgrinsteadtown121121 2 27946 0 0 /news/551a956beff28 1 2998 0 0 /news/kentleague/ramsgate/27thoct03.html 1 0 0 0 /news/metpolice291204.html 1 0 0 0 /news/551a99e3d9bf2 2 27500 0 0 /news/surreyfastatement180320 1 11260 0 0 /news/gillingham020621 1 11571 0 0 /news/imlookingforwardtogettingstartednowsaysfolkestoneinvictabossneilcugley 1 14319 0 0 /news/wp-admin/css/wp-login.php 1 0 0 0 /news/beckenhamtown0sladegreen0 2 17900 0 0 /news/dartford0-1hythetown-hopefullywecanwinmanymorethingssayshythetownbossscottporter 1 29148 0 0 /news/maidstoneunited1-0suttonunited-spotonselleykeepshiscool 1 15499 0 0 /gravesend-2003-2006/www.heineken.co.uk/ 1 3154 0 0 /news/everyseasonyouwanttoimprove-sothatssecondorfirstsaysvickersbossrickybennett 1 11907 0 0 /news/551bc99dbe7a4/drmartens/eastern/folkestone/conference/margate/margatevfarnborough250803.html 2 15653 0 0 /news/rusthall121018 1 12205 0 0 /news/wehavethebelieftoqualifyfortheplay-offssaysangelsbosswarrilow-exclusive 1 15812 0 0 /news/crowborough060418 1 12203 0 0 /news/551bc99dbe7a4/nationwide/gillingham/kentleague/deal/15thaug03.html 2 15653 0 0 /news/greenwichboroughfc.com 1 0 0 0 /news/chathamtown0-2stalbanscity-ijusthopemorelocalpeoplecomebacksayskevinwatson 2 35433 0 0 /news/losingonourbigdaywasabitterpilltoswallowadmitsburman-exclusive 1 16308 0 0 /news/greenwich080419 2 26712 0 0 /news/codyhastherawingredientsofatopstrikersaysgunn 1 14156 0 0 /news/bromleyjackholland070218 1 15519 0 0 /news/551bc99dbe7a4/drmartens/eastern/sittingbourne/drmartens/eastern/folkestone/folkvchat211003.html 2 15653 0 0 /news/erithbelvedere3-2gillingham-weveshownourloyalfanswerenotabadlittleside-ford 1 33973 0 0 /news/551bc5e0b752e 1 14277 0 0 /news/kennington120620 2 16005 0 0 /news/fleetleisure0-3suttonathletic-winningyourfirsttrophyisthehardestonesaysjamescollins 1 31246 0 0 /news/551a96db664f0 1 3428 0 0 /news/hythlanc191122 2 63395 0 0 /news/wevehadanup-and-downstartadmitsfisherbossgarylisney 1 15587 0 0 /news/vcdathletic150522 3 26999 0 0 /news/fisher5-2tonbridgeangels-itsearlydaysyetadmitsfisherbossstevefirkins 1 24445 0 0 /news/newchathambossmilesaimsformidtable 1 21660 0 0 /news/farnobg260916 2 17800 1 1 /news/551bc99dbe7a4/kentleague/thamesmead/kentleague/erithtown/erithvlords081103.html 2 15653 0 0 /news/pitchero.com/clubs/hernebay 1 0 0 0 /news/551a9c0e57486 2 20265 0 0 /news/wp-includes/xl2023.php 1 0 0 0 /news/corywillbemylastsummersigningsayscugley 1 15240 0 0 /news/drmartens/eastern/tonbridge/12thnov04.html 1 0 0 0 /news/joneswantspartisanhomesupporttocreatefacupgiantkilling 1 19551 0 0 /news/bromley040718 2 14781 0 0 /news/margatestillhitwithsuspensionstokeypersonnel 1 14051 0 0 /news/551a956c5e0d8 1 4070 0 0 /news/snodlandreeves040515 2 22144 0 0 /news/kentleague/deal/Martin1.html 1 0 0 0 /news/sceflstatement050121 1 11682 0 0 /news/stonesreleaseroyston 1 14095 0 0 /news/15thjuly03.html 1 0 0 0 /news/thurrock1-0vcdathletic-wemadeagoodnameforourselvessaysproudrickybennett 1 22528 0 0 /archive-2006-2014/71 1 20879 0 0 /news/holmesdale130815 1 13670 0 0 /news/551a99e3c88b5 1 12569 0 0 /news/wardclosetofinalisinghissquad-exclusive 1 13886 0 0 /news/sevenmaid140716 1 33685 0 0 /news/doverappointdixonasnewreserveteamboss 1 13303 0 0 /news/othernews/youthleaguetables110204.html 1 0 0 0 /archive-2006-2014/116 1 20550 0 0 /news/551a9c0e9b6e6 4 48818 0 0 /news/wp-content/plugins/hellopress/wp_mna.php 1 0 0 0 /news/whitstabletownunveilthearrivalofformersittingbournestrikerryangolding 1 13861 0 0 /news/551bc5e29f8ad 1 10830 0 0 /news/formerwellingstarappointedfavershamsnewfirstteamcoach 1 13609 0 0 /news/11thnov03.html 1 0 0 0 /news/webelieveinplayingfootballinsistskentleaguesbottomside 1 11734 0 0 /news/bromley160417 2 23356 0 0 /news/burmanlosingsleepwithredbussyndrome 2 20369 0 0 /news/millwall181023 5 55723 0 0 /news/crowborough020417 1 15183 0 0 /news/favershamtownfrustratedwithfixtureschedule 2 18439 0 0 /news/havingcraigstoneputpentopaperisgreatnewssaysebbsfleetunitedbossliamdaish 1 11858 0 0 /news/tonbridgeangels161220 1 11351 0 0 /news/wardillsupportstonesoverred-cardappeal 1 16626 0 0 /news/sittvfish120404.html 1 0 0 0 /news/25thfeb05A.html 1 0 0 0 /news/fleetvigorouslyfightforbestdealforboroboundbostwick 1 12788 0 0 /news/becksitt280123 6 191544 0 0 /news/551a967870bc6 2 16326 0 0 /news/hytheast180818 3 69313 0 0 /news/baldacchinoreturnstoerithbelvedere-exclusive 1 13026 0 0 /news/iwanttoachivebigthingsatmaidstoneunitedsaysgoalkeeperleeworgan 1 13254 0 0 /news/551a967861f48 2 24869 0 0 /news/TheFAStatement060420 3 30639 0 0 /news/erithtownhavetowintostayinthetitleracesayscorinthianbossmattlonghurst 1 16651 0 0 /news/kentleague/tunbridgewells/ramsgate301004.html 2 0 0 0 /news/ramsgate210319 2 27221 0 0 /news/wearelookingtoprogressupthedivisionssaysfavershamstrikeforcebossjohngoodwin 1 17821 0 0 /news/551a979821640 1 3884 0 0 /news/brentwoodtown250720 3 28587 0 0 /news/sittingbourne080920 3 30340 0 0 /news/tonyrussellquitserithtownafterleadingdockerstokentleaguesummit 1 13088 0 0 /news/bromley161017 1 14040 0 0 /news/ourfansbehaviourtowardssuttonmanagerwastotallyunacceptable-saystonbridgesecretary 1 19768 0 0 /news/kentleague/beckenham/erithtown191004.html 1 0 0 0 /news/plaayacupfinal04.html 1 0 0 0 /news/folktoot160917 2 61743 0 0 /news/wellingtown031021 1 14573 0 0 /news/vcdathletic0-2erithtown-itwasnotprettybutwegotthejobdoneadmitstonyrussell 1 19278 0 0 /news/NationalLeague141120 2 21448 0 1 /news/dealbosshareswaitsforholmesdalepointsdecision 1 19959 0 0 /news/weneedtobouncebackquicklysayscrayvalleybossstevechapman 1 15315 0 0 /news/oliverashclosetotakingovermaidstoneunited 1 12455 0 0 /news/unbeatenchatsexpectstonesreaction-exclusiveinterviews 1 15935 0 0 /news/werefinallymovingbacktowherewebelongsaysfisherjoint-managerbillywalton 1 16474 0 0 /news/fourwinswillkeepusupsaysbromleycoachneilsmith 1 13886 0 0 /news/crownalexndrapulloutofkentinvictaleague 1 14124 0 0 /news/eastthurrock010105.html 1 0 0 0 /news/clubsshouldgivereserveplayersmoreofachancesaysfree-agentheywood-exclusive 1 18379 0 0 /news/551bc5e488e67 1 17145 0 0 /news/dartford3-2ashfordtownmiddlesex-werebetterthanthatinsistsburman 1 21660 0 0 /news/dartfordsaviouracceptsboardinvite 1 13425 0 0 /news/551a967770be4 2 20748 0 0 /news/KLvsitt210204.html 1 0 0 0 /drmartens/eastern/tonbridge/10thjan05.html 1 9955 0 0 /news/burmanshowsstar-strikercassthedoor 1 18950 0 0 /news/improudofourteamperformancesayswellsskipperjasonbourne 1 20755 0 0 /news/ashfordunveilseasonticketprices 2 14733 0 0 /news/drmartens/eastern/tonbridge/5thdec03.html 1 0 0 0 /news/551bc5e4b696b 1 12051 0 0 /news/conferenceleagueunveilnewsponsor 1 11155 0 0 /news/551bc5dd21f3d 1 12223 0 0 /news/tunbridgewells051121 1 11588 0 0 /news/floodlightingdelaysareholdingusbacksaysholmesdalesecretary-exclusiveinterview 1 16195 0 0 /news/holmholl240718 1 31443 0 0 /news/drmartens/eastern/folkestone/27thaug04.html 1 0 0 0 /news/551a931e5173e 1 11047 0 0 /news/greenwichboroughunveiljohncumberbatchastheirjoint-manager-hugolangtonjoinshorsham 1 16065 0 0 /news/551bc99e10c89 2 18167 0 0 /news/beckenham200117 1 12751 0 0 /news/soccershorts040316 2 75326 0 0 /news/551a956ce6657 1 7760 0 0 /news/canterbury020817 1 13395 0 0 /news/gillingham060121 1 11635 0 0 /news/idliketotakeerithtownuptotherymanleaguesaysmarktompkins 1 15074 0 0 /news/wearesorrytobelosingjameseverittsaysfolkestoneinvictachairmanmarkjenner 1 12369 0 0 /news/phoelord290719 2 65623 0 0 /news/headcoachdepartstunbridgewells 1 10680 0 0 /news/margate020618 2 28197 0 0 /news/charltonathletic3-0miltonkeynesdons-wewerentplayingatourbestadmitsstuartweston 2 31783 0 0 /news/wehavenothingtolosesotheresnopressureonussaysashfordunitedcoachjohnovard 1 16587 0 0 /news/doverathletic0-2hastingsunited-doverchairmanpromisesachangeofstructureatcrabble 1 17724 0 0 /news/crowrust070917 1 35700 0 0 /news/thiswillturnouttobethetoughestseasonyetwarnsmunday 1 17592 0 0 /news/favershamtown1-2dulwichhamlet-werenotgettingthebreaksadmitsjustinluchford 1 20047 0 0 /news/hythetown6-2beckenhamtown-hythearehalfwaytoparadisesaystommysampson 1 26709 0 0 /news/wardputsoutanappealtofindwingersforfacupclash-exclusive 1 14811 0 0 /news/wewillputonashowaswealwaysdosayssheppeyunitedbosskevinhake 1 12206 0 0 /news/chipstead180517 2 17610 0 0 /news/soccershortsmanagerstakestockoftheirearlypre-seasonfriendlies 1 15267 0 0 /news/551bc99d8fd07 2 25409 0 0 /news/thamesmeadtown4-5cheshunt-mcmahonslamsamateurishdefending 1 21529 0 0 /news/aveley230405.html 1 0 0 0 /news/551bc5e664538 1 17951 0 0 /news/fisher1-2beckenhamtown-wehaveaplayertodiefor-insistspowell 1 28106 0 0 /news/551bc5da2a7aa 4 34522 0 0 /news/englandcall-upsfrustratescotton 1 12027 0 0 /news/tonbridge210417 2 27085 0 0 /news/ifeltfordealleakingtenaswevebeeninthatpositionbeforesayscorinthianbosstonysitford 1 17084 0 0 /news/wp-content/plugins/formcraft/file-upload/server/php/files/abruzi.php4 1 0 0 0 /news/31stjuly04.html 1 0 0 0 /news/sevenoakstownbosskeithlevettgunningfortophalffinish 1 15817 0 0 /news/pottersbartown4sittingbourne4includestodaysresults 1 19979 0 0 /news/bromcharl260116 3 45687 1 1 /news/24thjune03.html 2 0 0 0 /news/27thnov05.html 1 0 0 0 /news/chathamannouncepresentationnightdetails 2 13117 0 0 /news/ksports080917 1 12035 0 0 /news/snodlandtown070520 1 15333 0 0 /news/punjab250920 4 57642 0 0 /news/wellstal231119 1 26155 0 0 /news/551a99e3e41b0 2 29766 0 0 /news/tunwellsbeck101019 1 14143 0 0 /news/croydonchairmandontturnyourbackontheclubforengland-exclusive 1 14584 0 0 /news/bromley270519 2 16322 0 0 /news/macdonaldsignstwo-yeardealforsouthendunited 1 11150 0 0 /news/kentleague/maidstone/15thaug03.html 1 0 0 0 /news/sheppeyunited250222 1 13145 0 0 /news/welltakewhitstableallthewayinsiststramschief-exclusiveinterviews 1 16256 0 0 /news/ramscapturelondonerwaugh-exclusiveinterview 1 15933 0 0 /news/robertssuffersinjuryblow-exclusiveinterview 1 14564 0 0 /news/fisher1-4bridonropes-ithinkitsaveryspecialnightfortheclubsaysproudbenkotey 1 29820 0 0 /news/551a97b0e57be 2 34194 0 0 /news/lovellwantstrophytiessettledontheday-exclusiveinterview 1 13756 0 0 /news/fleetreturntotheirbreadandbutter 1 15716 0 0 /news/fixturelist 1 19008 0 0 /archive-2006-2014/220 1 19348 0 0 /news/harlowfat091004.html 1 0 0 0 /news/phoewhit181017 2 55452 0 0 /news/werestillquiteconfidentwecaninstallartificialpitchsayssevenoakstownbosspaullansdale 1 16589 0 0 /news/551bc5dd8a115 2 19966 0 0 /news/551a9677c8b9f 2 14796 0 0 /news/551bc99e33bc1 2 24260 0 0 /news/17thmay05.html 1 0 0 0 /drmartens/eastern/dartford/cray040805.html 1 9955 0 0 /news/551a96dc9cdb2 2 19252 0 0 /news/wedidnotachievewhatwesetouttodolastaugustadmitsporter 1 13178 0 0 /news/whenwerebackhomeitwillbeabigfishsaysfisherbossbillywalton 1 14752 0 0 /news/lordswood010916 1 11773 0 0 /news/15thaug05.html 1 0 0 0 /news/werenotsettingintothelionsdenitsnotlikethatinguernseysaysderesbossmickycollins 1 16717 0 0 /news/tonbridgeangels1-1hayesyeadingunited-wemustnotlosetosidesaroundussayswarrilow 1 24267 0 0 /news/ashfordtown0-1sittingbourne-weenjoyplayingawayfromhomesaysbrady 1 17683 0 0 /news/kingstonian3-2craywanderers-imdisapointedtogooutsaysianjenkins 1 26337 0 0 /news/craywands090218 3 31369 0 0 /news/551bc5e377227 1 15322 0 0 /news/favershamrelishinggillsvisit 1 15112 0 0 /news/onhisdayloickpiresisamatch-winnersayswellingunitedbossjamieday 1 11603 0 0 /news/rochstan230322 3 85383 1 1 /news/551bc99dbe7a4/kentleague/sladegreen/drmartens/eastern/ashford/21stoct03.html 2 15653 0 0 /news/551bc5da72e95 4 42042 1 0 /news/551bc5e557690 2 34242 0 0 /news/chatswillspoilsomeonesparty-obrienpledges 1 14893 0 0 /news/wedliketowinsomesilverwaresayscrayvalleybossstevechapman 1 15986 0 0 /news/18thmar05.html 1 0 0 0 /news/551bc99dbe7a4/kentleague/thamesmead/drmartens/eastern/ashford/30thDec2003.html 2 15653 0 0 /news/humelookstogetdefeatoutofhissystem 1 20098 0 0 /news/lovellgivessquadmembersachancetoimpress-exclusive 1 14506 0 0 /news/fleetstagefansforum 1 12386 0 0 /news/bromleyontheorientwereallhungrytosucceedsaysbromleyskippertutuhenriques 1 17723 0 0 /news/tonbridge290916 2 23640 0 0 /news/drmartens/eastern/sittingbourne/leightonfat091004.html 1 0 0 0 /news/ebbsfleetunited3-1ramsgate-wevegotsomegoodtalentcomingthroughsayskimble 1 21403 0 0 /news/imgoingtobeverydisappointedifbromleyarenotinthefirstroundproperofthefacup-bird 1 20646 0 0 /news/boredart191217 1 28186 0 0 /news/sporkent261118 1 37097 0 0 /news/hythe261105.html 1 0 0 0 /news/sevenoakstown2-4folkestoneinvicta 1 15966 0 0 /news/cugleyhailstheirbestperformanceoftheseason 1 16663 0 0 /news/doverapproachdartsforqualitystrikercass 1 11131 0 0 /news/wellmarg010117 1 32213 0 0 /news/stonessettomakebigannouncement 1 10962 0 0 /news/ashfordarrangespecialbenefitmatchforcunningham 1 15815 0 0 /news/longhurstcontinuestorebuildhissladegreensquad 1 13633 0 0 /news/551bc5e70eedd 1 16255 0 0 /news/itsaboutmakingdayslikethisspecialsaystunbridgewellsbossmartinlarkin 1 16053 0 0 /news/dulwichhamlet310121 1 15333 0 0 /news/folkestone230916 2 30254 0 0 /news/craywanderers0-1lewes-wellgetintotheplay-offsifwewinallthreesaysianjenkins 1 23103 0 0 /news/margatesignhockton 2 12792 0 0 /news/imreallypleasedtohaveprestonedwardsbackwithmesaysfleetbossliamdaish 1 12160 0 0 /news/goingfull-timecanbedone-butnotattheexpenseofbringingtheclubdownsaystonyburman 1 16837 0 0 /news/ouraimhastobesafetysayshume 1 18920 0 0 /news/kentleague/ramsgate/7thjuly03.html 1 0 0 0 /news/foleylearnsfromopeningdaydefeat 1 18298 0 0 /news/maidstoneunited2-0tootingmitchamunited-itwasimportanttobounceback-hume 1 16630 0 0 /news/bromley090621 2 18257 0 0 /news/wehadfourorfiveplayersthatididntthinkwanteditenoughadmitskeithmcmahon 1 13499 0 0 /news/youcantwinthekentleaguebyplayingbarcelonatypefootballsaysvcdbossrickybennett 1 15958 0 0 /news/borehamwood2sittingbourne0 2 20847 0 0 /news/soccershortstonbridgeangelsbidforhornetsleadingscorer 1 18441 0 0 /news/idontwantthesejekyllandhydeperformancessayswhitstabletownbossnickysouthall 1 14053 0 0 /news/serverproblems 1 9961 0 0 /news/ashfordunitedrelaunchplanstobuildanexcitingsportsvillageathomelands 2 19583 0 0 /news/princesparkhasliveduptoourexpectations-exclusive 1 15096 0 0 /news/29thsept05.html 1 0 0 0 /news/551bc99dbe7a4/drmartens/eastern/dartford/kentleague/sladegreen/17thjuly03.html 2 15653 0 0 /news/chathamtown0-1worthing-wecouldnthavegivenanymoreintermsofeffortsayskevinwatson 1 17773 0 0 /news/billericaytown1-1tonbridgeangels-warrilowruesleggesthirdredcard 1 17614 0 0 /news/bromvgraysfr090803.html 1 0 0 0 /news/wellingunitedappointjamieturnerandjakegallagherasjoint-caretakermanagers 1 13272 0 0 /news/20thdec03.html 1 0 0 0 /news/kentcounty/thamespoly20thjuly03.html 1 0 0 0 /news/dealtownbossderekharesexpectstightfacupclashagainstrivalshythe 1 20491 0 0 /news/chathamtown1uxbridge2 2 16913 0 0 /news/beck191115 1 12535 0 0 /news/551bc99dbe7a4/kentleague/greenwich/drmartens/eastern/chatham/8thdec03.html 2 15653 0 0 /news/erith131104.html 1 0 0 0 /news/crayburg230920 6 134072 0 0 /news/resultsaugsept2017A 2 151507 0 0 /news/kentleague/ramsgate/ramsvlords270903.html 1 0 0 0 /news/othernews/gotravelkentleaguetablesfinal2004.html 1 0 0 0 /archive-2006-2014/181 1 19111 0 0 /news/551a99e445f0b 1 11048 0 0 /news/bromley2-1bishopsstortford-chelmsfordwillbeourbiggesttestsofaradmitshaydenbird 1 35554 0 0 /news/bromley0-0havantwaterlooville-oneofthesedaysitsallgoingtocometogether-goldberg 1 22355 0 0 /news/bromleybossmarkgoldbergbringsintriotoaidsurvivalbid 1 12910 0 0 /news/weneedyoursupportatbourneparksaysstoneschairman 1 13497 0 0 /news/gillsratcliffe040615 4 37536 2 2 /news/ourfocusistobuildateamtogetpromotionsaysmargatechairmanboblaslett 2 24621 0 0 /news/anyteamthatwantstobattlewellbeupforitsaysthamesmeadtownbosskeithmcmahon 2 19301 0 0 /news/551a9b4831f95 4 29095 0 0 /news/holmesdale160717 1 13561 0 0 /news/hythe230916 2 25162 0 0 /news/551bc99dbe7a4/kentleague/thamesmead/nationwide/gillingham/3rdjuly03.html 2 15653 0 0 /news/551a99e3a79b2 1 13784 0 0 /news/holdersebbsfleetfaceoystermentest 1 10936 0 0 /news/551a96773a089 2 27554 0 0 /news/itsourmostimportantgameforawhilesaysfolkestoneinvictabossneilcugley 1 16084 0 0 /news/wecanbringthetrophybacktohayeslanesaysbromleybosshaydenbird 1 14260 0 0 /news/kentleagueclubsstruggletomakeendsmeetsayslarkin 1 22123 0 0 /news/551a931da303f 2 28730 0 0 /news/551a9250f260d/24thfeb05.html 2 6643 0 0 /news/lordswood3-0southendmanor-everyoneisbuzzingaroundtheplacesaysjasonlillis 1 16732 0 0 /news/lyddtowndeservetobeastepsixclubsaysmanagerdavejohncock 1 15007 0 0 /news/551a99e3cdc5f 2 26782 0 0 /news/merstham220523 4 32159 0 0 /news/wedontwanttobeinthekentleagueforeversaystunbridgewellschairmanjoecroker 1 18734 0 0 /news/skippersaunderscontentwithstarttohisseason 1 16090 0 0 /archive-2006-2014/33 2 25998 0 0 /news/cugleyreleasescontractedstrikerasthingsareabittightatfolkestone 1 13403 0 0 /news/551a9677e9d30 2 19271 0 0 /news/sheppeyunited280721 1 13671 0 0 /news/lewishamboroughtryingtoprogress 1 13005 0 0 /news/bridtunb150122 5 150710 0 0 /news/551a92505bffc 1 3489 0 0 /news/wp-p.php7 1 0 0 0 /news/551bc5e057262 1 19704 0 0 /news/551bc5e1347da 1 16624 0 0 /news/551a97983df76 1 3185 0 0 /news/551bc5e5cf2ff 1 12576 0 0 /news/pattersonaimingforlengthytrophyrun 1 16558 0 0 /news/SportEngland140520 3 34029 0 0 /news/sittvburn081103.html 1 0 0 0 /news/welltrytomakebourneparkourfortresssaysmiltonfulstonbossaaronperry 1 15106 0 0 /news/craywands261118 3 26227 0 0 /news/mileoak291005.html 1 0 0 0 /news/illscoregoalsintherymanleagueinsists42-goaltakaloo-exclusiveinterview 1 20206 0 0 /news/551bc99baebba 1 3555 0 0 /news/551a956baf59c 1 3457 0 0 /news/stainestown2-1ramsgate-wardfuryovercostlypenaltydecision 1 20652 0 0 /news/halstead200617 1 11296 0 0 /archive-2006-2014/29 2 25978 0 0 /news/breakingnewsfacupfirstrounddraw 1 10290 0 0 /news/haringeyborough201019 2 39440 0 0 /news/nationwide/gillingham/25thjuly03.html 1 0 0 0 /news/18thapr05.html 1 0 0 0 /news/princesparkspecialwinningwastheicingonthecake-exclusiveinterviews 1 16749 0 0 /news/31stoct05.html 1 0 0 0 /news/kentleague/tunbridgewells/whitstable140804.html 1 0 0 0 /news/sevenoaks031205.html 1 0 0 0 /news/walkerofferednewcontract 1 11573 0 0 /news/othernews/bearsted251104.html 1 0 0 0 /news/tramswillrunsmoothywhilstchairmanrecovers 1 12001 0 0 /news/11thdec03.html 1 0 0 0 /news/wellingunited020719 2 16227 0 0 /news/othernews/cafcladies30thdec03.html 1 0 0 0 /news/rusthall1-3sevenoakstown-itwasagooddayforussayssevenoakstownbosssimonjones 1 23896 0 0 /news/soccershortsexspurscoachjoinssevenoaks 1 23170 0 0 /news/sittingbourne2-0folkestoneinvicta-therewasnoneedforaustinsbadtacklefumesabbott 1 35889 0 0 /news/gillingham210519A 2 29785 0 0 /news/mcmahonrelisheskentvasederby-exclusive 1 13724 0 0 /news/trottcontemplatessteppingdownfromplaying 1 11919 0 0 /news/croydon270219 1 11587 0 0 /news/ryman/bromley/26thoct03.html 1 0 0 0 /news/tomparkinsonfacesmake-or-breakfortnight 1 15910 0 0 /news/sevenoaks310716 1 12992 0 0 /news/whitesanddartsfansreceivepraise 1 14302 0 0 /news/facarlsbergvasethirdrounddraw-wewanttoreachthenationalstagesayswellsbosslarkin 1 16647 0 0 /news/551bc99dbe7a4/kentleague/hernebay/othernews/22nddec03.html 2 15653 0 0 /news/tunbridgewells0-0crayvalley-wecannowfullyconcentrateonwembleysaysmartinlarkin 1 27042 0 0 /news/551a931e5d7d8 2 32336 0 0 /news/hythetown151121 3 31289 0 0 /news/ashford050718 3 29552 0 0 /maidstone-2003-2006 14 173721 1 0 /news/551bc5dce8825 1 12657 0 0 /news/bromley170120 2 22322 0 0 /news/wearelookingtoemulatewhatcorinthianhavedonesaysholmesdalebossfabiorossi 1 16870 0 0 /news/seatsinstalledatnorthfleetend 2 15623 0 0 /news/favershampulloffwalkercoup 1 13633 0 0 /news/sevenoaks240717 1 20262 0 0 /news/erithandbelvedere301020 1 13396 0 0 /news/drmartens/cupdraw.html 1 0 0 0 /archive-2006-2014/271 2 23434 0 0 /news/bromleytitlewaldren190415 2 20878 0 0 /news/hesshashighhopesfornewsigningbrowning 1 12848 0 0 /news/maidstoneunited0-3hendon-wefaceahellofachallengesayscaretakernott 1 20490 0 0 /news/551bc99a5e1c7 1 14440 0 0 /archive-2006-2014/159 1 19181 0 0 /news/fatrophyspecialthepressuresallonhorshamsayslong-servingmorris 1 17325 0 0 /news/burmanfacesaraceagainsttimetoattendfacuptie-exclusiveinterviews 1 16377 0 0 /news/25thsept03.html 1 0 0 0 /news/lewishamboroughunveilbillypiperastheirnewmanager 1 13023 0 0 /news/peckham241116 1 13003 0 0 /news/kentleague/cray/crayvhoddlsc011003.html 1 0 0 0 /news/551bc5db09e5f 4 44714 0 0 /dartford-2003-2006/5 3 27291 0 0 /news/551a9799bf839 1 4370 0 0 /news/holmesdale190719 1 14564 0 0 /news/dockerhashighhopesfortwo-goalherowest 1 14735 0 0 /news/dartford3-0tonbridgeangels-wevelosttothebetterteamtodayadmitstommywarrilow 1 20052 0 0 /news/dontexpecttoseeanyfamiliarfacesatfavershamsaysdoverathleticbossmartinhayes 1 13796 0 0 /news/canterbury311218 1 12620 0 0 /news/551a931e2db07 1 11643 0 0 /archive-2006-2014/161 1 18781 0 0 /news/dealtownsearchforfriendlyonsaturday 1 10945 0 0 /news/551bc99dbe7a4/kentcounty/drmartens/eastern/ashford/4thaug03.html 2 15653 0 0 /news/weshouldbefightingforaplay-offplacesayshythetownbosstimdixon 1 14287 0 0 /news/551a931e23706 1 10973 0 0 /news/phoenix010516 2 27965 0 0 /news/15thnov05A.html 1 0 0 0 /news/dontgetintoyourcarwithanyregretssaystonbridgeangelsassistantalexobrien 1 15877 0 0 /news/sevenoakstown3-1otfordunited-wedidntdoourselvesjusticeadmitssevenoaksbossanslow 1 22905 0 0 /news/551bc5e2c5076 2 14628 1 1 /news/551bc5e011d98 1 15581 0 0 /news/margate160317 2 14970 0 0 /news/improudofmyachievementssofarsayscraystalwartwood 1 17805 0 0 /news/margate150416 2 25837 0 0 /news/9thsept04.html 1 0 0 0 /news/sittingbourne0-1merstham-imalwaysconcernedaboutourhomerecordadmitsbrady 1 15789 0 0 /news/doverathleticstartplanningtheirclimbuptheleagues 1 17032 0 0 /news/maidstoneunitedappointjackparkinsonastheirunder21manager 1 12996 0 0 /news/kentleague/deal/Sampson9A.html 1 0 0 0 /news/551bc5df5c76f 1 14185 0 0 /news/sittingbourne1-2hythetown-wereshowingsignsthatwecanturnitaroundsaysbradleyspice 1 18163 0 0 /news/database.php 1 0 0 0 /news/dulwich050218 2 23173 0 0 /news/martinhayesgiveseighttrialistsachancetoimpressagainstcolchester 2 28613 0 1 /news/551bc99b2fa27 2 32178 0 0 /news/ashfordunited1-2hanwelltown-theleagueisourmainprioritynowsaysjohnovard 2 37071 0 0 /news/manformanwerebetterthanashfordinsistswalker 1 13891 0 0 /news/conference/margate/29thnov03.html 1 0 0 0 /news/551a95b3f2fed 4 37612 0 0 /news/ourfocuswillbeonsundayagainstbrightonsaysgillscoachjackwheeler 1 15133 0 0 /news/hernrams280823 2 68888 0 0 /news/551a95b3a1a49 2 23017 0 0 /news/welling241116 1 14056 0 0 /news/NationalLeagueStatement181020 2 17706 0 0 /news/drmartens/premier/dover/25thsept04.html 1 0 0 0 /news/snodbrid110817 1 13320 0 0 /news/551bc5e722fe4 1 15905 0 0 /news/allchangeatsladegreen 1 11520 0 0 /news/551bc5e2c9c65 1 10883 0 0 /news/ebbsfleetunitedunveiltheirnewmanagementteam 1 13252 0 0 /news/551bc5dec2f32 1 13650 0 0 /news/551a97993af77 1 5694 0 0 /news/iwantnastyplayerstomakeramsgateafortressagainsaysward 1 19721 0 0 /news/isthmianleaguestatement150621 3 34795 0 0 /news/taitisdesperatetoshowhisfullpotentialsaysburman 1 20320 0 0 /news/margate041220 2 25837 0 0 /news/idontwantanotherseasonlikethisonesayslewishamboroughchairmanraysimpson 1 24401 0 0 /news/551bc99dbe7a4/drmartens/eastern/sittingbourne/kentleague/lordswood/lordvseve061203.html 2 15653 0 0 /news/managerslockdownviews011120 3 36535 0 0 /news/drmartens/eastern/folkestone/havantvfolkfat291103.html 1 0 0 0 /news/trophydrawunkindtokentsremainingtwo 1 11493 0 0 /news/afcwimbledon1margate2 2 26424 0 0 /news/chathamtownappointpeterhawkinsastheirnewassistantmanager 2 18692 0 0 /news/17thfeb05.html 1 0 0 0 /news/hollands&blair130221 1 12556 0 0 /news/hythetown030220 2 28268 0 0 /news/craystagebenefitmatchfornon-leaguelegend 1 14175 0 0 /news/mattleereleasedbywings 1 10635 0 0 /news/hopefullywecangetafewmorepeoplethroughthegatesaysmattlonghurst 1 14421 0 0 /news/551bc99dbe7a4/kentleague/sevenoaks/ryman/bromley/wortvbrom081103.html 2 15653 0 0 /news/rustelms180217 1 35119 0 0 /news/26thjan05.html 1 0 0 0 /news/thefacarlsbergvasefourthrounddraw 1 10400 0 0 /news/epsomgrav070816 2 39107 0 0 /news/551a95b401621 3 36455 0 0 /news/stayingfitwillmakeabigdifferencesayscugley 1 18003 0 0 /news/sittingbourne251215 3 34521 0 0 /news/theresnothingtobenegativeaboutsayshume 1 18363 0 0 /news/peckham280417 1 12354 0 0 /kentleague-2003-2006/ 1 2708 0 0 /news/whitstable230216 2 26887 0 0 /news/craywanderers3-0whitstabletown-sayerhaslethimselfdownsaysmunday 1 37157 0 0 /news/rustdeal180418 1 31471 0 0 /news/551bc99c45ee5 2 29633 0 0 /news/iwillhelpbenjudgeinanywaypossibletogethimamovehedeservessaystommywarrilow 1 15134 0 0 /news/canterburycity291222 1 12348 0 0 /news/faversham040520 2 23383 0 0 /news/eritpeac110819 1 26166 0 0 /news/admin.php 1 0 0 0 /news/theweatherhashitushardsaysconcernedstoneschairman 1 17681 0 0 /news/youdontneedmoneytoproducegoodplayerssayswhitstablechairman 1 14722 0 0 /news/thechairmanbacksus100witheverythingsaysgreenwichboroughbossianjenkins 1 18434 0 0 /news/rusthall281015 1 12176 0 0 /news/kentcountyleague300616 1 13924 0 0 /news/strikermovementsinnorthkent 1 14185 0 0 /news/551a97b059c5c 1 12701 0 0 /news/tonbridgeangels140720 1 17207 0 0 /news/thebigkickoffwereprapredforlifeintherymanpremiersayshume-exclusive 1 13198 0 0 /news/wellgotoawkwardtootingtryingtowinthegamesaysfavershamtownbossrayturner 1 12522 0 0 /news/maidstone010720 1 11394 0 0 /news/551bc5de473b1 1 12258 0 0 /news/gravesendnorthfleetappointnewchairman 1 12181 0 0 /news/shepbill171023 5 177705 0 0 /news/erithandbelvedere270820 1 14324 0 0 /news/doverathletic3-0kingstonian-wemusttakeadvantageofourgamesinhandsayswallis 1 13640 0 0 /news/larkfield251119 1 13230 0 0 /news/haywrams150222 5 141775 0 0 /news/beckrust210918 1 32864 0 0 /news/beckenham201218 1 13365 0 0 /news/sittingbourne1-2wealdstone-mysidegivingbadgoalsawayisunheardoff-abbott 1 22052 0 0 /news/sheppeyunited030921 1 12946 0 0 /news/maidstoneunited1beckenhamtown1-humeexpectmoretwistsandturns 1 16539 0 0 /news/craywanderers220221 3 29159 0 0 /tier-football/2 2 22183 0 0 /news/sladegreengivengo-aheadtoerectnewstand 1 12268 0 0 /news/claptonorientladies1gravesendnorthfleetladies2 2 19036 0 0 /news/wp-includes/wp-22.php 1 0 0 0 /news/ivegoteverythingthatiparticularlywantheresaysgreenwichboroughbossgerrycox 1 14068 0 0 /news/seagerwantsabiggerbudgettomatchhisplay-offaspirationsnextterm-exclusive 1 15746 0 0 /news/crayval160317 1 13953 0 0 /news/551bc99bf3551 2 22332 0 0 /news/dannyhuntwilldoafantasticjobforlilywhitessaysfirkins 1 22090 0 0 /news/kentleague/sladegreen/sladevseven090304.html 1 0 0 0 /news/doverathletic050521 1 11857 0 0 /news/6thmay05.html 1 0 0 0 /news/congratulationsdartfordfootballclubrymanleaguedivisiononenorthchampions 1 10642 0 0 /news/thereisdefinitelynodivisioninthesquadsaysdoverassistantpauljoynes 1 18988 0 0 /news/19thapr05A.html 1 0 0 0 /news/thamesmeadtown1-2sittingbourne-iwanttowintheleagueonthesmallestbudgetsaysmattwyatt 1 27002 0 0 /news/advertisewithawinningteam 2 13232 0 0 /news/beckenhamtown0-2hythetown-cooksgoalwasoffsideadmitsluckyhythetownbossscottporter 1 36249 0 0 /news/sportingbengal0-1vcdathletic-weturnedupwiththewrongmentalityadmitsrickybennett 1 27733 0 0 /news/ireallyreallytrulybelieveweregoingtostayupsaysmikepaye 1 18781 0 0 /news/hollands010916 1 11979 0 0 /news/23rdoct03.html 1 0 0 0 /news/turnersettosigndealtostaywithramsgate 1 12726 0 0 /news/facupthirdqualifyingrounddrawdoverathleticfacebromley 1 11525 0 0 /news/ramsgate030519 2 26409 0 0 /news/afccroydonathletic070918 1 12293 0 0 /news/hillsborough260416 2 28163 0 0 /news/erithandbelvedere010621 1 12510 0 0 /news/drmartens/premier/dover/29thoct04.html 1 0 0 0 /news/wearefullyfocusedtoachieveplay-offplaceinsistsdartsbossburman 1 15573 0 0 /news/551bc5dbabaf6 4 49211 1 0 /news/551bc5de37421 1 17091 0 0 /news/holmesdalefernandes280715 1 12313 0 0 /news/formerbromleymanagementpairbackinfootball 1 12810 0 0 /news/wellingunited5-2billericaytown-youdontwintrophiesinnovembersaysjamieday 1 22769 0 0 /news/wp-admin/images/xmrlpc.php 1 0 0 0 /news/situationsvacant 2 12687 0 0 /news/millwall210517 3 29005 0 0 /news/551bc5e45511b 1 12070 0 0 /news/grimsbytown3-0dartford-wevegotamountaintoclimbadmitstonyburman 1 26420 0 0 /news/pitchero.com/clubs/afccroydonathletic 1 0 0 0 /news/tunbridgewellsformlimitedcompany 1 12277 0 0 /news/craywands180118 3 29696 0 0 /news/stadiumblowforebbsfleetunited 1 15557 0 0 /news/ChatvSitt010104a.html 1 0 0 0 /news/smallingneedstofulfilhisexpectationssayspearce 1 12724 0 0 /kent-invicta-league/17 2 24680 0 0 /news/551bc99dbe7a4/kentleague/maidstone/othernews/30thjune03.html 2 15653 0 0 /news/angelschairmantargets24morepointsandruninfacup 1 13199 0 0 /news/wevecomeonleapsandboundsduringmysixyearsincharge-suttonathleticbossguyeldridge 1 14702 0 0 /news/hernebay0-1flackwellheathaet-weshowedwhatwerecapableofsayshalsey 1 33325 0 0 /archive-2006-2014/230 1 18988 0 0 /news/glebe050821 1 11741 0 0 /news/ithinkwevegotenoughinourlockertogetaresultathanworthvillasayssimonhalsey 1 15295 0 0 /news/beckenham060418 1 12296 0 0 /news/enfieldtown1-0craywanderers-weredoingallwecantotryandstayupvowskeithbird 1 27540 0 0 /news/wedonthavetherightinfrastructureinplaceforrymanfootballsayssevenoakschief-exclusive 1 17851 0 0 /news/iwanttokeepthewinningmenalitygoingsayshernebaybosssimonhalsey 1 15972 0 0 /isthmian-league/33 3 46061 0 0 /news/551bc5e657eb0 1 12904 0 0 /news/ofcoursewecanclosethegaponrunawayleadersfavershaminsistshalsey 1 14904 0 0 /news/kentleague/thamesmead/20thjuly03.html 2 0 0 0 /news/burmanaddsleaderburgesstohissquad 1 14269 0 0 /news/phoenixsports310119 2 27124 0 0 /news/greenwich220917 2 24003 0 0 /news/551a931e6eb02 1 10591 0 0 /news/13thoct03.html 1 0 0 0 /news/551bc99dbe7a4/drmartens/eastern/dartford/kentleague/maidstone/30thdecember2003.html 2 15653 0 0 /news/bromley040216 2 20956 0 0 /news/stayingtopisthehardestpartadmitsfrost-exclusive 1 15934 0 0 /news/westwickhamplotanothertrophyupset 1 12344 0 0 /news/myexpectationsaretodothebestwecanandwinasmanygamesaswecansayssimonhalsey 1 15704 0 0 /news/drmartens/eastern/tonbridge/3rdoct04.html 1 0 0 0 /archive-2006-2014/91 1 20561 0 0 /news/boroughsettounveilnewsignings 1 10974 0 0 /news/kennington300819 1 12479 0 0 /news/bromley270720 2 15155 0 0 /news/551bc5db9539d 3 34030 0 0 /news/6thjuly05.html 1 0 0 0 /news/leatherhead170804.html 1 0 0 0 /assets/images/ 1 7489 0 0 /news/greenwichexpectmooreastheytargettopsix-exclusiveinterview 1 16058 0 0 /news/holmesdale311218 1 10994 0 0 /news/551bc99ce347d 2 19320 0 0 /news/sevenoaks291005.html 1 0 0 0 /news/cantcray230319 3 58547 1 1 /news/ashfordtown0-1metropolitanpolice-weveachanceofcatchingthesidesaboveussayslovell 1 15719 0 0 /news/FAStatement101120 3 31014 0 0 /news/kentleague/greenwich/12thsept04.html 1 0 0 0 /news/weneedmorestrengthindepthsayswalker 1 13105 0 0 /news/weveunderachievedthisseasonadmitscory 1 14650 0 0 /news/Margatebrownpos110515 3 44092 0 0 /news/wewanttoaspiretogetlikedartfordbutweneedmorefanssaystonbridgebosstommywarrilow 1 16780 0 0 /news/mundaythreatenstheaxeashetargetstwonewplayers 1 19830 0 0 /news/pressrelease 1 14075 0 0 /news/551bc5e1ae7d6 2 19082 0 0 /news/551a979a483b8 1 5151 0 0 /news/fleetwoodtownunveilbarryfergusonloansigningaheadofbromleyfacuptie 1 16209 0 0 /archive-2006-2014/32 2 25800 0 0 /news/crayhyth261021 6 177377 0 0 /news/drmartens/eastern/ashford/9thnov03.html 1 0 0 0 /news/margdulw140515 3 72141 0 1 /news/tongrays110217 2 63710 0 0 /news/haworthturnsdownlucrativeoffertostaywithdarts 1 13126 0 0 /news/ashfordtownp-pwaltoncasuals 1 11548 0 0 /news/tingley030504.html 1 0 0 0 /news/afccroydonathletic170920 1 12621 0 0 /news/fewellwantstoreachsurvivalearlierthannormal 1 18601 0 0 /news/eritbeck150920 1 34879 0 0 /news/weveprobablygotthebestteamspiritclaimserithbelvederebosschriscosgrove 1 15796 0 0 /news/favershamtown310521 2 23739 0 0 /archive-2006-2014/114 1 20084 0 0 /news/TheNationalLeagueStatement021020 2 14184 0 0 /news/stanrust141123 6 67796 1 1 /news/threeplacesareupforgrabsinmyopeningdayteamrevealsward 1 16705 0 0 /news/glebe220621 4 67034 0 0 /news/harlowtown1sittingbourne0sat29thapril2006 2 20854 0 0 /news/bromley191018 2 22264 0 0 /news/wemighthaveabetterchanceoffinishinginthetophalfsaysfisherbossbillywalton 1 14644 0 0 /news/kentleague/deal/Sampson19.html 1 0 0 0 /news/phoevcd240715 2 67666 0 0 /news/551a9c92d9a37 2 19702 0 0 /news/wejusthavetosortourhomerecordoutsayscraywanderersbossianjenkins 1 15495 0 0 /news/wewanttogoasfaraswecaninthefacupsaysdartsbosstonyburman 1 14235 0 0 /news/margate0-3walthamabbey-immoreawareofthesizeofthetasknowadmitsoconnell 1 21989 0 0 /news/faversham020122 2 29324 0 0 /news/itscrucialtohaveourownlocationsaysfisherbossgarylisney 1 20296 0 0 /news/werejusttryingtomoveittothenextlevelsayssevenacresidcupchiefleehill 2 19084 0 0 /news/FAStatement180720 3 38398 0 0 /news/tunbridgewells110119 1 13015 0 0 /news/letsgetnewyearofftowinningwayssaysseager 1 15270 0 0 /news/551a931e57f8e 1 11411 0 0 /news/soccershortsstrugglingstonesdeferplayerswages 1 44776 0 0 /news/551a97b084d3b 1 11244 0 0 /news/drmartens/eastern/folkestone/leyton240804.html 1 0 0 0 /news/facarlsbergtrophysecondqualifyingrounddraw 1 12419 0 0 /news/uckfield200919 1 14544 0 0 /vcd-2003-2006/2 1 13207 0 0 /news/holmesdale110220 1 13855 0 0 /news/forthcomingfixtures6thfebruary2006 1 21736 0 0 /news/themovetoramsgateisjusttobettermyselfsaystomparkinson 1 17608 0 0 /news/crowboroughA201016 1 11898 0 0 /news/joeford220619 2 23446 0 0 /news/mitchellragesundayleagueclubsarerunbetterthanlordswood-itsashambles-exclusive 1 11613 0 0 /news/wemusttakeadvantageofbeingathome-hares 1 14147 0 0 /news/gleblydd310117 1 34129 0 0 /news/heybridgeswifts2folkestoneinvicta0 2 18948 0 0 /news/thefacupdraw2014 1 11300 0 0 /news/weveprovedwecancompetewiththebestteamssaysluchford 1 16543 0 0 /news/wellingtown160220 1 17235 0 0 /news/crayvhern121103.html 1 0 0 0 /news/hythchal260920 5 158025 0 0 /news/humewerrereadyfortoughtootingtest 1 13149 0 0 /news/dontwriteusoffwarnshernebaychairman 1 17415 0 0 /news/551a9798e73f9 1 5240 0 0 /news/parkinsonlooksforwardtovickersclash 1 16461 0 0 /news/iwanttobeatjenkostallysayskempster 1 17492 0 0 /news/soccershortsguyeldridgequitssuttonathleticaftersevenyearsincharge 1 36726 0 0 /news/19thjuly05.html 1 0 0 0 /news/551bc99b96cbd 1 4279 0 0 /news/rochesterunited3-0lordswood-replacingstuartzanonewillbeverydifficultsaysglennbarlow 1 19379 0 0 /news/imdeterminedtomakesureitsnotusthatgodownsaystonbridgeangelsbosstommywarrilow 1 17898 0 0 /news/kentleague/hythe/7thnov04.html 1 0 0 0 /news/VCDAthletic170421 3 30444 0 0 /news/551a99e494f66 2 25764 0 0 /news/soccershortsconferenceclubstoldtogettheirfinancesinorder 1 52559 0 0 /news/tonbridgeangels4-1ashfordtownmiddlesexsecondplacedangelsgettheirjustrewards 1 20160 0 0 /archive-2006-2014/254 1 19193 0 0 /news/ebbsfleetunited2-1salisburycity-fleetendsalisburys12matchunbeatenrun 1 17577 0 0 /news/cordicereadstheriotact 1 22500 0 0 /news/giveuslucrativekentderbiessaysbinks-exclusive 1 16779 0 0 /news/ryman/bromley/brackvbrom300903.html 1 0 0 0 /news/creditcrunchchangeswillbemadesaysconcernedangelschairman 1 15919 0 0 /news/aseriesofkicksintheteethhavemadethejobsomuchmoredifficultsaysrickybennett 1 16321 0 0 /news/collinscategoricallydeniessevenoaksspeculation 1 17293 0 0 /news/rusthall250518 1 12277 0 0 /news/spartanspulloutofdalersopeningwarm-upmatch 1 10992 0 0 /news/maidstoneunited4-0whitstabletown 1 15739 0 0 /news/cugleyhailsremywonderstrike 1 20301 0 0 /news/bromvdulw261203.html 1 0 0 0 /news/crayvalley140719 3 31113 0 0 /news/ramsgate310320 2 25723 0 0 /archive-2006-2014/133 1 19616 0 0 /news/bearsapm200416 2 39841 0 0 /news/551bc99d0d720 2 20640 0 0 /news/kingshill060621 3 36791 0 0 /news/glebe170919 1 10985 0 0 /news/resultsjanuary2018 2 95721 0 0 /news/tonbridgeangels2-2ramsgate-thisisourturningpointsayslast-gaspherodavis 1 18324 0 0 /news/erithandbelvedere171123 7 72539 2 1 /news/551a9c91ace31 2 21439 0 0 /news/stonesunveilfirstsummersigning 1 12910 0 0 /news/phoenix271115 2 25318 0 0 /news/thamesmead170716 2 28600 0 0 /news/kentleague/thamesmead/winchester111204.html 1 0 0 0 /news/ryman/bromley/14thdec03.html 1 0 0 0 /archive-2006-2014/275 2 23063 0 0 /news/ryman/bromley/harrvbromlgecup181103.html 1 0 0 0 /news/551bc5dd063bc 1 15155 0 0 /news/bromley210920 2 21471 0 0 /news/551bc99dbe7a4/ryman/bromley/kentleague/cray/crayvsandhurstfac130903.html 2 15653 0 0 /news/fivekentclubsinthelast32ofthefavaseisagreatachievementsaysdeniserichmond 1 12364 0 0 /news/windsor011005.html 1 0 0 0 /news/croydon030915 1 13424 0 0 /news/wecantaffordtogoupsayscugley 1 22444 0 0 /news/551bc5df7813f 1 14431 0 0 /news/kentleaguesoccershortslordswoodsignformerwellingmidfielder-exclusive 1 17927 0 0 /news/weveblownitadmitsburman 1 12216 0 0 /news/doverathleticunveilnewsponsorshipdeal 1 16041 0 0 /news/wemustbetopofthetreenextseasonsayswingersherwood 1 14283 0 0 /news/wellfinishhigherthanmargateforthefirsttimein47yearssaysward 1 17912 0 0 /news/fisherp-pharingeyborough-cuptiefallsforthesixthtime 1 10731 0 0 /news/lordrust080121 4 137490 0 0 /news/sevenoakstownsettounveilnewmanagerwithindays 1 12182 0 0 /news/otfordunited0-2hildenboroughathletic-wehavegotpotentialinabundancesaysmikecramp 1 26055 0 0 /news/551bc5d9b0a72 4 29508 0 0 /news/haywashf021018 2 61609 0 0 /news/drydengivenall-cleartoplaycameorole 1 12402 0 0 /news/551a97b069bd2 1 12056 0 0 /news/conference/margate/10thdec04.html 2 0 0 0 /news/551a95b441618 2 24339 0 0 /news/langtonwilldrivetheclubforwardsaysforbes-exclusiveinterview 1 13434 0 0 /news/tonbridgeangels1-0kingstonian-mymidfieldthreewereoutstandingpraiseswarrilow 1 26309 0 0 /news/glebe2105217 1 14531 0 0 /news/fisher1-1erithtown-welikeleavingitlateadmitslisney 1 22269 0 0 /news/551bc5debf5c4 1 12454 0 0 /news/thorogoodstepsaside 1 11488 0 0 /news/burmanwaitsforoffersforin-formstrikermcdonald 1 16425 0 0 /archive-2006-2014/165 1 19556 0 0 /news/ourfriendliesaretheretotestussayswarrilow 1 18169 0 0 /news/weredroppinglikefliesadmitsdolby-exclusive 1 13242 0 0 /news/justinedinburgh080619 2 37017 0 0 /news/rymanonesouthplay-offfinalgivemeonebigfinaleffort-sayscugley 1 17291 0 0 /news/beckenham260120 1 13794 0 0 /news/maidstoneunitedpaircalledupforengland 1 12940 0 0 /news/royalengineers3-2gillingham-wehadplentyofchancesbutdidnttakethemsaysmarkpatterson 1 20374 0 0 /news/expectationswillneedtochangesaysdoverathleticchairmanjimparmenter 1 13515 0 0 /news/vcdath030417 2 24098 0 0 /news/folkestoneexploreafrenchconnection 2 24308 0 0 /news/551a9c92bbeb1 2 22326 0 0 /news/wembleywinnersmyproudesteverday-mcphee 1 17335 0 0 /news/stonesexplainhiscocksnewrole 1 13556 0 0 /news/stevenstakescontroloftunbridgewells 1 11019 0 0 /news/551a931dc3ff8 1 11842 0 0 /news/bromley5-1tonbridgeangels-werestilllookingtohaveourbestfinishsaysmarkgoldberg 1 29709 0 0 /news/551bc5df24fc0 1 15688 0 0 /news/bearspag100916 1 29321 0 0 /news/stonesswoopforcharltonyouthcoach 1 13175 0 0 /news/hopefullystuartkingwilldothebusinessontheparkforussaysneilcugley 1 18169 0 0 /news/kentleaguenewsinbriefeaglescanjumpaboardtramsforhalfprice 1 11224 0 0 /news/fisherreplacecroydoninkentleague 1 15370 0 0 /news/kentleaguecupfinalfiskdelightedwithtop-fourfinish-exclusive 1 14325 0 0 /news/jenkinsmarkshistenthanniversaryinchargeofcraywanderers 1 24133 0 0 /news/sittingbourne0arleseytown1 1 14369 0 0 /news/punjabunited191219 1 12340 0 0 /news/wewanttoclaimthekentleaguedoublesayshythetownbossscottporter 1 16192 0 0 /news/goalkeepernorthwoodbeginssearchforanewkentclub-exclusive 1 14362 0 0 /news/brombrai30102018 2 40703 0 0 /news/greenwich060716 2 24854 0 0 /news/tonbridgeangels6-1worthingmaindedicatesfourgoalstohislatemum 1 19294 0 0 /news/sceflstatement181220 1 13084 0 0 /news/concernsraisedoversorrystateofkentleagueclub-exclusive 1 12252 0 0 /news/fleetreachverbalagreementwithnewsponsor 1 11987 0 0 /news/corinthian190822 3 35867 0 0 /news/whitstabletown2-3maidstoneunited-imdisappointedwevegotnothingfromtwogames-luchford 1 22707 0 0 /news/551bc5e26212f 1 12227 0 0 /news/redwell170518 1 31961 0 0 /news/kentleague/whitstable/9thjuly03.html 1 0 0 0 /news/tonbridgeangels1-2margate 1 15256 0 0 /news/wortvbrom081103.html 1 0 0 0 /news/551a967777695 3 47829 0 0 /news/gillinghamsignformermargatedefendergaryborrowdale 1 19660 0 0 /news/imquietlyconfidentwecanpullitoffsaysford 1 15534 0 0 /news/idontwanttofinishwherewedidlastyearsaystonbridgeangelsbosstommywarrilow 1 16059 0 0 /news/facarlsbergtrophythirdrounddrawmoretravellingforkentslasttwo 1 13073 0 0 /news/wemustfocusonfinishinginplay-offplacessaysdoverstars 1 31863 0 0 /news/bromley010118 1 15160 0 0 /news/thebestisyettocomeinsistsinvictabosscugley 1 15798 0 0 /news/arlesey031205.html 1 0 0 0 /news/hernebay1-3folkestoneinvicta-weknowwecanbeanotheranotherlevelsaysneilcugley 1 29666 0 0 /news/maidstone100517 1 14155 0 0 /news/aaronperrypartscompanywithmiltonfulstonunited 1 10967 0 0 /news/551a931e4add1 1 11959 0 0 /news/welling080416 1 12244 0 0 /news/shameasmanagerpunchesrefereeatanundersevensfootballmatch 1 14115 0 0 /news/rusthalladoptprofessionalapproachundernewbosshugo-exclusive 1 16202 0 0 /news/corinthian070220 1 14242 0 0 /news/ileavefisherwithaheavyheartsaysbillywalton 1 14635 0 0 /news/riocomestosittingbourne 1 12346 0 0 /news/favershamtown271122 2 27687 0 0 /news/hopefullyitwillbeagreatdayforgreenwichboroughsayspaulblade 1 17594 0 0 /news/whitstabletown2-2ashfordtown-lane47rollsbacktheyears 1 16610 0 0 /news/tonboxfo081022 4 123650 0 0 /news/kentleague/VCD/6thdec04.html 1 0 0 0 /news/winningthekentleaguetitlewillbeamiracleforusadmitsfavershambossluchford-exclusive 1 14285 0 0 /news/arleseytown0chathamtown1 2 16025 0 0 /news/tonbridge070416 3 24696 0 0 /news/stonessignnorthwoodtocompetewithmullin 1 13386 0 0 /news/erithbel240517 1 15171 0 0 /news/wellingunited230921 1 21678 0 0 /news/bexken130517 2 14350 0 0 /news/fleetmcmahon030515 1 13813 0 0 /news/notrophiesarehandedoutinaugustsaystable-toppingerithbelvederebossmattlonghurst 1 15297 0 0 /news/dulwich121115 2 29473 0 0 /news/friendsre-unitedathayeslane 1 11007 0 0 /news/kentleague/lordswood/23rdjuly03.html 1 0 0 0 /news/craywanderers3-1folkestoneinvicta-craybeatnew-lookfolkestone 1 15084 0 0 /news/551a9c91d3481 2 17461 0 0 /news/maybewecangettopspotifresultsgoourwaysayscraywanderersbossianjenkins 1 14992 0 0 /news/551bc5e888f5c 1 12190 0 0 /news/whitehousepensnewdoverdeal 1 11440 0 0 /news/drmartens/eastern/sittingbourne/maldon231104.html 1 0 0 0 /news/greenwich230916 2 24473 0 0 /news/kentleague/lordswood/14thoct04.html 1 0 0 0 /news/warddoeshishomeworkontheirrivals-exclusive 1 13873 0 0 /news/wemustcutoutourmistakessayslovell 1 20532 0 0 /news/551bc5daed878 4 40022 0 0 /kent-county-league/7 3 42562 0 0 /news/fisher2-4erithtown-theresnopressureonustowinthekentleagueadmitstonyrussell 1 38449 0 0 /news/551a9cf4dcef0 2 14453 0 0 /news/jenkinslooksforwardtowokingtest 1 14089 0 0 /news/fatrophyspecialmcclementsisstillinburmansplans 1 14101 0 0 /news/ryansdeparturefreesupsomecashforlovell 1 10831 0 0 /news/dartford0-1gillingham-itsadreamtobeaconferencemanagersaysdartfordstonyburman 1 22074 0 0 /news/551bc5e52f8e5 2 30629 0 0 /news/billericay190305.html 1 0 0 0 /news/itsgreatforbromleytobeinvovledinatop-of-the-tableclashsaysbossmarkgoldberg 1 19562 0 0 /news/erithbel090218 1 13459 0 0 /news/dartbrai231217 1 27579 0 0 /news/whitlanc230917 1 33335 0 0 /news/551a92504acac 2 14603 0 0 /news/wp-content/plugins/apikey/king.php 1 0 0 0 /news/bowey301sevenoaks250105.html 1 0 0 0 /news/favershamtown6-1erithbelvedere-imnotthinkingaboutthetitleyetsaysluchford 1 15887 0 0 /news/havingfiveplayersoutisabitnaughtysaysfolkestoneinvictabossneilcugley 1 15596 0 0 /news/craycroy070218 1 34134 0 0 /news/departingtuckergoandwinthefinalexclusive 2 17620 0 0 /news/bromley2hamptonrichmondborough0 2 17384 0 0 /news/Maidstone070318 1 11951 0 0 /news/551bc5dcd9683 1 12245 0 0 /news/hythetown1-0dulwichhamlet-ifwereachtheplay-offswevereachedourgoalsaysscottporter 1 24363 0 0 /news/551bc99dbe7a4/kentleague/tunbridgewells/ryman/bromley/carsvbromfat011103.html 2 15653 0 0 /news/ireallyfancyourselvestodoreallymagicalthingsatfleetwoodsaysdannywaldren 1 21869 0 0 /isthmian-league/13 3 43764 0 0 /news/corinthian200117 1 14115 0 0 /news/matchreportshernebayearnreplayafterheoricsathayesyeading 1 24727 0 0 /news/wevehadresultsgoourwayandnottakenadvantageofitsaysstonesbossjaysaunders 1 13284 0 0 /news/itsmyjobtoputthingsrightsayscrayvalleybossstevechapman 1 12895 0 0 /news/shorts020715 2 40596 0 0 /news/wereathomesowemustwinfirstlegvowscorinthianbosstonysitford 1 13214 0 0 /news/faversham050717 2 31185 0 0 /news/3rdnov04.html 1 0 0 0 /news/weneedmoreexperienceinoursideadmitsyorath 1 14081 0 0 /news/551a931e2f3e9 1 12344 0 0 /news/constableoptsformovetokentleaguesidetunbridgewells 1 15568 0 0 /news/foleystrengthenshisvickerssquad 1 14329 0 0 /news/wp-content/uploads/kaswara/fonts_icon/a57bze8931/.__a57bze8931.php 1 0 0 0 /news/sittvchat281003.html 1 0 0 0 /news/551bc99b57907 2 18413 0 0 /news/maidstoneunited3-0craywanderers-werenotacceptingourfatesayscraybosskeithbird 1 30932 0 0 /news/12thmay04.html 1 0 0 0 /news/conference/gravesend/7thjuly04.html 2 0 0 0 /news/551bc5d945d85 2 17984 0 0 /news/dartsrelishingbiggames 1 12586 0 0 /news/heaslewoodweneedtobelieveinourselves-exclusiveinterview 1 14669 0 0 /news/hollands281016 1 11792 0 0 /news/lordswood150520A 1 12779 0 0 /news/551a97b1ae035 1 15468 0 0 /news/imlookingforwardtothefuturesayskinnearexclusiveinterview 1 12870 0 0 /news/tilbury300804.html 1 0 0 0 /news/thefavasefinal2013insportingtermsitsourbiggestdayanyofushavehad-martinlarkin 1 18783 0 0 /news/razorpowellwillcutitatmaidstoneinsistswalker 1 12193 0 0 /news/purcellwillhelpusclimbthetablesaysward 1 14128 0 0 /news/croygreen200116 1 10849 0 0 /news/frenchstrikerwantedtoomuchmoneyrevealshessenthaler 1 12724 0 0 /news/maidstoneunited2-2tonbridgeangels-wattsisnotamodelprofessional-hume 1 36085 0 1 /news/weneedmoreexperienceintherankssayslarkin 1 19238 0 0 /news/faversham231019 2 24148 0 0 /news/doverathletic3-2craywanderers 1 13693 0 0 /news/hythetown2-1favershamtown-idontthinkwewereatourbestadmitsunbeatenporter 1 28760 0 0 /news/551bc5e8f3de0 1 14601 0 0 /news/craywands270817 3 31186 0 0 /news/facarlsbergtrophyfirstrounddrawangelshandeddreamdrawatoxfordunited 1 14281 0 0 /news/soccershorts140717 2 36411 0 0 /news/dealsitt120920 3 96574 0 0 /news/wellingunited201120 1 12075 0 0 /news/cupdraws2008-2009 1 14803 0 0 /news/imgoingtokeepworkingtobringinnewplayerssaystonbridgeangelsbossstevemckimm 1 14768 0 0 /news/551a956c04cc1 1 3341 0 0 /news/551a9c0f2972b 2 16822 0 0 /news/othernews/youthleaguetablesfinal2004.html 2 0 0 0 /news/myplayerscanstillturnitaroundinsistscash-strappedfolkestonebossneilcugley 1 21698 0 0 /news/whitgraham080515 3 29771 0 0 /news/spenbrom140318 1 27996 0 0 /news/ryman/22ndjune03.html 1 0 0 0 /news/fiskhits-backattompkinslong-balljibes-exclusive 1 13253 0 0 /news/dartford030117 2 14898 0 0 /news/thamesmead261105.html 1 0 0 0 /news/wellingtown310820 1 14285 0 0 /news/sheppey030217 1 13560 0 0 /news/ebbsfleetunited.co.uk/fleet-take-the-message-to-reboot-our-national-game-to-parliament/ 1 0 0 0 /news/soccershortsliamdaishsignstwo-yearcontractextensiontostayatstonebridgeroad 1 25415 0 0 /news/milesbitterlydisappointedasdennesssignsforrivals-exclusive 1 14754 0 0 /news/anythinglessthangettingpromotedwouldntbeasuccessfulseasonforussayssimonglover 2 18607 0 0 /news/drmartens/eastern/tonbridge/20thoct04.html 2 0 0 0 /news/wellingunitedmustfind60000inonlyfourteendaystosurvive 1 17928 0 0 /news/leeworgan050420 1 22770 0 0 /news/chathamtown3-0metropolitanpolice 1 12650 0 0 /news/551bc99dbe7a4/kentleague/ramsgate/conference/margate/24thjune03.html 2 15653 0 0 /news/sittingbourne150320 2 40577 0 0 /news/soccershortswewillrunebbsfleetunitedinafinanciallyresponsiblemannersayspetervarney 1 30628 0 0 /news/20thapr04A.html 1 0 0 0 /news/imlookingforagoodconfidentstartsayslyddtownbossdavejohncock 1 14069 0 0 /news/ebbsfleetunitedunveilthearrivalofcameroonborndefenderpatrickada 1 11735 0 0 /news/rusthall161218 1 12927 0 0 /news/ashfordtownsuffertournamentpenaltyheartbreak 1 17327 0 0 /news/erithandbelvedere280521 1 12508 0 0 /news/fisher4-3beckenhamtown-itsjustfairytalestuffsaysproudfisherbossbillywalton 1 28972 0 0 /news/551a97b0b3c24 1 14173 0 0 /news/fishspel030922 4 123126 0 0 /news/hessenthalerbidstoremovestaines 1 12382 0 0 /news/sporlewi021023 5 150814 0 0 /news/551a931e27f87 2 29430 0 0 /news/wellliftourselvesagainstthebig-spenderssaysabbott 1 15856 0 0 /news/fisher160718 2 25140 0 0 /news/tommywarrilowreturnstostonebridgeroadaschiefscout 1 15348 0 0 /news/dulwich060318 3 28497 1 1 /news/bynomeanswellbeunderestimatingourfacupopponentsinsistschathamtownbosskevinwatson 1 13589 0 0 /news/imgettingnopressurefromtheclubsaysmcmahon 1 20085 0 0 /news/551a9c0e64a84 2 14663 0 0 /news/wereonthelookoutfornewplayersallthetimesaysramsgatebossjimward 1 17268 0 0 /news/warrilowplanningspendingspree-exclusive 1 21062 0 0 /news/crayvdeal030216 1 29653 0 0 /news/corinthian070116 1 12341 0 0 /news/kentcounty/bromleians20thjuly03.html 1 0 0 0 /news/ashford100818 3 27950 0 0 /news/abbottpullsofdebollacoup 1 14874 0 0 /news/hythetownsecretarymartingilesvoiceshispitchconcerns 1 16370 0 0 /news/dartvfolk240204.html 2 0 0 0 /news/551a96dc64aa4 3 32051 0 0 /news/15thjune05.html 1 0 0 0 /news/craywands220416 3 31126 0 0 /news/maidstone160717 2 18950 0 0 /news/drmartens/eastern/erith&belvedere/southall051004.html 1 0 0 0 /news/551a9798539bc 1 2679 0 0 /news/applicantsforchathamvacancyhavebeenremarkablyhigh 1 12823 0 0 /news/burgesshilltown200323 5 42264 2 2 /news/erithbelvedere2-1pagham-cablehascomebackwiththerightattitude-radbourne 1 29026 0 0 /news/weneedamanagertoliftourconfidencesayswilson 1 16856 0 0 /news/tunwells261015 1 15028 0 0 /news/sittingbourneseethelight 1 12700 0 0 /news/fisher3-3glebe-wehaveprogressedfromlastseasonsaysglebebossrockymcmillan 1 34721 0 0 /news/iwanttoseehowwecandoagainstareallygoodsidesaysvcdathleticbosstonyrussell 1 15679 0 0 /news/25thjuly04.html 1 0 0 0 /southern-counties-east-football-league/20 1 20301 0 0 /news/bromleians080620 2 20244 0 0 /news/christchurch1-0tunbridgewells-wedidntperformforoursupporterssaysrobbins 1 20636 0 0 /news/drmartens/eastern/dartford/1staug04.html 1 0 0 0 /news/551a9cf563d0a 3 35018 0 0 /news/ryman/bromley/10thdec04.html 2 0 0 0 /news/dulwtonbvcd050815 2 26997 0 0 /news/metrostans020416 1 29275 0 0 /archive-2006-2014/219 1 19171 0 0 /news/wereahardteamtobeatsaysthamesmeadtownbosskeithmcmahon 1 15249 0 0 /news/drmartens/eastern/erith&belvedere/berkhamsted161104.html 1 0 0 0 /news/drmartens/eastern/fisher/12thmar04.html 1 0 0 0 /news/cordicebeckenhamrepresentsabigchallengeforus 1 14459 0 0 /news/specialofferwebsitesponsorshipupforgrabs 1 10334 0 0 /news/greenwich290318 3 36014 0 0 /news/craywanderers2-0metropolitanpolice-wedeserveacrackattherymanpremiersaysroyston 1 15863 0 0 /news/551bc5dfce9ed 2 27302 0 0 /news/sawyerexpectsrealexaminationagainstleagueneighbours 1 15037 0 0 /news/backingborotowembleyborogivenfire-powerboost-exclusive 1 17975 0 0 /news/551bc99dbe7a4/ryman/bromley/drmartens/eastern/folkestone/hastvfolklgecup281003.html 2 15653 0 0 /news/craybeck140223 3 89686 0 0 /news/drmartens/eastern/ashford/26thsept04.html 1 0 0 0 /news/rusthollyoak110515 1 14502 0 0 /news/craywands080319 3 33662 0 0 /news/wp-content/plugins/gatewayapi/inc/a57bze8931.php 1 0 0 0 /news/corinthian2-0erithbelvedere-wewontlastlongintherymanifweplaylikethatsaysford 1 30585 0 0 /news/dealtown050717 3 34396 0 0 /news/wevebeenstabbedinthebackclaimsjoeford 1 17521 0 0 /news/ramsgate120618 2 24207 0 0 /news/tramshopingforasmoothride-exclusiveinterview 1 16434 0 0 /news/drydenwearemorethancapableofwinningleague 2 15517 0 0 /news/wewouldntbewherewearewithoutchairmangaryhillmansaysianjenkins 1 20245 0 0 /news/dartford1-2borehamwood-wevebeentopallyearandthingsaregettingnervyadmitsburman 1 23862 0 0 /news/hernebay070422 2 30131 0 0 /news/hopefullywecangetonemorewintosealtitlesayswellingunitedbossjamieday 1 15887 0 0 /news/mishimorathtributes201219 1 15812 0 0 /news/thamesmeadtown2-1greatwakeringrovers-meadfrustrateroverstoearnplaceinnextround 1 13667 0 0 /news/ashfordputundereighteensideonhold 2 22156 0 0 /news/hythetownunveilthesigningofphilstevensonfromlocalrivalsfolkestoneinvicta 1 12941 0 0 /news/mcdonnellreturnboostforbromley 1 17391 0 0 /news/551a9c0e4e51c 4 38810 0 0 /news/sittingbourne281016 2 25354 0 0 /news/newlightstoshineonsouthwoodstadiumwithinsixweeks-exclusiveinterview 1 12644 0 0 /news/wellingunited1-1doverathletic-everyoneinvolveddeservesapatonthebacksaysjamieday 1 26776 0 0 /news/phoegree110315 1 28141 0 0 /news/barton030905.html 1 0 0 0 /news/erithtown2-1vcdathletic-someonesgoingtogetagoodhidingwarnserithtownstonyrussell 1 23622 0 0 /news/othernews/charltonladies27thaug03.html 2 0 0 0 /news/longhurstwaitsforoffersafterleavingchathamforhavingadifferenceofopinion 1 14937 0 0 /news/craygree070419 3 91452 0 0 /news/wellingtown040120 1 15009 0 0 /news/crocksitt040715 4 95211 1 1 /news/werenotgoingtocrippletheclubinsistswarrilow 1 24056 0 0 /news/farnieexperienceisthebestpolicy-exclusiveinterview 1 14958 0 0 /news/kennyshowshisthankstothemanwhokeepstheborodreamalive 1 23495 0 0 /news/massiverespecttojpcollierforallthathehasdoneforholmesdalesayscoachrossmitchell 1 13272 0 0 /news/551bc5dace7a9 3 24760 0 0 /news/glebe100120 1 13137 0 0 /news/holmgleb140317 1 32556 0 0 /archive-2006-2014/123 1 19495 0 0 /news/mattjohnsonisjoiningusfortherightreasonssaysdoverathleticbossmartinhayes 1 14236 0 0 /news/wellhavethestrengthtowinkentleaguetitlevowscosgrove 1 12789 0 0 /news/551a9799d1f38 1 6870 0 0 /news/bromley0-1dagenhamredbridge-werestillputtingallthejigsawpiecestogethersaysgoldberg 2 31992 0 0 /news/xl2023.php 1 0 0 0 /news/drmartens/eastern/erith&belvedere/27thnov03.html 1 0 0 0 /news/wellingunited270919 1 12291 0 0 /news/ryman/bromley/wortvbrom081103.html 1 0 0 0 /news/kentleague/maidstone/maidvlord271203.html 1 0 0 0 /news/tonbridgeangels2-1hitchintown-immorethanhappywithwhativedoneheresaystommywarrilow 1 27917 0 0 /news/thamesmead120317A 2 27189 0 0 /news/fcelmstead140517 2 14492 0 0 /news/daishquiteexcitedaboutnewfacesontrial 1 16453 0 0 /news/dealtownrecognisepastcontributionsofexplayersandmanagerswithlifemembershipscheme 1 13570 0 0 /news/iwouldliketogainentrancetothewomenssuperleagueinfuturesaysgillschairmanpaulscally 1 16718 0 0 /news/kentleague/VCD/27thfeb04.html 2 0 0 0 /erith-belvedere-2003-2006 17 207703 2 2 /news/humebringsinkidsduetobudgetcuts 1 16516 0 0 /news/daledidnttapmeupinsistslangton 1 12713 0 0 /news/sevenacresidcup1-2suttonathletic-cupdoublewillmakeitagreatseasonsaysjamietodd 1 31209 0 0 /news/kentfootballunitedbosssammacneilunveilshissummersignings 1 13478 0 0 /news/drmartens/premier/welling/8thJan04.html 1 0 0 0 /news/beckcori221218 1 33193 0 0 /news/551a931e98ce6 2 30210 0 0 /news/551a97b0b7f2a 1 10978 0 0 /news/dulwichhamlet2-1margate-wecanbeathreatinthisleaguesaysdulwichhamletbossgavinrose 1 31770 0 0 /news/phoenix010620 2 24371 0 0 /news/smallingscashwillcomeinhandysaysstoneschairman 1 16388 0 0 /news/newsigningsbringfreshhopeforfolkestone-exclusiveinterviews 1 18036 0 0 /news/ashfordhavemajorsayinwhowinstitle-exclusiveinterview 1 14792 0 0 /news/isthmianleaguestatement041220 2 27581 0 0 /news/hernebay061122 5 71125 0 0 /news/bromley170616 2 18050 0 0 /news/yesterdaysmatchreports 1 29066 0 0 /news/tonbridgeangels6-1merstham-wevebeenthreateningawinlikethatforweeks-warrilow 1 24998 0 0 /news/fivekentleagueclubsapplyforrymanleaguestatus 1 10953 0 0 /news/doverreadyfordartsvisit 1 11547 0 0 /news/afccroy190216 2 16267 1 1 /news/wehavetostandupandcompeteagainsttheleagueleadersbillericaysaysianjenkins 1 12893 0 0 /news/favershamtown0-3dulwichhamlet-wehaventputaperformanceintodayadmitsrayturner 1 21068 0 0 /news/myplayerswanttofinishthejobtheyvestartedsayshernebaybosssimonhalsey 1 19164 0 0 /news/551bc5e8a40df 1 11833 0 0 /news/itsimportantforustoimproveourformathomesaysbromleybossmarkgoldberg 1 13922 0 0 /news/ryman/bromley/chessington240704A.html 2 0 0 0 /news/hythe141216 2 27692 0 0 /news/soccershortshistondeservetobethrownout 1 42976 0 0 /isthmian-league/42 3 43692 0 0 /news/faversham240818 2 29523 0 0 /news/fleetappointnewchairman-daishbeginstorebuildhissquad 1 17277 0 0 /news/tootingmitchamunited0-3craywanderers-itsgreatwerestillgoingforitsaysianjenkins 1 19157 0 0 /news/kentleague/tunbridgewells/bearsteadu18120904.html 1 0 0 0 /news/werequitecapableofgonigtodoverandbeatingthemsaystommywarrilow 1 15990 0 0 /news/faversham200821 6 67020 0 0 /news/8thJune05.html 1 0 0 0 /news/wellsbeginsearchfornewsecondstringmanager 1 12250 0 0 /news/canterbury111116 1 12143 0 0 /news/hythe090915 2 25713 0 0 /kent-invicta-league/29 2 24661 0 0 /news/krisbrowning280819 2 15005 0 0 /news/newsigningswillmakeusmorecompetitivesayscugley 1 14934 0 0 /news/cassstillhasafutureatprincespark-burman 1 15417 0 0 /news/hendmarg170515 2 51084 0 0 /news/551a92501f8b7 3 28764 0 0 /news/wellsmashhythebutidontwanttodohernebayanyfavorssaysnortonbossbentaylor 1 19501 0 0 /news/551a9c922dc70 3 37106 0 0 /news/551a931ea03fb 2 38950 0 0 /news/ramscupheroesmyplayersstooduptotheplatesaysproudward-exclusive 1 15280 0 0 /news/favershamtown0-1tunbridgewells-teenagestopperhodgsonwinstheplaudits 1 26057 0 0 /news/lordswood110817 1 11438 0 0 /news/soccershortsdoverstarclokepensnewtwo-yeardeal 2 37438 0 0 /news/tunbridgewells2-2hythetown-imtheproudestmanagerintheworldsaysscottporter 1 29476 0 0 /news/ebbsfleetunited0-1gateshead-ineedsomemoneyforplayerssaysfleetbossliamdaish 1 19007 0 0 /news/Ebbsfleetgreenlight090415 2 16304 0 0 /news/itsgreatthatpeoplesexpectationsaresohighsaysfavershamtownbossrayturner 1 13019 0 0 /news/wellingunited4-3salisburycity-myplayersgavemeaheartattacksaysdrainedjamieday 1 22115 0 0 /news/551a9c0eb6928 4 34774 0 0 /kent-invicta-league/16 2 24458 0 0 /news/thingswillchangeatfarnboroughnextseasonsaysoldboysmanagerbyronbeard 2 20181 0 0 /news/iwillnotgoovermyplayingbudgetinsistswarrilow 1 21737 0 0 /news/atriptowembleystadiumiswithintouchingdistanceforebbsfleetunited 1 12890 0 0 /news/erithtown270621 4 45754 0 0 /news/weletourselvesdownbigtimeagainstbearstedsaysashfordunitedbosspaulchambers 1 12621 0 0 /news/dereskeepfaithwithgormanaftercosgroveresignation 1 17313 0 0 /news/wellingunited1-0charltonathleticturnerletsaimfortheplay-offs-exclusive 1 16514 0 0 /news/iwantawinninghabitsaysobrien 1 15306 0 0 /news/weregoingtodartfordtobringthetrophybacktokentsayspcsteele 1 12325 0 0 /news/newsevenoakstownbossdarrenanslowsettostartfromscratch 1 12308 0 0 /news/gillsatwembleystimsonproveshiscriticswrong 1 17145 0 0 /news/thamesmead170817 2 24408 0 0 /news/wellingunited170619 1 13692 0 0 /news/meridianvp021221 1 12193 0 0 /news/championshessenthalerwillguideustothefootballleague-parmenter 1 17435 0 0 /news/pleasedosomethingfortheseteamsthatarestrugglingmacraetellsfa 1 24098 0 0 /news/26thaug04.html 1 0 0 0 /news/551a9c926c7d8 3 52361 0 0 /news/kentleague/tunbridgewells/14thaug03.html 1 0 0 0 /news/21stoct05.html 1 0 0 0 /news/551bc5d9e4bc4 2 14714 0 0 /news/551bc99db7da5 2 26551 0 0 /news/thamsmald110116 2 22751 0 0 /news/hytheharvey120515 2 25264 0 0 /news/phoenix061017 2 25490 0 0 /news/iwillnotrisklong-termfutureoftheclubinsistsangelschief 1 11735 0 0 /news/mydesiretosucceedhasneverchangedsaysnewly-appointedramsgatebossjustinluchford 1 30410 0 0 /news/soccershortslovellrepresentsenglandatworldcup 1 13135 0 0 /news/sct301116 1 13003 0 0 /news/harlowtown0-3folkestoneinvicta 1 15250 0 0 /news/fisher1-4holmesdale-impreparedtoquitifsomeonecandobetterthanmesaysbillywalton 1 31543 0 0 /news/ashfordwelcomegunnersforcunninghambenefitmatch 1 11489 0 0 /news/bromley260418 2 20400 0 0 /news/551bc5e3e5b17 1 16076 0 0 /news/atrophyinthenextcoupleofyearswouldbetheicingonthecakesaysholmesdalechairmanharris 2 19959 0 0 /news/doverathletic260519 2 15962 0 0 /news/dartvburn010504.html 2 0 0 0 /news/tonbridgeangels1-2folkestoneinvicta 1 20394 0 0 /news/memberclubsvoteforleaguenamechange 1 11354 0 0 /news/551a9c0ec4d47 3 32615 0 0 /news/folkestone061104.html 1 0 0 0 /news/phoenix080818 2 27898 0 0 /news/sevenoaks180816 1 12862 0 0 /news/january2010results 1 75540 0 0 /news/551a9baff2647 3 26843 0 0 /news/551a96779e7ed 3 29468 0 0 /news/wellingunited6-1whitstabletown-weshowedthemrespectandwesmashedthem-ford 1 26641 0 0 /news/thescarythingisyoureconstantlylookingoveryourshouldersayssittingbournebossmattwyatt 2 17725 0 0 /news/nineclubsbattleitouttoreachthepromisedland 1 19471 0 0 /news/kentsutt080222 2 80588 0 0 /news/folkestoneinvictabossneilcugleyhailsthearrivalofnaturalgoalscorerstuartking 1 17611 0 0 /news/metrogas060616 1 15170 0 0 /news/erithandbelvedere080819 1 13723 0 0 /news/22ndfeb05.html 1 0 0 0 /news/rochesterunited210623 3 30738 0 0 /news/chathamtown2-0leatherhead 1 11824 0 0 /news/margate130617 2 32123 0 0 /news/glebe280721 3 18100 2 2 /news/aheadoframscrunchgamewithhorshamwardsaysthespiritisfantastic-exclusive 1 14268 0 0 /news/bromley280817 1 16786 0 0 /news/19thsept05G.html 1 0 0 0 /news/drmartens/eastern/folkestone/folkvchat211003.html 1 0 0 0 /news/margate280617 2 25633 0 0 /news/chathamsignnewstrikersfornextseason 2 16896 0 0 /news/tuckertoapplydespiteassistancerejected-exclusiveinterview 1 13440 0 0 /news/lordswood100719 1 12568 0 0 /news/551bc5dad9d42 4 46952 0 0 /news/crockenhill110216 2 17693 0 0 /news/dartford241116 2 15825 0 0 /news/drmartens/eastern/sittingbourne/maldon041204.html 1 0 0 0 /news/hythe220105.html 1 0 0 0 /news/drmartens/eastern/sittingbourne/sittingbournevfleet060903.html 1 0 0 0 /news/bourneterminateshiscontractatcheritonroad 1 16143 0 0 /news/551bc99a65284 1 12778 0 0 /news/welling111116 1 11471 0 0 /news/sladegreen180904.html 2 0 0 0 /news/erithtown050216 1 12718 0 0 /news/bromcrys290717 2 37933 0 0 /news/playersneedtocareaboutplayingfordoversayschriskinnear 1 13352 0 0 /news/wellingtown280722 1 13736 0 0 /news/foleybringssixplayerswithhimtochatham 1 16960 0 0 /news/greenwichboroughandfishercasttheireyesonnewfaces 1 14336 0 0 /news/dannywakelingkfuwellingtown040719 3 20427 0 0 /news/551a925049841 2 14766 0 0 /news/fcelmstead201016 1 12189 0 0 /news/551bc5df4e785 1 12340 0 0 /news/alfacgiapi/database.php 1 0 0 0 /news/itsbeenamixedfewweeksadmitsramsgatebossjustinluchford 1 15570 0 0 /news/kentcountyleaguerusthallbosspleasedwiththeplayingstandards-exclusive 1 31985 0 0 /news/bromley210218 1 14698 0 0 /news/14thsept05.html 2 0 0 0 /news/sevenoakstown2hernebay2exclusiveinterviews 1 16463 0 0 /news/invictachairmanhasaclubtobeproudoff 1 15486 0 0 /news/warrilowpens18-monthcontracttostaywithangels 1 16481 0 0 /news/bromley070618 2 18597 0 0 /news/baldacchinoweneedthatluckybreaktokickstartourseason-exclusive 1 12211 0 0 /news/magnificentangelswehavenothingtofearinsistswarrilow 1 18834 0 0 /news/551bc5e796c8b 1 16086 0 0 /news/halsteadutd.co.uk 1 0 0 0 /news/wehavecharacterinabundancesaysfocusedhessenthaler 1 12366 0 0 /news/everyonehereisdesperatetogoupandwewillbetryinghardtoachievethatsayschriskinnear 1 13528 0 0 /news/szkearme050618 2 42981 0 0 /news/greenwich060718 2 22726 0 0 /news/sittingbourne200821 2 32647 0 0 /news/hernebay150720 2 25515 0 0 /news/watsonblundercoulddefineourseasonadmitscugley 1 18149 0 0 /news/551a96db5d037 2 15229 0 0 /news/551a99e49cf5d 2 24660 0 0 /news/dulwich120617 2 25574 0 0 /news/551bc5dda6299 1 15945 0 0 /news/kentleague/thamesmead/27thoct03.html 2 0 0 0 /news/kentleague/lordswood/29thnov04.html 1 0 0 0 /archive-2006-2014/256 1 19134 0 0 /news/15thsept04.html 1 0 0 0 /news/youcannowdoyouronlineshoppingwithus 1 12334 0 0 /news/soccershortscrabblepassesfootballleaguegroundgradingrequirements 1 25592 0 0 /maidstone-2003-2006/3 1 13460 0 0 /sevenoaks-2003-2006/2 1 14462 0 0 /news/welling020518 1 13213 0 0 /news/gillsatwembley38000ticketsupforgrabs 1 15756 0 0 /news/ramsgate040420 2 24895 0 0 /news/ashfordunited171123 5 56894 1 0 /news/551bc5e26831f 1 13700 0 0 /news/10thoct05G.html 1 0 0 0 /news/iwantamanagerwhoinveststimetodevelopgoodyoungplayerssayslewishamsraysimpson 1 15512 0 0 /news/therewillbenoplacetohideatmaidenheadsaysfavershamtownbossrayturner 1 13972 0 0 /news/oboyletakesupdalersjob 1 11393 0 0 /news/wellbetryingtowinbothofournexttwohomegamessaysfolkestoneinvictabossneilcugley 1 13854 0 0 /news/551bc5dbef81d 3 37157 0 0 /news/wardyouhavetoearnyourpremierpoints-exclusiveinterview 1 13503 0 0 /news/itwouldbegreatifwecouldmaketheplay-offsagainsaysneilcugley 1 15572 0 0 /news/ramsaddyoungkeepertotheirsquad 1 11342 0 0 /news/551a97b1a70f9 1 13603 0 0 /news/suttdeal300118 1 30058 0 0 /archive-2006-2014/185 1 19270 0 0 /news/weshouldbeathollandsblaircomfortablysaysconfidentbeckenhamcoachjasonclews 1 12982 0 0 /news/cray271017 3 31959 0 0 /news/leistoncalloffhythetownsridiculoustriptosuffolk 1 18701 0 0 /news/cugleywellpullthroughthistogether 1 14174 0 0 /news/1stoct04.html 1 0 0 0 /news/htyhe220118 2 27600 0 0 /news/leworp130517 1 32082 0 0 /news/sittvchar170704.html 1 0 0 0 /news/oboylewantsmorehardgraftfromhisdockers 1 15559 0 0 /news/trottaddstohissquad 1 10809 0 0 /news/ryman/bromley/bromvegh021203.html 1 0 0 0 /news/551a956cb44bc 1 5112 0 0 /news/drmartens/eastern/erith&belvedere/24thsept04.html 1 0 0 0 /news/551a9678173fb 2 17553 0 0 /news/551bc5e5977c7 2 18782 0 0 /news/frenchacehopestoearnhimselfdoverdeal 1 11985 0 0 /news/lingfielddean200415 1 12639 0 0 /news/ETU270805.html 1 0 0 0 /news/conference/gravesend/17thoct04.html 1 0 0 0 /news/wp-admin/css/colors/blue/uploader.php 1 0 0 0 /news/551a956bbfdf0 3 27161 0 1 /news/respectarticle021015 1 14358 0 0 /news/wevegotsomegreatpeoplegettinginvolvedforgeorgehowardsbenefitmatchsaysmickycollins 1 19938 0 0 /news/therealdeal-wembleymanuscript-chapters11-20 1 76488 0 0 /news/wp-content/dropdown.php 1 0 0 0 /news/weretryingourutmosttogetpromotioninsistspennock-exclusive 1 18271 0 0 /news/551a956b62481 1 3768 0 0 /news/ashfordtownp-pwhitstabletown-gameoff 1 10589 0 0 /news/IsthmianLeagueStatement080121 3 28165 0 0 /news/whitstabletown1-2tilbury-webeleivewecanstayupsaysseager 1 15894 0 0 /news/551bc5e57fe02 2 21039 0 0 /news/corinthian111116 1 13163 0 0 /news/dartford1-1dulwichhamlet-wedroppedtwopointsadmitsburman 1 22847 0 0 /news/walkerbrushedasideaslovelltakesupexcellentopportunityatashfordtown 1 11121 0 0 /news/ashfordshowingthegreenshootsofrecovery 1 15849 0 0 /news/sittingbourne021015 2 25520 0 0 /news/wortcray011118 2 59700 0 0 /news/wp-head.php 1 0 0 0 /news/imreadyformanagementsayshalsey 1 19332 0 0 /news/thesefacupgamesmeansomuchtoeveryoneinnon-leaguefootballsaysramsgatebossdeanhill 2 22908 0 0 /news/21stjuly04.html 1 0 0 0 /news/bromwell140117 2 44380 0 0 /news/iwouldntsaywerethefavorites-halsey 1 21886 0 0 /news/mcmahonvowstospendwiselywhennewstadiumisbuilt 1 15392 0 0 /news/goalshavegivenusanairofconfidenceadmitsflanagan 1 19776 0 0 /news/sevenoaksleague100120 1 13222 0 0 /news/saturdaysmatchreports 1 25032 0 0 /news/ajax-actions.php 1 0 0 0 /drmartens/premier/dover/4thfeb04.html 1 9955 0 0 /news/mckimmisourrockadmitsmargatesplayer-bosstrott 1 12030 0 0 /news/KsporGlebeA210222 2 59286 0 0 /news/favershamtownfootballclub 1 11223 0 0 /news/dorktonb051217 2 62481 0 0 /news/tonbridgeangels1-7charltonathletic-itsjustanembarrasingendtoourseasonadmitswarrilow 1 26640 0 0 /news/barton090405.html 1 0 0 0 /news/551bc99d8c44b 2 21669 0 0 /news/551bc99a8e511 2 17918 0 0 /news/thepressureisoffusandwereconfidentofcausingashockinsistshythebossscottporter 1 19370 0 0 /news/defendernathanpaulinthemiddleoftug-of-war 1 15143 0 0 /news/rochbrom041117 2 40839 0 0 /news/maidstone090519 1 12907 0 0 /news/kentleague/cray/greenwichvcray060903.html 1 0 0 0 /news/hastingsunited0-2maidstoneunited-stonesgetcampaignofftowinningstart 1 18669 0 0 /news/punjab150320 1 12492 0 0 /news/551bc99cc8146 2 24005 0 0 /news/TheBromleyBoys231018 2 24506 0 0 /news/gleberit030821 1 30390 0 0 /news/craywanderers0-0arleseytown-theirmindswillbeoncoventrysayspaulblade 1 21759 0 0 /news/faversham151118 2 28947 0 0 /news/wewontgiveuptheghostsayswarrilow 1 13291 0 0 /news/ryman/bromley/bromvleat240104.html 1 0 0 0 /news/kentleaguechristmasprogrammesuffersfromthebigfreeze 1 15855 0 0 /news/fordchallengeshissidetogetintoplay-offs 1 12988 0 0 /news/551bc5e1143ed 1 11374 0 0 /news/relegationbattleisgoingdowntothewiresayslovell 1 16999 0 0 /news/ourclose-knitsquadareallhappyinsistsramschairman 1 11745 0 0 /news/551a99e4398ff 2 26552 0 0 /news/bordtud210516 1 34087 0 0 /news/551a9c92c3986 2 22610 0 0 /news/itsasaddayforeverybodyconnectedwithashfordtownfootballclubsayshurtlovell 1 32747 0 0 /news/wewanttoplayawinningbrandoffootballsaysbromleycoachneilsmith 1 17198 0 0 /news/crowcole280117 1 32072 0 0 /news/margate070219 2 26623 0 0 /news/cugleybeginssearchfornewgoalkeeper 1 17739 0 0 /news/stevenage160320 2 23890 0 0 /news/folkestoneinvicta1redbridge0 1 14078 0 0 /news/551bc5dc7dfd4 3 45800 0 0 /news/kentleague/maidstone/7thjuly04.html 1 0 0 0 /news/wewanttobeinthekentinvictaleaguesaysmiltonfulstonbossaaronperry 1 21503 0 0 /news/squadsannouncedforsykochallenge 1 13116 0 0 /news/cugleythreemorewinstobeentirelysafe 1 14737 0 0 /news/551a9c0e476a0 2 15406 0 0 /news/ashford140116 1 14304 0 0 /news/mershyth120922 5 146535 0 0 /news/thewaitgoesonfordartsfans 1 13733 0 0 /news/ivehadanawfulrecordinthetrophyandihopetoputitrightsaysbromleybossmarkgoldberg 1 15704 0 0 /news/eastgrinstead121219 2 24403 0 0 /news/itsgoodtobeinapositiontooffercrystalpalaceagamesayswandsassistantjoefrancis 1 13873 0 0 /news/ramsofferteenagepaircontracts-exclusiveinterviews 1 15563 0 0 /news/551a95b3ebd3c 3 34962 0 0 /news/ksports050821 1 12956 0 0 /news/paulbarnes190618 2 33677 0 0 /news/mysackinghascomeasabitofashockadmitsleerichmond 1 13714 0 0 /news/kentleague/thamesmead/7thjuly03.html 2 0 0 0 /news/thebigkickoffkentleaguemanagersrelishopeningday-exclusives 1 17887 0 0 /news/wemustenjoyhomecomfortsinsistspatterson 1 20034 0 0 /news/saturdayssoccer25thfebruary2006 1 20357 0 0 /news/mainlefttonbridgeangelsforstifferchallenges 1 11648 0 0 /news/wp-content/plugins/casper/css.php 1 0 0 0 /news/erithbelv180915 1 12732 0 0 /news/SportsMinisterStatement180820 3 28604 0 0 /news/drmartens/eastern/tonbridge/16thaug03.html 1 0 0 0 /news/alliwanttodoisbeatramsgateinsiststakaloo 1 12297 0 0 /news/dockersclawthemselvesoffootoftable 2 14069 0 0 /news/551a97b2309b1 1 13878 0 0 /news/551a99e35f653 2 28212 0 0 /news/stonesheropauldesperateforfameandglory 1 14988 0 0 /news/GovernmentStatement070920 3 41749 0 0 /news/londonseniortrophyfinal2021fcelmstead280521 1 19647 0 0 /news/gillingham070822 1 18329 0 0 /news/551bc5e050a16 2 18833 1 0 /news/favasespecialsampsontellsvickersnottobottleit-exclusive 1 16103 0 0 /news/wecouldbeaforcenextyearsayscorinthiancoachmattlonghurst 1 14899 0 0 /news/drmartens/eastern/sittingbourne/aveley290904.html 1 0 0 0 /news/chatham061020 1 12260 0 0 /news/8thdec05.html 1 0 0 0 /news/soccershorts110720 2 36987 0 0 /news/erithandbelvedere.co.uk 1 0 0 0 /news/istillbelieveinthemagicofthefacupsayserithbelvederebossmickycollins 1 17455 0 0 /news/thamesmeadagreegroundsharedealwithdockers 1 12544 0 0 /news/soccershorts140521 2 32697 0 0 /news/daishvoiceshisconcernsovertrainingfacilitiesandbudget 1 18396 0 0 /news/croydon010819 1 11925 0 0 /news/551bc99dbe7a4/ryman/bromley/ryman/bromley/18thjuly03.html 2 15653 0 0 /news/theresnoweightonourshoulderssaysbromleyshaydenbird 1 14353 0 0 /news/sevenmaids160715 2 44277 0 0 /news/21stdec04.html 1 0 0 0 /news/dartford1-1carshaltonathletic-iamhappywedidntlosesaysburman 1 20017 0 0 /news/canterburysmith040615 2 17458 0 0 /news/crockenhill180915 2 16125 0 0 /news/gettingthroughwillbeagreatachievementsaysradbourne 1 15239 0 0 /news/floodsareahugeblowtotheclubsayshildenboroughcaretakerbossandrewmckechnie 1 14004 0 0 /news/iminlimboduringjanuarysalesadmitsdaish 1 14928 0 0 /news/kentfootballunited121118 1 14657 0 0 /news/bromley0-3chelmsfordcity-mistakeshavecostusthreegoalssaysdisappointedhaydenbird 1 37574 0 0 /news/anyonewhounderestimatesconcordrangerswilllosewarnsbromleycoachhugolangton 2 18842 0 0 /news/itsashamemorepeopledontcomeandsupportus-cugley 1 18697 0 0 /news/kentskelliedisciplineappointedasnextsecretaryoftheisthmianleague 1 14608 0 0 /news/wehaventgotalotofmoneytospendonastrikersayserithbelvederebosschriscosgrove 2 18745 0 0 /news/kentleague/thamesmead/13thaug04.html 1 0 0 0 /news/seveshep180323 5 185780 0 0 /news/dulwichhamlet211022 1 12670 0 0 /news/551bc99dbe7a4/kentleague/sevenoaks/drmartens/eastern/folkestone/hastvfolk151103.html 2 15653 0 0 /news/chatharl280315 2 54265 0 0 /news/warrilowmyaimistogetangelsflyinghigh-exclusive 1 18535 0 0 /news/descisiontimeloomsforsevenoakstownbosssimonjones 1 11449 0 0 /news/bexleyinvictaflytheflagforgay-friendlyfootballinkent 2 19615 0 0 /news/kentleague/VCD/19thaug04.html 1 0 0 0 /news/22ndjan05.html 1 0 0 0 /news/robbinssignstwomorefromashfordtown 1 14721 0 0 /news/doverathletic3-2dartford-wepulledtogetheraftermambosredcardadmitshessenthaler 1 28562 0 0 /news/rustchat110719 1 25850 0 0 /news/wellingunitedappointnewnumbertwo 1 10767 0 0 /news/holmesdale281119 1 10767 0 0 /news/sladegreenconsidertheirimmediatefuture-exclusive 1 12442 0 0 /news/upbeathumefanciesacupgiantkilling 1 25701 0 0 /news/bromebbs010118 1 29472 0 0 /news/beckenham101117 1 12170 0 0 /news/ibelievethatwecanturnthisaroundinsistsrusthallbosspaulmcdonagh 1 14370 0 0 /news/6thoct04.html 1 0 0 0 /news/weknowwhatwehavetodotostayupsaysmunday 1 22280 0 0 /news/youcantalwaysplayprettyfootballinthekentinvictaleagueadmitsashfordbosspaulchambers 1 14720 0 0 /news/551bc5dc2ab7d 2 21362 0 0 /news/greenwichborough1-2horleytown-wereattheendofweekoneandwereoutofthefacup-cox 1 21665 0 0 /news/551a9b481904c 4 28222 0 0 /news/chathamtown0-1ramsgate-millstakestheplaudits 1 17908 0 0 /news/craywanderers3-0haringeyborough-yougettothisstageofacupyouwanttowinit-francis 1 20703 0 0 /news/craytoot220217 3 75566 0 0 /news/3rdapr05.html 1 0 0 0 /news/crownalexandramovingagiantstepclosertobeingacceptedintokentinvictaleaguenextseason 1 15853 0 0 /news/wellingunited1-1teambath-fordruesbadweek 1 17459 0 0 /news/drmartens/premier/dover/29thoct03.html 1 0 0 0 /archive-2006-2014/141 1 19276 0 0 /news/greenwichborough2-2whitstabletownseagerourworsedefensivedisplayfor15months-exclusive 1 22957 0 0 /news/wevegotagoodblendofyouthandexperienceinthesidesaysmaidstoneunitedbossjaysaunders 1 15087 0 0 /news/fisher130716 1 13155 0 0 /news/551a99e4bed70 2 42852 0 0 /news/wardimhappywithmybudget-exclusiveinterview 2 15991 0 0 /news/sceflsponsor151119 1 11305 0 0 /news/551bc5e71389a 1 11927 0 0 /news/itwasaneasydecisiontosignfordartfordsaysrichardrose 1 12239 0 0 /news/peckpunj290417 1 30004 0 0 /news/wealwaysgointoeveryseasonwithaspirationstodobettersayscraysjoefrancis 1 13862 0 0 /news/551bc99a90ee7 2 17345 0 0 /news/youngstersreadytomaketheirmarksaysbinks 1 11761 0 0 /news/551a9b482aab6 4 36504 0 0 /news/greenwich200915 1 19599 0 0 /isthmian-league/62 2 36771 0 0 /news/551bc5e83ba86 2 17571 0 0 /news/ashfordtown3-1crowboroughathletic-lovellpleasedwithprogress 1 17144 0 0 /news/aveley101004.html 1 0 0 0 /news/drmartens/premier/welling/15thmar04.html 1 0 0 0 /news/ksports210417 1 12774 0 0 /news/4thdec05.html 1 0 0 0 /news/craywanderers200823 3 35297 0 0 /news/wp-content/plugins/seoo/alfa-ioxi.php 1 0 0 0 /news/551a97b07b58e 1 14003 0 0 /news/vcdathletic090523 3 19149 2 2 /news/idehill1-4ightham-thisteamcangoonanddominatethesevenoaksleaguesaysighthamboss 1 30843 0 0 /news/welling110616 1 12293 0 0 /news/dartkidd040115 2 33710 0 0 /news/corinthian281119 1 15123 0 0 /news/weneedsomeluckonfavasetrailadmitsford-exclusiveinterview 1 12528 0 0 /news/551a956bacfd7 1 3741 0 0 /news/soccershorts 1 28233 0 0 /news/mydreamistoplayinthepremierleaguesayssevenoakstownstrikerrichmondkissi 1 13521 0 0 /news/othernews/SECWFL250104.html 1 0 0 0 /news/thamdart160716 2 58681 0 0 /news/551a9677d7690 2 16452 0 0 /news/soccershortsebbsfleetgoalkeeperprestonedwardscalledupintoenglandsquad 1 25660 0 0 /news/holmtunb020222 1 33113 0 0 /news/lisneyrelishingmillwallvisit 1 23145 0 0 /news/15thmay04.html 1 0 0 0 /news/injuryravagedstonesawaitclearanceforirishmidfielder-exclusive 1 16920 0 0 /news/551a96dc06dfa 1 5279 0 0 /news/thebuckstopswithmesaysapologeticjustinluchford 1 11543 0 0 /news/folkestoneinvicta1hamptonrichmondborough2 1 17703 0 0 /archive-2006-2014/158 1 19217 0 0 /news/551bc5dfb5c6d 1 15050 0 0 /news/favasespecialfordwantshisunderdogstoreachvasefinal-exclusiveinterview 1 15434 0 0 /archive-2006-2014/63 1 20808 0 0 /slade-green-2003-2006/4 2 26800 0 0 /news/ebbsfleetunited4-0wellingunited-itwasmenagainstboysadmitssorryjamieday 1 33654 0 0 /news/551bc99dbe7a4/drmartens/eastern/dartford/ryman/bromley/7thdec03.html 2 15653 0 0 /news/551bc5e2c7337 1 10917 0 0 /news/551bc5e0d0627 1 13283 0 0 /southern-counties-east-football-league/5 2 40348 0 0 /news/wewantourlotterynumberstocomeupsaystitlechasingfrancis 1 15160 0 0 /news/crowborough020817 1 13045 0 0 /news/tonbridgeangels0-0stalbanscity-weneverdonothingeasyhereadmitstommywarrilow 1 35519 0 0 /news/551bc99c15842 2 31049 0 0 /news/551bc5e0f3629 1 17873 0 0 /news/drmartens/eastern/sittingbourne/lymingtonreplay070804.html 1 0 0 0 /news/551bc5dd9fc9a 1 13727 0 0 /news/ramsgatevdeal071003.html 1 0 0 0 /news/wewanttoestablishourselvesintherymanleaguesayshythetownbossscottporter 1 13602 0 0 /news/fansassistmargatewithgroundimprovements 1 11903 0 0 /news/graystonb060116 2 22907 0 0 /news/wedontwantteamscomingtoreachfieldsandwinningsayshythetownbossscottporter 1 17224 0 0 /news/wewanttogoonanunbeatenrunsaysobrien 1 16950 0 0 /news/beckenhamtown4sladegreen0 2 19492 0 0 /news/fisher3-2canterburycity-ithinkwellturnitoversayscanterburycitybossadegower 1 27578 0 0 /news/canterbury240319 1 15811 0 0 /news/551bc99dbe7a4/drmartens/premier/welling/drmartens/eastern/sittingbourne/newportvsitt261003.html 2 15653 0 0 /news/dealtown180721 1 12336 0 0 /news/551bc5e0ab8c8 1 13261 0 0 /news/ferkinsbringshistrustedteamwithhimtogreenwichborough-exclusive 1 13969 0 0 /news/othernews/selsey17thjuly03.html 1 0 0 0 /news/tonbridgeangels3-0heybridgeswifts-bosspleasedwithpowellsswiftfinish-exclusive 1 19692 0 0 /news/lordswood150305.html 1 0 0 0 /news/drmartens/premier/welling/7thjuly03.html 1 0 0 0 /news/crayvalley061117 1 13186 0 0 /news/tunbridgewells091118 1 13988 0 0 /news/wehavetorespondtoback-to-backdefeatssaysfavershamtownbossrayturner 1 11974 0 0 /news/werenotgoingtowinitbutyouwanttostayinitforaslongasyoucansaystommywarrilow 1 16824 0 0 /news/ryman/bromley/30thjuly03.html 2 0 0 0 /news/braintree250916 2 15132 0 0 /news/lovellhashighhopesfornewstriker 1 14423 0 0 /news/tophalfiswhatimlookingatsaysrusthallbosspaulmcdonagh 1 13664 0 0 /news/erithbelv191115 1 13765 0 0 /news/drmartens/eastern/sittingbourne/sittvburn081103.html 1 0 0 0 /news/bromtoot051015 2 36635 0 0 /news/erithbelvedere3hythetown1 1 14100 0 0 /news/fitnesshasgottobebetterbecausewereplayingfull-timeteamssaysdartfordspaulsawyer 1 13097 0 0 /news/allantaitwillenjoyhisfootballheresaysfolkestoneinvictabossneilcugley 1 18961 0 0 /news/canterburyappointversatilecoachdobson 1 12468 0 0 /news/sct070518 1 14225 0 0 /news/craywands060917 3 29025 0 0 /news/battleofthanettrottstillinshock-wardwantslocalbraggingrights-exclusiveinterviews 1 19328 0 0 /news/charltonathletic080622 1 13177 0 0 /news/kentleaguepairsnapuprymanleaguemidfielders 1 12541 0 0 /news/17thaug04.html 1 0 0 0 /news/margbill210418 2 56105 0 0 /news/sheppey201017 1 12641 0 0 /news/dockerspraisedforstagingwomensinternational 2 14451 0 0 /news/551bc5de7511d 1 13909 0 0 /news/favershamtown3-0hythetown-theboysexecutedthegameplanbrilliantlysaysrayturner 1 30704 0 0 /news/kentleague/tunbridgewells/tunvlordswood130803.html 1 0 0 0 /news/cugleywemustimproveourgoalscoring 1 14866 0 0 /news/kentleague/maidstone/24thfeb04.html 1 0 0 0 /news/springettboostforlovellfortrophytieatbognorregis 1 14148 0 0 /news/drmartens/premier/welling/dartford091104.html 1 0 0 0 /news/dulwich070916 3 32073 1 1 /erith-belvedere-2003-2006/4 4 40279 0 0 /news/sheppeyunited030522 1 16493 0 0 /news/resultsmarch2009 1 21355 0 0 /news/gillingham030117 3 27393 0 0 /news/551bc5e82bccb 2 27976 0 0 /news/551bc5dd6b7a4 2 16502 0 0 /news/wewanttogetoutofthekentleaguesaysporter 1 22437 0 0 /news/othernews/SECFLTABS020204.html 1 0 0 0 /news/faallocations120522 2 26331 0 0 /news/sittingbourne260918 2 29066 0 0 /news/bromley140322 5 58988 0 0 /news/sevenoakstown3-2hythetown-weturnedupwiththewrongattitudeadmitsporter 1 20436 0 0 /news/greenmill290716 2 58576 0 0 /news/pre-seasontraininghasbeengoingwellsayscrayvalleybossstevechapman 1 13838 0 0 /news/sittingbournesnapuphighly-ratedgoalkeeperreed 1 13339 0 0 /news/551bc5e6c71de 1 23621 0 0 /news/551a97b2707dd 1 15366 0 0 /news/551a931e1b131 2 28402 0 0 /news/sittingbournesufferanothervandalismattackatbournepark 1 12361 0 0 /news/crowborough261218 1 13927 0 0 /news/rustholm040821 2 45628 0 0 /news/551bc5e496bc4 1 10845 0 0 /news/551a9718bb07d 3 25862 0 0 /news/molesey1-5sittingbourne 1 15152 0 0 /news/551bc5e2e328d 1 12453 0 0 /news/othernews/Tables.html 1 0 0 0 /news/dartford1-0wellingunited-mybestmomentinfootballmanagementsaysproudtonyburman 1 25059 0 0 /news/551bc99ce0b69 2 19332 0 0 /news/trottlookingforcapitalgains 1 12348 0 0 /news/drmartens/eastern/erith&belvedere/carterton210904.html 2 0 0 0 /news/chatham260220 1 15886 0 0 /news/greenwich171217 1 14275 0 0 /news/chathamtown3wingatefinchley1exclusiveinterview 2 28158 0 0 /news/j'darcy260804.html 1 0 0 0 /news/sittingbourne0-0bathcitylovellpleasedwithdrawasbathrunsdry-exclusiveinterview 1 16239 0 0 /news/isaidtothechairmaniwillwintheleagueforhimsaysgreenwichboroughbossianjenkins 1 17916 0 0 /news/sheppey260617 1 13469 0 0 /news/walthamforest290105.html 1 0 0 0 /news/welldul040817 1 24468 0 0 /news/551bc5e46c9f5 2 17746 0 0 /news/folkestoneinvictafansplaytheirheroestoraisemoneyforinjuredstrikerpauljones 1 12329 0 0 /news/margate301116 2 20628 0 0 /news/margate060619 2 23619 0 0 /news/sittingbourne180119 2 28673 0 0 /news/itsabouttimewehadsomeluckadmitsmoore 1 12815 0 0 /news/ksports090222 2 18204 0 0 /news/folkavel151122 2 58027 0 0 /news/kentleague/sladegreen/sladegreen.html 1 0 0 0 /news/ebbsfleetunitedtakeoverdrawsastepcloser 1 12035 0 0 /news/ianjenkinspoundsthestreetsoflondontoraisefundsforcharity 2 16407 0 0 /news/visitingsideswillraisetheirgamesatprincesparkwarnsburman 1 13503 0 0 /news/kentleague/deal/Sampson5.html 2 0 0 0 /news/wevegottopickourselvesupsaysbitterlydisappointedyorath 1 14488 0 0 /news/burmandelightedwithcasscapture 2 12931 0 0 /news/miltonkeynesdons1-0doverathletic-ithinkwecouldvegotsomethingadmitschriskinnear 2 40305 0 1 /news/drmartens/eastern/folkestone/folkvflee181103.html 1 0 0 0 /news/551bc5e4a3424 1 18090 0 0 /news/farnborough070218 1 11194 0 0 /news/551a979ac4a14 1 4998 0 0 /news/wardaimstotakeramstocupfinal-exclusive 1 12489 0 0 /news/imlearningaswellastheplayerssayshernebaybosssimonhalsey 1 14244 0 0 /news/bromley200915 2 23609 0 0 /news/fordunveiledasnewwingsboss 1 12169 0 0 /news/551bc5df87596 1 15968 0 0 /news/itshurtmetostopplayingformycountrysaysashleycole 1 11562 0 0 /news/ramsgate040620 3 26321 0 0 /news/margate200905.html 1 0 0 0 /news/patientmcmahonfinallycapturesprolificstrikerconstable 1 20489 0 0 /news/tunwells070216 1 14059 0 0 /news/hugolangton090618 1 17307 0 0 /news/sladegreensdemiseopeneddoorforcontroversialcorinthianmove 1 14071 0 0 /news/warrilowhavefaithinrook 1 17353 0 0 /news/greendork040217 2 60974 0 0 /news/dartford1-1doverathletic 1 16403 0 0 /news/wehavetowinourbattlestobeatnewcastlebenfieldsayshernebaybosssimonhalsey 1 17684 0 0 /news/tonbridgeangels5-1eastbourneborough-itsthebestweveplayedsaystommywarrilow 1 22223 0 0 /news/12thjune05.html 2 0 0 0 /news/13thjuly05.html 1 0 0 0 /news/theroadtowembley 1 28064 0 0 /news/stonesbegintheirjourneybackhomethisyearvowschairman 1 11427 0 0 /news/theicingonthecakeistocomehopefullysayspromotionchasingdartfordbosstonyburman 1 14002 0 0 /news/craywanderers220322/ 3 30337 1 1 /news/theresnowayweretakingthefootofthepedalsayswarrilow 1 14223 0 0 /news/ebbsfleetunitedyourviews 1 10152 0 0 /news/milesswoopsforformerfavershamskipperholder 1 20681 0 0 /news/crayvalley3-1greenwichborough-weregoingtorunitlikeaproperprofessionalclub-jones 1 32502 0 0 /news/drmartens/eastern/erith&belvedere/7thjuly04.html 1 0 0 0 /news/craywands240616 3 35915 0 0 /news/wearedeterminedtobuildforthefuturesaysstonesbossjaysaunders 1 13018 0 0 /news/551bc99b08100 2 15115 0 0 /news/wecouldfoldinayearifwedonthaveanyfinanceswarnsthamesmeadtownmanagerkeithmcmahon 1 22041 0 0 /news/afccroy210316 1 13123 0 0 /news/craybaff050119 1 30322 0 0 /news/fleetmarchingtothewembleyarchfleetfanswillhelpusprogresssaysstrikereribenne 1 17458 0 0 /news/tootingmitchambossisoutoforderforapproachinglaurenthamiciclaimsjoefrancis 1 14555 0 0 /news/wevegottobuildonourcupsuccesssaysford 1 13210 0 0 /news/mersmarg121021 6 163927 0 0 /news/551a9798718b9 2 21214 0 0 /news/wealddart170218 1 28365 0 0 /news/551bc99dbe7a4/othernews/kentleague/tunbridgewells/7thjuly03.html 2 15653 0 0 /news/othernews/fat1stnov.html 1 0 0 0 /news/thebigfreezecoldsnapwipesoutallkentfootball 1 16421 0 0 /news/sittingbourne3-1waltoncasuals-wehaveonehellofachanceofmakingtheplay-offs-abbott 1 14788 0 0 /news/551a96779a886 2 22786 0 0 /news/dulwich040116 2 27514 0 0 /news/croydon250222 1 12699 0 0 /news/ithinkwereaheadofscheduleadmitsvcdathleticbosstonyrussell 1 15668 0 0 /news/tonbridge091117 3 36605 1 1 /news/werebasicallystartingagainadmitsvickersbossbennett 1 16896 0 0 /news/551bc99dbe7a4/drmartens/eastern/chatham/othernews/pitches25thjuly03.html 2 15653 0 0 /news/wehavetotrytosavetheclubfromrelegationsayskeithbird 1 15571 0 0 /news/theresnopressureonmeormyplayerstogoupsaysneilcugley 1 14422 0 0 /news/folkestoneinvicta0-3carshaltonathletic-wemissourkeymenadmitscugley-exclusive 1 20150 0 0 /news/thamesmeadtowngivengoaheadfor4mredevelopmentofbaylissavenue 1 12592 0 0 /news/iwantmyteamtobeanharduglyhorribleteamtoplayagainstsayswhitstablebosspeternott 1 12431 0 0 /news/551a97b137d6b 1 14353 0 0 /news/stanflac121220 4 119634 0 0 /news/faversham270416 2 36458 0 0 /news/kentleague/VCD/vcdvwhitstable120803.html 1 0 0 0 /news/metrogas250521 2 17207 0 0 /news/whitstable240820 2 25805 0 0 /news/erithbelvedere4-5wealdstone-bravederessufferlateheartbreak 1 16704 0 0 /news/chathamtownbeginsearchforheadofyouthandjuniorfootball 1 18319 0 0 /news/14thaug03.html 1 0 0 0 /news/faissuehanwelltownonefinalchancetostagefavasetie 1 13900 0 0 /news/551bc5e4176a9 1 16591 0 0 /news/southallpleasedwithmargatesresponse 1 16335 0 0 /news/spenbrom060318 1 12204 0 0 /news/dartford0-0edgwaretown-wedidntdoourselvesjusticeadmitsburman 1 17203 0 0 /news/thamesmeadtown3-7portsmouth-itwasadreamforustogetthisfarsaysprouddannyharris 1 30059 0 0 /news/kentleague/hythe/hythevslade081103.html 1 0 0 0 /news/551bc5e8ef4c2 1 16136 0 0 /news/551a95b41b5d8 3 40492 0 0 /news/ebbsfleetunited2-3afcwimbledon-exdoverstarsammymooresendsebbsfleetcrashingout 1 23274 0 0 /news/edgwaretown2-1dartford-dartswintitleonemotionaldayandburmansaysimproudaspunch 1 20782 0 0 /news/551a96db6d0f0 4 42511 0 1 /news/kentclubsbeginmagicalfacupjourney-exclusiveinterviews 1 24753 0 0 /news/drmartens/eastern/sittingbourne/sittverit181103.html 1 0 0 0 /news/doverathleticsettoannouncebigsummersignings 1 16818 0 0 /news/lordswoodunveilsimonhalseyastheirnewboss 1 14841 0 0 /news/facupfirstrounddrawtheplayersmustputinagoodperformancetosetupvaleclash-burman 1 18250 0 0 /news/ilford1-3chathamtown-wedontwanttounderachievethisseasonsaystable-toppingkevinwatson 1 24700 0 0 /news/itsalwaysnicetocomeupagainstateamyouhadanassociationwithsaysbromleysneilsmith 1 16227 0 0 /news/orpington180915 1 11505 0 0 /news/faversham211119 2 25195 0 0 /news/charlton110620 3 37190 0 0 /news/resultsjulyaug2022 2 89857 0 0 /news/erithbelvedere1-2tonbridgeangels-iwantmoregoalsdemandswarrilow 1 28106 0 0 /news/soccershortsstoneslaunchcarshareschemetogettohomelands 1 45006 0 0 /news/soccershortsmargateappointyorathasdirectoroffootball 1 13726 0 0 /news/margdulwposf1201515 3 51122 1 0 /news/551bc5d95c137 4 35000 1 0 /news/551bc5dc603be 3 46713 0 0 /news/wevedonewelloutofstuartzanonetransfersaysvcdathleticbosstonyrussell 1 16689 0 0 /news/551bc99bb4feb 2 21896 0 0 /news/kinnearsignsthurrockgoalkeeperonloan 1 10587 0 0 /news/imlookingforatophalffinish-iftheplayersworkhardsaysrusthallbosspaulmcdonagh 1 13752 0 0 /news/hythetownbossscottporterunveilsryanrooksigning 1 11879 0 0 /news/bromley020618 2 18027 0 0 /isthmian-league/36 3 45559 0 0 /news/kentleague/thamesmead/thamesmead.html 1 0 0 0 /news/wellingtown140522 1 12043 0 0 /news/erithtown200915 1 14118 0 0 /news/wellingsignformernorthernirelandinternational 1 11366 0 0 /news/kentleague/whitstable/20thJan04.html 1 0 0 0 /news/551bc99dbe7a4/kentleague/erithtown/kentleague/tunbridgewells/17thjuly03.html 2 15653 0 0 /news/drmartens/premier/dover/worthing240804.html 2 0 0 0 /drmartens/eastern/tonbridge/3rdjune05.html 1 9955 0 0 /news/doverathleticexpectbumpercrowdforgillsvisit 1 12965 0 0 /news/wellingwellard051215 1 16819 0 0 /news/7thJan04.html 1 0 0 0 /news/551a967722788 2 19071 0 0 /news/thefacaremoreaboutenglandthantherestofusfumesfolkestoneinvictasecretary 1 15039 0 0 /news/ramsgate300619 2 25516 0 0 /archive-2006-2014/152 1 19323 0 0 /news/551bc5e91e0e9 1 15535 0 0 /news/theresabigincentivetobeatwhitstableinfatrophysayshythetownbossscottporter 1 15094 0 0 /news/wsoyanz.php 1 0 0 0 /news/werelookingtowinsowedonthavetoworryaboutanyoneelsesaysneilcugley 1 13896 0 0 /news/beck030915 1 12043 0 0 /news/thefatrophyismassivelyimportantforclubsatourlevelsaysramsgatebosstimdixon 1 14814 0 0 /news/hythfave100423 2 65805 0 0 /news/horncray260423 2 67489 0 0 /news/fanstakeupchairmansearlychristmaspresent 1 13918 0 0 /news/gillinghamladiesbeginsearchfornewmanager 1 16262 0 0 /news/doverathletic010621 1 11506 0 0 /news/551a99e341f32 2 30830 0 0 /news/dulwilson160515 2 31334 0 0 /southern-counties-east-football-league/60 1 19470 0 0 /news/lovellshownthedoorbydolby 1 14398 0 0 /news/mittenexpectedtoreturnforgatesmelbournedebut 1 13804 0 0 /news/sevenoakstown190822 2 25145 0 0 /news/551bc5ddab59a 1 14719 0 0 /news/itsmyjobtogivefisheritspridebacksaysbillywalton 1 17681 0 0 /news/ifwegetsloppyhitchinwillpunishuswarnstonbridgeangelsbosstommywarrilow 1 17353 0 0 /news/therewillbeaturningpointsaysfrustratedobrien 1 14708 0 0 /drmartens/eastern/sittingbourne/maidstone020805.html 1 9955 0 0 /news/wellingunited3-2tonbridgeangels-bestweveplayedforalongtimesaysjackparkinson 1 24531 0 0 /news/chatham250816 3 30339 0 0 /news/glebe210321 4 46694 0 0 /news/bromley301215 2 16118 0 0 /news/romford1-0chathamtown-werenotmeetingourexpectationsadmitskevinwatson 1 17062 0 0 /news/sittingbourne250915 2 25770 0 0 /news/wingatefinchley2chathamtown0sat29thapril2006 1 12120 0 0 /news/ebbsfleetunited2-1dartford-imdelightedthatwevecameoutontop-liamdaish 1 27060 0 0 /news/551a931dc97c6 1 13468 0 0 /news/ramsgate241120 2 24247 0 0 /news/crayvalley130217 1 12986 0 0 /news/halls290516 1 13735 0 0 /news/walton230805.html 1 0 0 0 /news/kentseniortrophyfinalourtrophyfaminewillcometoanendvowsbeckscoachhughes 1 15263 0 0 /news/wewillgivewhitehawkarunfortheirmoneysaysfavershambossjustinluchford 1 19856 0 0 /news/drmartens/eastern/folkestone/29thsept03.html 1 0 0 0 /news/facupspecialkentclubsembarkontheroadtowembley-exclusivepreviews 1 21773 0 0 /news/drmartens/eastern/chatham/10thjuly03.html 1 0 0 0 /news/551a9678a6f59 3 37366 0 0 /news/soccershorts040716 2 42285 0 0 /news/craychairmanfightstokeephislover 1 15389 0 0 /news/folkestoneinvicta1-1chathamtown-thewindspoiltthegameadmitrivals 1 19462 0 0 /news/youcangooutandmakeanameforyourselfinthefacupsaysderesbossmickycollins 1 12425 0 0 /news/21stnov04.html 2 0 0 0 /news/fisher280722 1 14096 0 0 /news/sittingbourne241218 2 28761 0 0 /news/borehamwood2-1wellingunited-tonightisnotgoingtowinorlosetheleaguesaysjamieday 1 21998 0 0 /news/ashfordunited1-2phoenixsports-wevegotachancenowwehavetotakeitsaystonybeckingham 1 29869 0 0 /news/tonbridgeangels090220 1 12205 0 0 /news/sevehyth030122 6 155868 0 0 /news/551bc5dd672d3 2 21138 0 0 /news/iwouldlovenothingmorethanforustowinapieceofsilverwaresaysgillsbossjamesmarrs 1 16424 0 0 /news/weneedatrainingvenuetoimproveourplaysayshume 1 16145 0 0 /news/ashfcrow010417 1 34431 0 0 /news/551bc99befeb4 2 19358 0 0 /news/ashfhyth061121 6 195355 0 0 /news/doverathleticprepareforbarnettest 1 15942 0 0 /news/weneedtohaveawinningmentalitysaystunbridgewellsbossmartinlarkin 1 16562 0 0 /news/tonbridgeangelspmargatep 2 14039 0 0 /news/sevenches170916 1 31344 0 0 /news/maidstoneunited2hythetown1-stoneschairmaninowhavekeystonewstadium 1 16786 0 0 /news/551a979b09d2f 1 5073 0 0 /news/whitstabletown1-0ramsgate-wewanteditmoresayslane 1 17975 0 0 /news/551bc99dbe7a4/conference/margate/kentleague/ramsgate/17thdec03.html 2 15653 0 0 /southern-counties-east-football-league/56 1 19224 0 0 /news/kentleague/thamesmead/21stjuly04.html 1 0 0 0 /news/pennockpraisesteamfortengameunbeatenrun 1 11583 0 0 /news/551bc5e093b3d 1 21383 0 0 /news/vcdathletic2-0walthamabbey-ithinkwevegotachancetodoitsaysvcdbosstonyrussell 1 25577 0 0 /news/guttedburmanseesdartsunbeatenstartgo 1 19632 0 0 /news/ashford090218 3 28161 0 0 /news/maidstone120218 1 14465 0 0 /news/whitstabletownscoopbarryeasttrophyforflyingtherymanleagueflaginfatrophyrun 1 13451 0 0 /news/croydon071122 6 71072 0 0 /news/551a9b4830545 5 30207 0 0 /news/billericay191105.html 1 0 0 0 /news/551a96dc1f5f6 3 36272 0 0 /news/551a9250c6279 2 16478 0 0 /news/drmartens/eastern/folkestone/harrow280804.html 1 0 0 0 /news/551a9c932eef2 3 35130 0 0 /news/551bc99dbe7a4/kentleague/sevenoaks/kentleague/whitstable/7thjuly03.html 2 15653 0 0 /news/551bc5dacb7e3 4 44182 0 0 /news/erithbelvedere2dealtown1 1 12538 0 0 /news/tonbridgeangels0-1newportcountybraveangelsreflectonwhatwouldhavebeen 1 18761 0 0 /news/weowethepoliceoneafterawaydefeatsaysabbott 1 15992 0 0 /news/daishwantstransferwindowscrapped 2 16026 0 0 /news/weneedtoturndrawsintowinssayswhitstabletownbosspeternott 1 14779 0 0 /news/signinganewstrikermighttakeabitoftimesaysdartfordbosstonyburman 1 13905 0 0 /news/crayvalleypm1-0chathamtown-ivegottogetagreatteamtogethersaysstevechapman 1 28099 0 0 /news/wevetoldthechairmanwerestayingheresayssittingbournebossgaryabbott 1 24340 0 0 /news/crowseve300418 1 11562 0 0 /news/letsgetthispartystartedscreamstitle-winningdartfordcaptain 1 12802 0 0 /news/favsf080617 1 12951 0 0 /news/hollands&blair130920 1 16039 0 0 /news/bromleians030618 2 14001 0 0 /news/bromley090821 2 15937 0 0 /news/eastbournetown1-0corinthian-itsamissedopportunityfortheclubadmitsmattlonghurst 1 27266 0 0 /news/arestonesfansthemostdevotedinkent 1 12976 0 0 /news/berkhamsted150105.html 1 0 0 0 /archive-2006-2014/101 1 20383 0 0 /news/wellcomethroughourbadpatchvowsburman 1 14097 0 0 /news/wellingunitedfanslaunchboostthebudgetscheme 1 13549 0 0 /news/nickyforsterisagreatmanmanagerandmotivator-doverchairmanjimparmenter 1 13144 0 0 /news/holmesdale3-2beckenhamtown-hughesgivesbeckenhamanelectricshock 1 20575 0 0 /news/551bc5e3526b4 1 17791 0 0 /news/551a9c92a9fed 2 15541 0 0 /news/craywanderers2-0hastingsunited-wevegottobelievethatwereagoodsidesaysmichaelpaye 2 32200 0 0 /news/sittingbourne2-0whitehawk-nooneexpectedustowinadmitsjoedowley 1 21779 0 0 /news/551bc5e255749 1 13061 0 0 /news/iwillnottoleratepoordisciplinenextseasonsaysdolby 1 13137 0 0 /news/wevegottoberuthlessinthefacupasyougetnosecondchancesayschathambosskevinwatson 1 13651 0 0 /news/gillsunveilstimsonasnewboss 1 11551 0 0 /news/wevegottobeatourbesttowinitsayscorinthianbosstonysitford 1 14434 0 0 /news/tunbridgewells101221 1 12316 0 0 /news/punjab230519 1 12393 0 0 /news/snodland171116 1 12914 0 0 /news/margate190705.html 1 0 0 0 /news/luchfordwemustcontinueourwork-ethic 1 15377 0 0 /news/stocthat200518 1 16304 0 0 /news/managerhaydenbirdpartscompanywithbromley 1 11834 0 0 /news/exgillsaundersenticeshowelltofolkestone 1 15198 0 0 /news/551bc99dbe7a4/ryman/bromley/kentleague/sladegreen/chessingtonvsladefr260703.html 2 15653 0 0 /news/favershamtownandcroydonacceptedintokentleague 2 15519 0 0 /news/dulkin200317 2 57420 0 0 /news/thamesmeadsplashout10000aheadofrymanleaguedeadline-exclusive 1 13618 0 0 /news/551a9797e9a50 2 21468 0 0 /news/maidvfolk171203.html 1 0 0 0 /news/cordicehasntgivenuphopeonhisnumberonetarget 2 21307 0 0 /archive-2006-2014/62 1 20908 0 0 /news/elmstead171116 1 11866 0 0 /news/othernews/KYLFIX020204.html 1 0 0 0 /news/burmanwantstoenjoythenextsevendays 1 15671 0 0 /news/thebigkickoffwereontherighttracktowintitleinsistsmcmahon-exclusive 1 18821 0 0 /news/daishworriedasfixturesstarttopileup 1 12463 0 0 /news/ashfordtown0-2craywanderers-jenkinstargetssecondplace 1 14082 0 0 /news/dulwichhamlet121219 1 11840 0 0 /news/doverathleticannounceticketdetailsforhistoricfacuptieathuddersfieldtown 1 17430 0 0 /news/551a95b36e8b4 2 18418 0 0 /news/drmartens/eastern/folkestone/10thsept04.html 1 0 0 0 /news/racefortherymansaundersretiresfromplayingkentleaguefootball-exclusive 1 17571 0 0 /news/milespleasedwithopeningdaypoint-exclusive 1 15306 0 0 /news/wellingtown301119 1 14478 0 0 /news/chathamtakeapoint-anddenness-fromashford 1 13335 0 0 /news/551a979891706 2 22716 0 0 /news/tompkinsineedmenaroundme-exclusive 1 15096 0 0 /news/albiebarkerquitsasdealtownboss 2 18187 0 0 /news/orpington191115 1 13411 0 0 /news/wellslinkupwithforesterstodeveloplocalpotential 1 11885 0 0 /news/daishillhavenosleeplessnightsifwegodown 1 11572 0 0 /news/ebbsfleetunited4-0bromley-iapologiseforouroverallperformancetonightsaysmarkgoldberg 1 31105 0 0 /news/wemustbouncebacktonightinsistsseager 1 14518 0 0 /news/kentleague/sevenoaks/22ndaug04.html 1 0 0 0 /news/quartetsigncontractstostabilisedartford-exclusiveinterview 1 11255 0 0 /news/policewelcomestrikeramoako 1 10784 0 0 /news/burmanwantstoupsetplay-offchasingteams 1 12970 0 0 /news/craywands250616 3 39588 0 0 /news/theseasonsaimisonlyhalfdonesayslyddtowncoachliamsmith 1 12459 0 0 /news/ferkinsstrugglestorebuildborosquad 1 12368 0 0 /news/lyddtown201023 2 24884 0 0 /news/wevegotabighurdletocrosstogettowembleysayshernebaybosssimonhalsey 1 15966 0 0 /kent-county-league/10 3 41604 0 0 /news/stroutsreturnstostoneswithmyblessingsaysseager 1 11230 0 0 /news/hythetown1-1holmesdale-stalemateleavesdooropenforvickers 1 14917 0 0 /news/weneedtotakeourchancessaysguest 1 16648 0 0 /news/551bc99db2d79 2 25417 0 0 /news/angelsdayofdestinywearereadyforpromotionchairmanstevechurcher 1 15975 0 0 /news/lewestonb300915 2 52284 0 0 /news/bromdag170418 1 28516 0 0 /news/wevegotagoodchanceoftryingtofinishinthetophalfsaysthamesmeadbosskeithmcmahon 1 16123 0 0 /news/551a9718ece0f 3 40783 0 0 /news/551a931d99512 1 13206 0 0 /news/chathamtownfc.info 1 0 0 0 /news/barnettmaintainsimpressiveform 1 11533 0 0 /news/551bc99be8e41 2 28144 0 0 /news/thurrock0-2doverathletic-hessenthalertargetsgillspair 1 21339 0 0 /news/beckcroy03032020 3 58110 2 2 /news/commerciallyitsextremelyimportanttoreachfacupfirstroundsaysbromleybossmarkgoldberg 1 12865 0 0 /news/iwillbringthestonesbackhomevowschairman 1 12861 0 0 /news/k%20sports020819 1 13305 0 0 /news/farnborough070318 1 14073 0 0 /news/bromley3wealdstone2exclusiveinterview 1 5704 0 0 /news/maidstoneunited2-1burgesshilltownweneedyoursupportathomeinsistsstoneschairman 1 18779 0 0 /news/551a9250a6464 2 15013 0 0 /news/ashfordunitedf.com 1 0 0 0 /news/tigersunveilformerclaptontrioastheirnewmanagementteam 1 11319 0 0 /news/therewillbeareactionbecauseivetoldtheminnouncertaintermswhatiexpectsayssitford 1 16087 0 0 /news/kentleague/thamesmead/26thjuly04.html 1 0 0 0 /news/doverathleticbosschriskinnearisstilllearningabouthissquad 1 16697 0 0 /news/bearsted100716 1 15133 0 0 /news/margateinvitesupporterstopublicmeetingtodiscusshartsdownparkredevelopment 1 12995 0 0 /news/551bc99dbe7a4/kentleague/ramsgate/kentleague/cray/crayvrams081103.html 2 15653 0 0 /news/bromley030721 5 62556 0 0 /news/severams110918 2 73385 0 0 /news/12thsept04.html 1 0 0 0 /news/wellgotoramsgateingoodspiritssayswhitstabletownbossjustinluchford 1 11961 0 0 /news/cantknap121215 1 28821 0 0 /news/pre-seasonresults-summer2012 1 33719 0 0 /news/croydon070319 1 12245 0 0 /news/kentfootballfixtureswc230106 1 15615 0 0 /news/cablestillintwomindsabouthisfuture-exclusive 1 14431 0 0 /news/eastthurrockunited0folkestoneinvicta2 1 13803 0 0 /news/shearersignsforfavershamtown 1 14323 0 0 /national-league/22 2 23774 0 0 /news/551bc99dbe7a4/drmartens/eastern/folkestone/kentleague/tunbridgewells/17thjuly03.html 2 15653 0 0 /news/bromley240821 5 66597 0 0 /news/14thnov05G.html 1 0 0 0 /news/itwillbespecialtoplayatpriestfieldstadiumsaysemmatune 1 23748 0 0 /sporting-2003-2006 14 145889 1 0 /news/fcelmstead291216 1 12290 0 0 /news/holmgreen120815 1 40114 0 0 /news/bromley3-1sevenoakstown-wererelyingonotherstowintheleaguesaysbromleybosskeithbird 1 27291 0 0 /news/sct280816 1 12377 0 0 /assets/js/ 1 3489 0 0 /news/2ndaug04.html 1 0 0 0 /news/ryman/bromley/1stsept03.html 1 0 0 0 /news/ashfordownerwelcomesstonesbacktohomelandsstadium 1 14646 0 0 /news/greeniesfridaypreview-canwhitstablecauseashockovermargate 1 19562 0 0 /news/werelookingatlong-termgrowthratherthanshort-termglorysaystonybeckingham 1 14270 0 0 /news/bromley190318 1 18744 0 0 /news/lordswood150219 1 12013 0 0 /news/stochart130621 4 77994 0 0 /news/wevegotverylittletoloseandanawfullottogainsaysfavershamtownbossrayturner 1 15245 0 0 /news/551bc99dbe7a4/kentleague/cray/drmartens/eastern/erith&belvedere/23rdjune03.html 2 15653 0 0 /news/holmphoe290323 1 31599 0 0 /news/seanmuggeridgetakessolechargeaftersimoncolbranquitscrowboroughathletic 1 12475 0 0 /news/28thmar04A.html 1 0 0 0 /news/facupfourthqualifyingrounddraw 1 11412 0 0 /news/551bc5e1e01fb 2 19248 0 0 /news/countdowntokick-offyourguidetosaturdayspitchinspections 1 14607 0 0 /news/craywanderers1-2metropolitanpolice-jenkinstellshisplayerstolettheirhairdown 1 20413 0 0 /news/pennockwereexpectingatoughnight 1 12651 0 0 /news/tunwells030816 1 12208 0 0 /news/551a931e251e7 1 13879 0 0 /news/551a9c91bc449 3 37210 0 0 /news/livetextdartford1-0maidstoneunited 1 23003 0 0 /news/kentleague/sevenoaks/21stoct04.html 1 0 0 0 /news/craywands030118 3 35659 0 0 /news/551a9799754df 1 4679 0 0 /news/551a96dba40bc 1 4173 0 0 /news/ourplayersbelievewecanwinboththeleagueandfavasesaysphoenixsportsbosssteveoboyle 2 22152 0 0 /news/facarlsbergtrophyandvasedraws 1 11164 0 0 /news/ashfordtownsyouthsidesneedtosecurefinancialpackagetoplayathomelands 1 15507 0 0 /news/greenwich060418 2 32026 0 0 /news/gillsdesperatetoendtenmonthwait 1 10490 0 0 /news/551bc5e5efe3d 1 15473 0 0 /news/drmartens/eastern/folkestone/eastleigh250904.html 1 0 0 0 /news/ryman/bromley/19thsept03.html 1 0 0 0 /news/folkglou021021 5 151340 0 0 /news/holmesdale080319 1 13721 0 0 /news/sittingbournevwhyteleafe130903.html 1 0 0 0 /news/551bc5e17d98e 2 28517 0 0 /news/maidstoneunited3-0wingatefinchley-wecanplaybetterthanthatsaysjaysaunders 1 28100 0 0 /news/royalistsareabananaskinwarnsbromleybosswakeling 1 12117 0 0 /news/551a96dbc2ae7 1 3517 0 0 /news/sittingbourne050815 2 27380 0 0 /news/ihopeworthingrespectusaswecanscoregoalswarnsbeckenhamtownassistantmichaelmarks 1 12934 0 0 /isthmian-league/16 3 45813 0 0 /news/bromley1fisherathletic2 1 5574 0 0 /news/1stmay05.html 1 0 0 0 /news/werekeepingourfeetonthegroundinsistslovell-exclusiveinterview 1 14115 0 0 /news/sevenoaks130815 1 15861 0 0 /news/drmartens/eastern/dartford/14thnov04.html 1 0 0 0 /news/crowborough210518 1 13913 0 0 /news/kentreliancesponsorkentseniorcupwithprizemoneyupforgrabsforfinalists 1 15250 0 0 /news/chatham140719 1 14753 0 0 /news/kentfootballunited120818 1 11658 0 0 /news/playallkentcupfinalsatprincesparkpleadswhitstablechairman-exclusiveinterviews 1 13234 0 0 /news/stoneschairmanwritesoffhispersonalloanstotemptnewinvestors 1 13653 0 0 /archive-2006-2014/127 1 19074 0 0 /news/bromfolk061016 3 74894 0 0 /news/coricant031118 1 43218 0 0 /news/3rdfeb05.html 1 0 0 0 /news/no-onesplaceinthesideissafesaysinvictabosscugley 1 17140 0 0 /news/beckenhamtown3-0erithtown-wejustwentthroughthemotionsadmitstonyrussell 1 25497 0 0 /news/ashfordtownsettounveilnewhighprofilesponsor 1 11128 0 0 /news/rochester111218 1 11420 0 0 /news/rusthall190217 1 17883 0 0 /news/kentleague/greenwich/Greevlord130104.html 1 0 0 0 /news/23rdjune03.html 1 0 0 0 /news/craywands201118 3 35333 0 0 /news/wejusthavetomakesurewedeliveronthedaysayschathamtownstrikerandyconstable 1 12905 0 0 /news/drmartens/eastern/dartford/25thjuly04.html 1 0 0 0 /news/kentleague/beckenham/27thaug03.html 1 0 0 0 /news/scefl280517 1 16333 0 0 /news/beardeal280921 1 11041 0 0 /news/iamrelishingthechancetobepartofahugelyambitiousclubsaysjamielawrence 1 15327 0 0 /news/wevegotourhouseinorderadmitsramsgatebossjimward 1 14866 0 0 /news/championsdoverathleticsheroesgettheirhandsofsilverware 1 11769 0 0 /news/maidstoneunited2-2hendon-itsnotgoingtobeaquickfixwarnsnewstonesbossandyford 1 21676 0 0 /news/hythe160717 2 27143 0 0 /news/wattsfitnessracetohelpouthisbelovedfisher 1 14105 0 0 /news/bradbrookboostforabbott 1 15727 0 0 /news/charltonathleticvisitchathamfortilleystestimonial-exclusiveinterview 1 14395 0 0 /news/551a956c34d0c 1 3280 0 0 /news/king.php 1 0 0 0 /news/carshaltonathletic0-1maidstoneunited-itsgoodtohavesaundersonboardsaysnott 1 26349 0 0 /news/margatearebuzzingastheylookforwardtotwobigawaytrips 1 11369 0 0 /news/551bc5e1124a4 1 11388 0 0 /news/1stjuly05.html 1 0 0 0 /news/sevebark160719 2 56376 0 0 /news/hythbeck191223 30 160994 0 9 /news/551bc5e446813 1 4277 0 0 /news/wandseagertobanishlastseasonsplay-offdisappointment 1 15273 0 0 /news/erithtownelms161015 1 30120 0 0 /news/cugleytargetsstrikertobecomeaforce 1 17957 0 0 /news/tuckerresignsafter20yearsatconeyhallexclusiveinterview 1 13641 0 0 /news/othernews/28thaug03.html 1 0 0 0 /contact/+%28%29 2 13018 1 1 /news/pitchero.com/clubs/crowboroughathletic 1 0 0 0 /news/thesykochallenge-update 1 11475 0 0 /news/hythetown280422 2 29933 0 0 /news/soccershorts020722 2 38979 0 0 /news/larkepso110921 4 111366 0 0 /news/corinthian0-9maidstoneunited-alittletriptowembleywillbenicesaysfive-goalwelford 1 28331 0 0 /news/maidstoneunited4-5waltonhersham-wevethrownitawaywithshoolboydefendingsayssaunders 1 26159 0 0 /news/22ndaug04.html 1 0 0 0 /archive-2006-2014/59 1 20736 0 0 /news/burgesshilltown0-1whitstabletown-werodeourluckadmitsheroicfewell 1 24524 0 0 /news/1stsept03.html 1 0 0 0 /news/ithinkweregoingtoproveafewpeoplewrongsaystonbridgeangelsbosstommywarrilow 1 14902 0 0 /news/wecantlettheoccasiongetthebetterofussaysdulwichhamletbossgavinrose 1 14008 0 0 /news/wardfeelsreallypositiveonplayerfront 1 17289 0 0 /news/551bc99bb0b56 2 24084 0 0 /news/folkestone200619 2 24900 0 0 /news/quartetfallatthefinalhurdle 1 17542 0 0 /news/wellbestayinginthekentcountyleagueunlessiwinthelotterysaysbexliansbossdannyhill 1 20388 0 0 /news/saundersreturnstohartsdownpark 1 11437 0 0 /news/tonbridgeangels3-2ashfordtownmdx-itsbeenagooddayforus-warrilow 1 23373 0 0 /news/mygreatteamwillwintheleagueinsiststrott 1 15892 0 0 /news/erittunb301122 1 34196 0 0 /news/551a99e5155f5 1 24630 0 0 /news/margate040117 1 13199 0 0 /news/thamesmeadeyeingoystercatch-exclusive 1 18931 0 0 /news/551a931e80013 2 34614 0 0 /news/crayvrams081103.html 1 0 0 0 /news/hbayvcray270304.html 1 0 0 0 /news/doverathleticsnapupstrikercalumwillockfromebbsfleetunited 1 10883 0 0 /news/ebbsfleet030721 4 51182 0 0 /news/someofourplayershavegottostarttoimproveorwellhavetodosomethingaboutitsayscugley 1 13811 0 0 /news/beckenhamtown2-3craywanderers-ivegotfartoomanyplayersattheminutesaysianjenkins 1 34147 0 0 /news/glebwhyt010920 1 34376 0 0 /news/tobesuccessfulweneedtomaintainaconsistentsquadsayshernebaybosssamdenly 1 12522 0 0 /news/wehavetobeinapositionjustincasehernebaywobblesayserithtownbosstonyrussell 1 14803 0 0 /news/ourqualityshonethroughintheendsaysplay-offchasingford 1 13009 0 0 /news/fatrophyspecialwarrilowwantsmoregiantkillingacts 1 16010 0 0 /news/tonbridgeangels4-2bromleycoxwecancompetewiththeproclubs-exclusive 1 18608 0 0 /news/imstayingputatwhitstablesaysflatteredseager 1 13914 0 0 /news/dartford3chathamtown1-binksithoughtitwasacrackinggameoffootball 2 24846 0 0 /news/fisher1-1croydonathletic4-5pens-wevegiventhemarunfortheirmoneysaysproudlisney 1 32881 0 0 /news/551bc5e4ac4e7 1 11457 0 0 /news/tonbridgeangels180522 3 27602 0 0 /news/epsombeck280818 1 30002 0 0 /news/27thoct04.html 1 0 0 0 /news/drmartens/premier/dover/15thaug04.html 1 0 0 0 /dartford-2003-2006/www.heineken.co.uk/www.heineken.co.uk/ 1 3151 0 0 /news/canterbury280119 1 11900 0 0 /news/greenwich290616 3 27108 0 0 /news/mcmahonverypleasedwiththamesmeadsstart 1 13235 0 0 /news/weshouldbemindfulofchathamsstrengths-butwedontfearthemsaysmunday 1 14752 0 0 /news/kentleague/cray/27thaug03.html 1 0 0 0 /news/invictafacealongandrockyroadaheadwarnsjenner 1 12709 0 0 /news/hessenthalerfacesteamselectionnightmareformidweektriptofleetwood 1 18913 0 0 /news/resultsaugust2017 2 72409 0 0 /news/tonbridge020106.html 1 0 0 0 /news/crayholm030918 3 64036 0 0 /news/drmartens/eastern/folkestone/bashvfolk081103.html 1 0 0 0 /news/conference/margate/margvnorthwich270903.html 1 0 0 0 /news/footballstarsturnoutinforceforsewell 1 13963 0 0 /news/ihavenoroomformercenariesanymoresaysradbourne 1 20827 0 0 /news/ashfordunitedallocatedplaceinthenewkentinvictaleague 1 13911 0 0 /news/stonesgivestudentsalessoninfootball 1 12100 0 0 /news/551a9250b7f69 1 6087 0 0 /news/551bc5db0516e 4 38476 1 0 /news/tunbrust180422 4 172246 0 0 /news/daishfacesuncertainfuture 1 13721 0 0 /news/nomads180516 1 11813 0 0 /news/peckham190618 1 12690 0 0 /news/davecookneedstoworkhardtorecapturetheformheshowedinhisfirstspellheresaystimdixon 2 15703 0 0 /archive-2006-2014/83 1 20815 0 0 /news/wellshavelinkswiththefamous 1 14911 0 0 /news/leeworgan091023 4 41487 1 1 /news/hollands210419 1 11995 0 0 /news/humechallengesstonestostayatthesummit-exclusiveinterview 1 15444 0 0 /news/idontthinkwecancatchwokingnowadmitswingsbossjamieday 1 13534 0 0 /news/bromley030119 2 18749 0 0 /news/drmartens/eastern/sittingbourne/lymington040904.html 1 0 0 0 /news/cugleyhasfolkestoneatheartsayslindsey 1 19614 0 0 /news/551bc99dbe7a4/kentcounty/kentcounty/21stoct03.html 2 15653 0 0 /news/wehaveeverychanceofexceedingourpreviousbestpositionsayswhitstabletownchairman 1 15488 0 0 /news/551a931e9cc9a 2 35176 0 0 /news/kentfootballunited090521 1 13574 0 0 /news/551bc5e6b166e 1 19704 0 0 /news/kentleague/cray/9thfeb04.html 2 0 0 0 /news/ramsvlords270903.html 1 0 0 0 /news/deresbossexpectdockersdog-fight-exclusiveinterview 1 12455 0 0 /news/corinthian140816 1 13301 0 0 /news/greenways060718 1 13018 0 0 /news/deal030915 1 13743 0 0 /news/551a956c28b1e 1 3462 0 0 /news/551bc5e274c54 1 11652 0 0 /news/fisher2-4craywanderers-itwasagametoomanyforusadmitsfisherbossstevefirkins 1 26405 0 0 /news/peoplewillhavetodealwiththefrustrationsofbeingdroppedsaysdoverathleticbosshayes 1 12710 0 0 /news/hastings130905.html 1 0 0 0 /news/551a9718d6d9b 3 27831 0 0 /news/chathamtown0-0ashfordtown-footballcanbesofrustratingattimesadmitslovell 1 24461 0 0 /news/kentleague/cray/KSTSF080304.html 1 0 0 0 /news/crowborough150217 1 11455 0 0 /news/rusthallappointronaldson 1 11207 0 0 /news/551bc99c3e719 2 34666 0 0 /news/lewisham180718 1 12382 0 0 /news/abbottconcentratesontheleague 1 12683 0 0 /news/wedontfearanyonesaysdoverathleticassistantjakeleberl 1 15068 0 0 /news/551a97b292fcb 1 14949 0 0 /news/wereupforthechallengeinsistsseager-exclusiveinterview 1 14595 0 0 /news/cugleycondemnspowellschallengeondickson 1 21510 0 0 /news/kentleagueclubsprepareforbigkick-off 2 19348 0 0 /news/canterbury300417 1 12067 0 0 /news/551bc5de0acdd 1 14205 0 0 /news/bromvdartfordfac.html 1 0 0 0 /news/4thaug05G.html 1 0 0 0 /news/ourbouncebackabilityisasignofourunityandbeliefsaysdoverathleticbossnickyforster 1 12521 0 0 /news/rusthallsignwestcountrystar 1 10061 0 0 /archive-2006-2014/105 1 20341 0 0 /news/8thjune04.html 1 0 0 0 /news/NationalLeagueStatement100321 2 16250 0 0 /news/thebigkickoffwemustliveuptoourexpectationssaysnewbosslangton-exclusive 1 13386 0 0 /news/16thdec05.html 1 0 0 0 /news/551a956bebedd 3 27910 0 0 /news/hugolangton181015 2 28710 0 0 /news/ivetakensittingbourneasfarasipossiblycouldsaysmattwyatt 1 16792 0 0 /news/itsnotallaboutmeinsistsawardwinningmanager 1 12687 0 0 /news/bromley211119 2 19230 0 0 /news/beckbalh220322 1 27187 0 0 /news/ksports051121 4 54170 0 0 /news/551bc99c7fb39 2 31055 0 0 /news/kentleague/sevenoaks/12thaug04.html 1 0 0 0 /news/wp-admin/includes/wp-login.php 1 0 0 0 /news/stangleb170123 4 45390 0 0 /news/551a99e4e98a4 1 21747 0 0 /news/lyddtown310818 1 13104 0 0 /news/551bc5e84a2ac 1 11060 0 0 /news/tonbrdover210915 2 61375 0 0 /news/17thjan05.html 1 0 0 0 /news/wellingunitedfacewinding-uporder 1 12255 0 0 /news/jenkinssetforsquadshowdowntalks 1 20635 0 0 /news/wp-admin/dropdown.php 1 0 0 0 /news/wp-admin/includes/xmrlpc.php 1 0 0 0 /news/3rdaug04.html 1 0 0 0 /news/erithandbelvedere170323 1 13953 0 0 /southern-counties-east-football-league/21 1 19625 0 0 /news/shorts110615 2 42201 0 0 /news/myambitionistobecomeaprosays20-year-oldsammacneil 1 14381 0 0 /news/graysunveilkedwellsigning 1 11757 0 0 /news/551a9718b66dc 3 27578 0 0 /news/idoknowwevegottoimprovesaysfolkestoneinvictabossneilcugley 1 16871 0 0 /news/whatweofferedhimwastoogoodforhimtoturndownsaysthamesmeadtownbosskeithmcmahon 1 17382 0 0 /news/londonfirmskrillsecuredealtosponsorconferenceforthreeseasons 1 14365 0 0 /news/winningtheleagueismyonlyprioritysaysburman 1 19964 0 0 /news/seagerexplainsknightdeparture 1 11508 0 0 /news/letshopewecantaketheclubforwardsaysnewsittingbournejoint-managerjimward 1 15410 0 0 /news/afccroydonathletic100823 3 25532 2 1 /news/thamesmead260916 6 40049 3 3 /news/suttonathletic3-5hollandsblair-theboysarestillgivingmeeverythingsayspaulpiggott 1 35883 0 0 /news/551bc5e7d9095 1 10989 0 0 /news/5thsept04.html 1 0 0 0 /news/reading280804A.html 1 0 0 0 /news/erith150105.html 1 0 0 0 /news/551a9cf55be31 3 39025 0 0 /news/12thaug05.html 1 0 0 0 /news/superpowersarsenalarecomingtochathamtoplaygillinghamladies 1 13335 0 0 /news/551bc99dbe7a4/ryman/kentleague/whitstable/whitstablevlordswood130903.html 2 15653 0 0 /news/hessenthalerdeliverypleasesdoverchairman 1 17621 0 0 /news/551bc5e42b439 1 4803 0 0 /news/werenotgivinganythingupinsistsramsgatebossjimward 1 11856 0 0 /news/eastdart140418 1 25819 0 0 /news/551a97b25f72c 1 14774 0 0 /news/551a96dbeaca2 2 16292 0 0 /news/walkersmakingsteadyprogressaheadofbigkentderby 1 20558 0 0 /news/signingstroutsisabigcoupforwhitstabletownhailsseager-exclusive 1 13912 0 0 /news/551a9b48253cd 4 29639 0 0 /news/wellaltr080315 1 24819 0 0 /news/facupdraw2010-2011 1 18059 0 0 /news/ebbsfleetunited1-2salisburycity-daishwevegottosticktogether 1 21791 0 0 /news/whitstable241004.html 1 0 0 0 /news/cpalace221216 3 30171 0 0 /news/iwanttohavearuninthefacupsaysianjenkins 1 14187 0 0 /news/beckashf240819 3 67947 0 0 /news/cugleywantssixpointsoverfestiveperiod-exclusive 1 15992 0 0 /news/sydenhamsports041020 1 11965 0 0 /news/551bc5e1ec089 1 14296 0 0 /news/drmartens/eastern/folkestone/harrowcupreplay051004.html 1 0 0 0 /news/ashfordenticedefensivepairawayfromhastings 1 13128 0 0 /news/crayfolk241121 3 81721 0 0 /news/werealllookingforwardtothechallengesaheadinthenewcampaignsayswellingbossjamieday 2 18000 0 0 /news/551bc5e89b302 1 11557 0 0 /news/aclublikefishershouldntbebottomoftheleagueinthefirstplacesaysmartinford 1 18561 0 0 /news/craywands190317 3 36527 0 0 /news/eastbourne190219 1 13028 0 0 /news/ihaveaqualitysquadbutitstakingawhiletogeladmitscrayvalleybossstevechapman 1 13914 0 0 /news/sittingbourne3-2margate-iwanttobethechampionshipmanagersaysabbott 1 24005 0 0 /news/craywands301117 2 16921 0 0 /news/drmartens/eastern/ashford/horsham271104.html 1 0 0 0 /news/551bc5db27b09 4 43490 0 0 /news/holmesdale2-4ashfordunited-itsnotevenworthtalkingaboutthetablesayspaulchambers 1 28792 0 0 /news/hernebay030220 3 30302 0 0 /news/craywanderers100421 3 28518 0 0 /news/stevenageswoopforfleetace 1 13408 0 0 /news/551bc99dbe7a4/othernews/ryman/bromley/1stsept03.html 2 15653 0 0 /news/551a956c0d515 6 19315 5 5 /news/dartfordbosstonyburmanunveilsmarkarberandnathancollierashisfirsttwosummersignings 1 13377 0 0 /news/551a9797f061a 1 4537 0 0 /news/bromley140819 2 19521 0 0 /news/551a99e453879 1 11091 0 0 /news/kentleague/sladegreen/12thdec04.html 1 0 0 0 /news/chessingtontootingbec061121 2 16659 0 0 /news/metcalfpredictsopenkentleaguetitlerace 1 14096 0 0 /news/wevegotanopportunitytodosomethingspecialsaysebbsfleetunitedbossstevebrown 1 20717 0 0 /archive-2006-2014/212 1 20011 0 0 /news/551a979ad1ab1 1 5099 0 0 /news/cray260705.html 1 0 0 0 /news/ashfordunited190821 3 36753 0 0 /lordswood-2003-2006/2 2 17724 0 0 /news/croydonisthenextstopformuch-travelledsodje 1 17672 0 0 /news/formerchairmanmarkjennerinsistsfootballwillcontinueathomelands 1 27740 0 0 /news/dartford020106.html 1 0 0 0 /news/dulwichhamlet060619 2 23986 0 0 /news/drmartens/eastern/ashford/11thaug03.html 1 0 0 0 /news/carshalton240905.html 1 0 0 0 /news/lovelltellshisplayerstotaketheirchances-exclusiveinterview 1 13513 0 0 /news/551bc99dbe7a4/drmartens/eastern/dartford/kentleague/ramsgate/ramsgatevhythe120803.html 2 15653 0 0 /kent-invicta-league/25 2 24599 0 0 /news/whitstable301004.html 1 0 0 0 /news/drmartens/eastern/folkestone/cray091104.html 1 0 0 0 /news/551bc5dd58318 2 19506 0 0 /news/weareallunitedintryingtobringsuccesstotheclubsayscollins 1 19219 0 0 /news/cheatclaimsforcesearlyfinishtokentleaguematch-exclusive 1 13142 0 0 /news/kingvcd240815 2 55467 0 0 /news/horsham070505.html 1 0 0 0 /news/dealchat071221 1 11161 0 0 /news/arlesey201104.html 1 0 0 0 /news/hocktoncollectsrymanleaguegoldenbootaccolade 1 14226 0 0 /news/551a96dc17346 3 36397 0 0 /news/chathamtown030822 3 27668 0 0 /news/kentleague/deal/26thsept04.html 2 0 0 0 /news/angelsbeatcrawleytosigngoalkeeperreed 1 11303 0 0 /news/ashford160518 3 28184 0 0 /news/ambitiousclubawaitfloodlightdecisionbeforeapplyingtokentleague-exclusiveinterviews 1 16089 0 0 /news/beckenham280219 1 14557 0 0 /news/wingatefinchley301004.html 1 0 0 0 /news/backingthefleettowembleyglorydaishcallsuponthe12thman 1 13473 0 0 /news/crayvalleyB240320 3 31647 0 0 /news/551bc5de6f568 1 11622 0 0 /news/theroadtowembleywemustseizethemoment 1 20607 0 0 /news/iwanttohelpbuildastrongfootballclubsaysnewly-appointedbromleygreenbossjohnovard 1 15513 0 0 /news/551a99e411be1 1 11671 0 0 /news/551bc5e230867 1 13696 0 0 /news/preseason2016 2 74117 0 0 /news/homelands300117 4 28435 3 3 /news/wardswoopsforoxforduniversitybounddefender 1 14261 0 0 /news/resultsfebruary2021 2 39697 0 0 /news/wewontgointherethinkingwevejustdonewelltogettheresaysvcdbosstonyrussell 1 15940 0 0 /ashford-2003-2006/www.heineken.co.uk/ 1 3130 0 0 /news/551a979929f5d 1 5006 0 0 /news/kentishfootballjoinstwitter 1 9913 0 0 /news/yorkcitysignebbsfleettrio 1 12621 0 0 /news/myplayershavetoconcentrateongettingintomy18-mansquadsaysnott 1 18778 0 0 /news/stansfeld310820 1 13731 0 0 /news/ithoughtwedbefurtherdownthetableadmitsshockedneilcugley 1 15406 0 0 /news/soccershortsformersouthendbossstevetilsonjoinsdoverathleticascover 1 54064 0 0 /news/inconsistencyseparatesusfromthebigboysadmitsdolby-exclusiveinterview 1 14914 0 0 /news/551a9250d01bf 4 39593 0 0 /news/wingsaddstrikertosquadandstagetrophyfinal 1 12232 0 0 /southern-counties-east-football-league/39 1 20412 0 0 /news/stansfeld230523 1 14328 0 0 /news/tunbridgewells040823 2 15864 0 0 /news/551bc5e4e4cde 1 11183 0 0 /news/551bc5e690c9d 1 13942 0 0 /news/glebe030120 1 13053 0 0 /news/gledhilljoinsthepolice 1 12396 0 0 /news/faversham221216 2 30963 0 0 /news/saturdayheadlines-ramsbeatlastseasonsrunnersup 1 29427 1 0 /news/551a97993f37f 1 6938 0 0 /news/dartford181217 1 14470 0 0 /news/kentleague/thamesmead/3rdaug04.html 2 0 0 0 /news/lordswood161221 4 47734 0 0 /news/kentyouthleague240615 1 13088 0 0 /news/wehavesignedamanwhohaswonlotsinnon-leaguefootballsaysvcdathleticbosstonyrussell 1 12435 0 0 /news/erithbelvedere7-0sidlesham-deresmaintaintheirhighstandardswithseven-goalromp 1 21280 0 0 /news/ryman/bromley/25thsept03.html 1 0 0 0 /archive-2006-2014/137 1 19590 0 0 /news/hilairereleasedbymargate-clublaunchesliveaudioservice 1 12460 0 0 /news/bromvtilburyfr050803.html 1 0 0 0 /news/myplayerswouldplayformefornothingsaysthamesmeadtownbosskeithmcmahon 1 15467 0 0 /news/mcmahonwantsadreamstarttoseason 1 17430 0 0 /news/dartford160618 2 14317 0 0 /news/ashford200815 1 12360 0 0 /news/fisher201218 1 11910 0 0 /news/wevehadlongenoughinthekentleagueadmitsfoley 1 13078 0 0 /news/551bc5e0a18df 1 14747 0 0 /news/glebe081223/contact 1 4789 0 0 /news/ourfinancialpositionisthebestiveknownitforalongtimerevealsfolkestoneinvictaboss 1 13693 0 0 /news/arleseywillbedifficulttobreakdownsaysramsbossjimward 1 17026 0 0 /news/whitstable100517 1 12538 0 0 /news/FAHeadingGuidance240220 3 35348 0 0 /news/551bc5e6bbd98 1 14641 0 0 /news/rusthall140819 1 11890 0 0 /news/alfa-rex2.php7 1 0 0 0 /news/sackingmybestmateisthehardestdecisionthativeeverhadtomakeinmylife-garyhillman 1 13860 0 0 /news/ifeelihaveputinplacethefoundationsforthestonestoreturnhome-paulbowden-brown 1 15184 0 0 /news/rochester260418 1 13646 0 0 /news/551a9c0e87f50 4 39007 1 1 /news/corbettpartscompanywithcash-strappedfolkestone 1 13045 0 0 /news/dovershowinterestinstrikerdimmock 1 14917 0 0 /news/dartford3-3canveyisland9-8pens-dartskeeptheirnervetobookleistontrip 1 21010 0 0 /news/crayhail160918 1 26811 0 0 /news/kentleague/whitstable/5thnov04.html 1 0 0 0 /news/vickersbossrickybennettsayshissidewilladapttowintryconditions 1 18987 0 0 /news/harrysmith210517 2 25795 0 0 /news/551bc99dbe7a4/kentleague/cray/results/kentleaguetables6thdec.html 2 15653 0 0 /news/fisherprepareforjudgementday 1 13443 0 0 /news/551bc5e020a2a 3 35550 0 0 /news/dolbymakesstoreyhisfirstsummersigning-exclusive 1 13324 0 0 /news/othernews/28thoct03.html 1 0 0 0 /news/crayvalley240817 1 13053 0 0 /news/551a9cf5a5358 2 19670 0 0 /news/wakelingaimingforcupsuccess 1 13302 0 0 /news/craywanderers4-1chichestercityunited-wemusttysterlingtoacontractsaysjenkins 1 19764 0 0 /news/551bc5e41b8f2 1 15449 0 0 /archive-2006-2014/82 1 20663 0 0 /news/drmartens/eastern/ashford/11thnov03.html 1 0 0 0 /news/kentleague/lordswood/30thjune03.html 2 0 0 0 /news/hollrams210821 6 191510 0 1 /news/wellingunited140522 1 12999 0 0 /news/551a99e4847ce 1 12344 0 0 /news/doverathletic300720 1 12263 0 0 /news/fatrophyspecialseageraskswillbrackleytakeusseriously 1 15374 0 0 /news/soccershorts250622 2 42313 0 0 /news/longlu18vbromu18090404.html 1 0 0 0 /news/ashfnorw200115 1 25442 0 0 /news/burmantheballisinourcourt 2 18780 0 0 /news/craigholloway050619 2 16826 0 0 /news/551a96db43fb9 1 3596 0 0 /news/maidstoneunitedsignshaunwelfordforanundisclosedfeefrommargate 1 12017 0 0 /news/551a99e33da37 1 14114 0 0 /news/bromley2-1dorchestertown-jamiebutlerhasthepotentialtohaveanexcellentfuturesaysbird 1 35356 0 0 /news/othernews/favase4thround.html 1 0 0 0 /news/myambitionistopushoneveryyearsaystonbridgeangelsbosstommywarrilow 1 12872 0 0 /news/myambitionistotakecrayintothefootballleague-jenkins 1 20253 0 0 /news/bromwok041016 2 39131 0 0 /news/therescashtospendsaysdoverchairman 1 13338 0 0 /archive-2006-2014/218 1 19731 0 0 /news/roseremainstightlippedfollowinghisresignation 1 11311 0 0 /news/deresappointfromwithin 2 13626 0 0 /news/vcdrussell230415 2 27310 0 0 /news/kenncrow131019 1 38673 0 0 /news/iwanttobecompetingfortheplay-offsnextseasonsayswhitstabletownbosspeternott 1 11546 0 0 /news/wewillnotbeheldtoransomsaysdartsbossburman 1 12037 0 0 /news/craighollowaystandsdownasmargatejoint-managerwithaheavyheart 2 21364 0 0 /news/551bc99cb0e55 2 22284 0 0 /news/551a96dc9a5df 2 18525 0 0 /news/favershamtown2-1greenwichborough-wewanttogooutwithabangsaysshearer 1 44834 0 0 /news/bearstedfc.co.uk 1 0 0 0 /news/551bc5e681be1 1 13139 0 0 /news/snodlandtown191118 2 14194 1 0 /news/supportersraisefundsformargate 1 11619 0 0 /news/fleetnamechangewasastrategicdecisionsayschairman 1 12626 0 0 /news/551bc5ddccd3f 1 14727 0 0 /news/551bc99dbe7a4/ryman/conference/margate/16thoct.html 2 15653 0 0 /news/ourobjectiveistoapplyforthekentinvictaleaguesaysapmcontrastbosskrisbrowning 1 17222 0 0 /news/vickersbossfoleyaddsanotherstonetohisranks 1 13620 0 0 /news/letsplayourparttobringfisherbackhometoend10-yearexile 1 15123 0 0 /archive-2006-2014/145 1 19569 0 0 /news/551a979a8b967 1 5285 0 0 /news/folkestoneinvicta1-0hendonwedroppedbelowourstandardsadmitscugley-exclusiveinterview 1 18842 0 0 /news/croydon171104.html 1 0 0 0 /news/ivegotagoodenoughbudgettowinpromotionnextseasonrevealswarrilow 1 13253 0 0 /news/sheppey160618 1 12359 0 0 /news/551bc5e61bf62 1 15145 0 0 /tonbridge-2003-2006/5 2 20590 0 0 /news/championsthanksforthesupportsaysprouddartschairman-exclusive 1 14881 0 0 /news/mainonvergeofafcwimbledonmoveforanundisclosedfee-exclusive 1 10520 0 0 /news/bearsout190823 4 131878 0 0 /news/thambill170917 3 75048 0 0 /news/hendon1-0folkestoneinvictasevenpointswillkeepusuppredictscugley-exclusiveinterview 1 18010 0 0 /news/wevestillgottimetomakeupgroundsaysplay-offchasinglovell-exclusive 1 15406 0 0 /news/itsabigweekendforalotofclubssaysdartfordbosstonyburman 1 13459 0 0 /news/soccershorts020717 2 31487 0 0 /news/ishouldgetanawardforbeingthemosthatedplayerinthekentleaguesaysnortonsbentaylor 1 16512 0 0 /news/551bc5df67755 1 14502 0 0 /news/31staug04A.html 1 0 0 0 /news/beckenham270217 1 13529 0 0 /news/imtalkingtothreeplayerstobethespineofmyteamsayssevenoakstownbosssimonjones 1 12806 0 0 /news/Afcwimbleon060905.html 1 0 0 0 /news/551bc99b81fbe 2 23442 0 0 /news/hughesblowshislyddasplayersfailtoturnup 1 13989 0 0 /news/mcmahonpleasedwithstrengthindepth 1 13857 0 0 /news/sevelord121217 1 32233 0 0 /news/eastashf281221 5 57247 0 0 /news/kentleague/thamesmead/4thoct04.html 2 0 0 0 /news/wegotohassocksfullofconfidenceafterholmesdalehidingsayscorinthianbossjamescollins 1 12519 0 0 /news/chelmdart120819 2 39499 0 0 /news/watchtheworldcupunfoldatyourfootballclub 1 22218 0 0 /news/craywanderers1-1canveyisland-itwasagoodpointagainstateaminfifthsaysianjenkins 1 23563 0 0 /news/551a9250f260d/20thoct05.html 2 6643 0 0 /archive-2006-2014/49 1 20630 0 0 /news/thamesmeadinvestigateillegalapproachforskipperkearley 1 12349 0 0 /news/eastbournetown2-4sittingbourne-wereonlylookingonewayandthatsupsaysnickdavis 1 30154 0 0 /news/pitchero.com/clubs/corinthianfc 1 0 0 0 /news/oboyleplottingdockersbiggesteverscalp 1 15175 0 0 /news/baldacchinowecouldnotreachourtargets-exclusive 1 12070 0 0 /news/beckenhamtown4lordswood0 2 26938 0 0 /news/daishtherewillbeafewyoungstersinoursquad 1 12178 0 0 /news/551bc5e38b923 1 23844 0 0 /news/erithbelvedere4-2corinthian-worstteamperformanceihaveseenin50yearssaystonysitford 1 30414 0 0 /news/hythe270119 2 27260 0 0 /news/maidstone280319 1 12441 0 0 /news/greenwichboroughareapillarinthecommunitysaysoutgoingsecretary 1 13826 0 0 /news/crowborough130618 3 31477 1 0 /news/margateonthebrinkofheartbreak 1 13651 0 0 /news/kentleague/sladegreen/thamesmead161004.html 1 0 0 0 /news/ourfinancespaintsagloomypicturerevealsfavershamtownchairmanrayleader 1 15533 0 0 /news/erithandbelvedere170120 1 13281 0 0 /news/huntleypleatosheringhamweneedyououtonthepitch 1 23133 0 0 /news/tonbridge041217 2 16735 0 0 /news/margate060716 1 11233 0 0 /news/ifanybodywantsasuccessfulmanagerimhere-jimward 1 15032 0 0 /news/hollands160518 1 11758 0 0 /news/walton&hersham081005.html 1 0 0 0 /news/wedidnthavethesquadtodealwithinjurieslastseasonsaysmaidstoneunitedbossjaysaunders 1 16001 0 0 /news/greensitt151217 1 16535 0 0 /news/wereatrockbottomadmitserithtownbosstonyrussell 1 13494 0 0 /news/corinthian-casuals3-1ramsgate-weweresecondbestadmitsramsgatebosstimdixon 2 34161 0 0 /news/dartford3-2leiston-burmancannotwaittoentertainportvaleinfacup 1 31814 0 0 /news/wewanttogettothefinalsaysthamesmeadtownbosskeithmcmahon 1 15335 0 0 /news/thefacarlsbergtrophyfinal-buildupebbsfleetunitedvtorquayunited 1 23668 0 0 /news/theresnoreasonwhychathamcantbetopsixwithasmallbudgetsaysmiles-exclusive 1 16087 0 0 /news/bromchar270719 2 33709 0 0 /news/itwillhavetobeagooddealtotakemeawayfromramsgatesaysjimward 1 17346 0 0 /news/bromley0-1doverathletic-itwasbackstothewallbutweweremagnificentsaysnickyforster 1 24213 0 0 /news/whiteunveilsthreetransfertargets 1 12766 0 0 /news/NationalLeagueStatement221220 2 15680 0 0 /news/tunbridgewells0-3whitstabletown-brombydecidestosignforwells-exclusives 1 20463 0 0 /news/wewerethebetterteambyfarinsistsyorath 1 12800 0 0 /news/glebe230717 1 14231 0 0 /news/familymancablemissesvitalcupreplay 1 14812 0 0 /news/gillingham0-3coventrycity-ithinktheoccasiongottothemtodayadmitsdeflatedjamesmarrs 1 26388 0 0 /news/hopefullystrikerandyconstablecangoonarunandproveeveryonewrongsayskeithmcmahon 1 17156 0 0 /news/greenways020819 1 11932 0 0 /news/tonbridge040116 2 30325 0 0 /news/551a9677e160a 3 44661 0 0 /news/rusthall310722 4 57570 0 0 /news/bromkidd220915 2 35796 0 0 /news/tonbridgeangels2-1chathamtown-wevegottolearnhowtowingamessayskevinwatson 1 27975 0 0 /news/flamingoparkticksalltheboxes-sayscraywanderersvice-chairmandavidfrancis 1 15610 0 0 /news/maidstone161115 1 13520 0 0 /news/sampsonvowstoleadredhillintotherymanleague-exclusive 1 16924 0 0 /news/iwantustostartputtingaruntogetherandmoveupthetablesaysholmesdalebossjpcollier 1 16067 0 0 /news/erithtown4-0holmesdale-weknowwehaventwonanythingadmitserithtownbosstonyrussell 1 26084 0 0 /news/arisrelishinghomeplay-offlottery-exclusiveinterview 2 19490 0 0 /news/soccershorts240617 2 30302 0 0 /news/551bc5dc393ee 3 35603 0 0 /news/sheppey310818 1 12653 0 0 /news/mypersonalambitionsaretomakeitallthewaysays20-year-oldbosssammacneil 1 17655 0 0 /news/crayvalley170617 1 12143 0 0 /news/fixturesforapril2009 1 43720 0 0 /news/crowborough140919 1 11619 0 0 /news/16thnov05.html 1 0 0 0 /news/551a9c925dcd5 3 45587 0 0 /news/lindseywaitingforsummeroffers-exclusiveinterview 1 12836 0 0 /news/mooreimpressesinmidfieldasfleetbounceback 1 11678 0 0 /news/wemuststartperforming-daish 1 15857 0 0 /news/doverathleticreleaseollieschulzfromhiscontractbymutualconsent 1 12885 0 0 /news/551bc5de6ca05 1 11940 0 0 /news/ryman/bromley/bromvfolk230304.html 1 0 0 0 /news/greenwichboroughconfirmtwo-matchtourofcyprus 1 11921 0 0 /news/ramsgate3-2harlowtown 1 12714 0 0 /news/551bc99dbe7a4/ryman/bromley/kentleague/thamesmead/14thnov03.html 2 15653 0 0 /news/FALeaguesStatement080121 3 29405 0 0 /news/glebe010916 2 15392 1 1 /news/congratulationsdoverathleticfootballclubrymanleaguedivisiononesouthchampions2007-2008 1 9887 0 0 /news/24thoct03.html 2 0 0 0 /news/ryman/bromley/13thoct04.html 1 0 0 0 /news/erithtownfoodbank301119 1 12248 0 0 /news/ireckonfourmorewinswouldbeenoughtogetusintheplay-offssaysfolkestonebossneilcugley 1 15495 0 0 /news/vcdfav2087 2 68659 0 0 /news/foleyexpectstoloseprobetsanddenness 1 15948 0 0 /news/551a97b1e3733 1 17479 0 0 /news/shorts17072015 2 48987 0 0 /news/551a956cb7fd0 1 4673 0 0 /news/fordblastsclubforlackofsupportaheadofbigfavaseclash-exclusiveinterview 1 14463 0 0 /news/favershamtown0-1doverathletic-readingsimpressesagainsthisformerside 1 18873 0 0 /news/adminfuns.php7 1 0 0 0 /news/borehamwood190819 2 23489 0 0 /news/promotionchasingrusticsappointlangtonastheirnewboss-exclusive 1 12352 0 0 /news/551bc5e49b584 1 18068 0 0 /news/resultsoct2015 2 124093 0 0 /news/soccershortsownerstomeetdulwichhamletfansoverstadiumdevelopment 1 21810 0 0 /news/kentleague/sevenoaks/hythe231004.html 1 0 0 0 /news/crowboroughathleticappointgoalkeepercoachandyirvineasnewassistantmanager 2 16581 0 0 /news/lawrenceonstand-bytogethischancetoimpress-exclusive 1 15143 0 0 /news/graveshake180515 1 12930 0 0 /news/greenwich031117 2 24767 0 0 /news/stamford1chathamtown1 1 11994 0 0 /news/therealistictargetistofinishthehighestrankedkentsidesaysbromleyshaydenbird 1 20621 0 0 /news/10thmar05.html 1 0 0 0 /news/kentleague/deal/Sampson20.html 1 0 0 0 /news/chathamtown0-5aveley-theresaseverelackofqualityadmitsembarrassedkevinwatson 3 67882 0 0 /news/borehamwoodvisitprincesparkinwestviewcupclash 1 11247 0 0 /news/kentstarsofferyoungstersthechancetojoinsoccerelite 1 26902 0 0 /news/drmartens/eastern/folkestone/folkevhemelfat011103.html 1 0 0 0 /news/soccershorts220519 2 30330 0 0 /news/551a956c5387b 1 5173 0 0 /news/margate260518 2 27578 0 0 /news/thetitleraceisfarfromoverinsistsharwood 1 14838 0 0 /news/wellingunited2-3ebbsfleetunited-iwanttobesuccessfulatebbsfleetsaysjamieday 1 32066 0 0 /news/weneedtobeveryfocusedandbeveryprofessionalsaysbromleybossmarkgoldberg 2 18453 0 0 /news/551a9678127b5 3 38647 0 0 /news/allmanmakesdecisiononhisfuturewithinthenextcoupleofweeks 1 15037 0 0 /news/551bc99dbe7a4/drmartens/eastern/tonbridge/drmartens/eastern/chatham/11thaug03.html 2 15653 0 0 /news/551a96782b1c4 2 16056 0 0 /news/551bc5e601a19 1 17383 0 0 /news/play-offfinallivecraywanderers1-0metropolitanpolice-crayheroesmakehistory 1 42659 0 0 /news/dartford6-0horshamymcaburmanimthrilledabout4000princesparksell-out 1 23160 0 0 /news/kentrivalslookingup 1 22882 0 0 /news/14thmar04.html 1 0 0 0 /news/ineedbetterplayerstochallengeforpromotioninsistsyorath 1 23293 0 0 /news/kentleaguecupfinalwefrozeonthebigstageadmitsporter-exclusive 1 18026 0 0 /news/craigclarkquitscrockenhilloverpersonalreasons 2 16395 0 0 /news/551bc99dbe7a4/kentleague/erithtown/kentleague/beckenham/20thjuly03.html 2 15653 0 0 /news/wewanttogoonebettersayserithbelvederebossmickycollins 1 20234 0 0 /news/franciswantstoavoiddefeatathigh-flyinghastings 1 14520 0 0 /news/corby121105.html 1 0 0 0 /news/wellgetourfeetfirmlybackonthegroundsayshernebaybosssimonhalsey 1 14254 0 0 /news/wp-admin/repeater.php 2 0 0 0 /news/stonesinsisttheywillremainathomelands 1 13679 0 0 /news/551a95b446f65 2 19688 0 0 /news/corsdeal210123 2 32949 1 1 /news/favershamstarscomeoutforcharity 1 12962 0 0 /news/doverathletic220518 1 11655 0 0 /news/croydonchairmansu-turnstunstompkins 1 15164 0 0 /news/greenwich200117 2 26277 0 0 /news/sevenoaks020817 1 14570 0 0 /news/humepreparesforhendonbacklash 1 13401 0 0 /news/folkestoneinvicta0-1wellingunited 1 16189 0 0 /news/doverathletic3-1wroxham-wewereverypoorihopeitwasntcomplacencysaysnickyforster 1 18268 0 0 /news/kentleague/hernebay/hernevafcwimfav181003.html 1 0 0 0 /news/kentglebe191215 1 33551 0 0 /news/invictaunveilbiggestsponsorshipdeal-andlosetheirstripes 1 12198 0 0 /news/bankholidayweekendresultsforthcomingfixtures 1 76242 0 0 /news/woodstocksports0-1erithtown-thistieisntoversayserithtownbosstonyrussell 1 18227 0 0 /news/maidstoneunited0-1croydonathletic-andyfordquitsasmaidstoneunitedboss 1 23912 0 0 /news/welling031117 1 12802 0 0 /news/craywands130318 3 30866 0 0 /news/15thapr05.html 2 0 0 0 /news/551a97b0770b8 1 13751 0 0 /news/fishlord180317 1 36374 0 0 /news/olsonleavesdartfordforregularfirstteamfootball 1 12174 0 0 /news/551a96783b762 2 17690 0 0 /news/thebestisstilltocomeinsistswarrilow 1 15121 0 0 /news/soccershortskentplayersignsdealwithswedishclub 1 18217 0 0 /news/sittingbourne150522 2 24093 0 0 /news/doverbeginworkonnewcentrespot 1 12325 0 0 /news/wereamatchforanybodyinsistsbaldacchino-exclusive 1 13330 0 0 /news/chatham270917 2 14760 0 0 /news/551bc99dee697 2 26412 0 0 /news/chathamtown5-1royalengineers-itsalwaysnicetoscoregoalssayskevinwatson 1 18662 0 0 /news/itslikeanyjobifyouvegotachanceofpromotionyouvegottogoforitsayshessenthaler 1 15640 0 0 /news/drmartens/eastern/sittingbourne/sittvchat281003.html 1 0 0 0 /news/rothwell200805.html 1 0 0 0 /news/nortonsportsbossbentayloraimingfortopeightfinish 1 16305 0 0 /news/cordicewarnshisplayersaboutsundaysuspensions 2 17252 0 0 /news/donsarepunishedoverdarlingtonblunder 1 12545 0 0 /news/bromley030417 2 21943 0 0 /news/wemustlearnfromourmistakessaysseager-exclusive 1 15779 0 0 /news/551bc99dbe7a4/kentleague/tunbridgewells/othernews/29thjune03.html 2 15653 0 0 /news/favershamtown2-1hythetown-theresmoretocomefrommysideinsistsluchford 1 37628 0 0 /news/ashford270518 2 20024 0 0 /news/17thsept05.html 1 0 0 0 /news/551bc5de04a88 1 12062 0 0 /news/theendofthelineforrymanleagueservice 1 12106 0 0 /news/sporwell250719 1 34644 0 0 /news/551bc5e13ca4a 1 11460 0 0 /news/fansflockthroughtheturnstilesforcodymcdonaldsreturntodartford 1 19286 0 0 /news/551a99e55fbf6 1 23305 0 0 /news/rothwell130805.html 1 0 0 0 /news/tunbridgewells8-0holyport-martinlarkinwetorethemtopieceswewereexceptional 1 36964 0 0 /news/maidstoneunited2-3tonbridgeangels-theyveallgivenmeeverythingsaystommywarrilow 1 21853 0 0 /news/551a95b417e19 3 35036 0 0 /news/leatherhead220517 2 23598 0 0 /news/illbringsuccesstonew-lookwingsvowssmith-exclusive 1 15217 0 0 /news/doverathletic120820 1 11634 0 0 /news/551bc5dc45146 2 15055 0 0 /news/551a97989cdb3 2 23589 0 0 /news/beckenham010219 1 11818 0 0 /news/kentleague/sladegreen/sladevwhitstable111003.html 1 0 0 0 /news/hernebay3-1winchestercity-wecanmixitupifweneedtosayshernebaybosssimonhalsey 1 21249 0 0 /news/resultsseptember2019 2 99401 0 0 /news/molesey170905.html 1 0 0 0 /news/humevowstobethesidethatturnsdoveroveratfortresscrabble 1 15787 0 0 /national-league 61 471185 6 16 /news/551a931e46d49 1 12103 0 0 /news/oakwoodpitchcakedinsnow-kentseniorcuplasteightdraw 1 11869 0 0 /news/stonesraisefundsthroughsellingcarparkspaceatjameswhatmanway 1 17093 0 0 /news/vcdchic061020 2 65323 0 0 /news/drmartens/eastern/folkestone/burgvfolk070104.html 1 0 0 0 /bromley-2003-2006/3 2 18332 0 0 /news/theresnoreasontopanicsayshappy-go-luckyjenkins 1 18243 0 0 /news/rickybennettcharity190117 2 26004 0 0 /news/29thmay05.html 2 0 0 0 /news/551bc99dbe7a4/drmartens/eastern/chatham/kentleague/4thsept03.html 2 15653 0 0 /news/551a95b3ef1cc 3 34147 0 0 /news/staplehurstbossquitsduetoalackofcommitmentfromhisplayers 1 11392 0 0 /news/kentleague/lordswood/26thsept04.html 1 0 0 0 /news/vickersbossfoleyfeelsthecreditcrunch 1 18248 0 0 /news/maidstoneunited110320 1 14937 0 0 /news/phoenixsports180920 2 26999 0 0 /news/DCMSStatement140820 3 29737 0 0 /news/kentleague/maidstone/30thdecember2003.html 1 0 0 0 /news/ramsgate041019 2 25866 0 0 /news/abbottwewontbeontheendoffacupshock 1 13968 0 0 /news/dealtownfc.co.uk 1 0 0 0 /news/folkestoneinvictasellstrikerstuartkingtomaidstoneunited 1 16120 0 0 /news/crayfolk150223 6 178104 0 0 /news/mauricedunktakesoverassittingbournechairman 1 13572 0 0 /news/bromley210615 3 22037 0 0 /news/lutontown0-0wellingunited-ifitwerentforthefanstheclubwouldntbehere-jamieday 1 32693 0 0 /herne-bay-2003-2006/www.heineken.co.uk/ 1 3184 0 0 /news/maidstoneunited13-0redhill-ithoughtwecouldhavehadafewmoreadmitsjackparkinson 1 21092 0 0 /news/551a979958dae 1 5151 0 0 /news/nickbarnesisthegreatbitforthejigsawtogetourpromotionpushbackontracksaysporter 1 21525 0 0 /national-league/12 2 25895 0 0 /news/ramsgateannouncesegregationmeasures 1 12859 0 0 /news/beckseven270318 1 32143 0 0 /news/18thaug05.html 1 0 0 0 /news/maidstone191117 1 23479 0 0 /news/551bc5e27d721 1 15274 0 0 /news/rothwellvsittingbourne20903.html 1 0 0 0 /news/stonesco-ownercountscostofwintryconditions 1 14797 0 0 /news/tudopeck010519 1 33827 0 0 /news/thereisenoughtalentinthanetforustomixitinsoutherncountieseastleague-liammorris 1 18694 0 0 /news/lillisunveiledasnewlordswoodboss 1 13800 0 0 /news/wecanhandlethepressureandexpectationsayslovell-exclusive 1 13525 0 0 /news/tonbridgeangelsblock500kmysterytakeoverbid 1 15334 0 0 /news/thebigkickoffwemustavoidopeningdaydefeatsaysmiles-exclusive 1 14116 0 0 /news/551bc5e51b985 2 18953 0 1 /news/551bc5de88ea3 1 11478 0 0 /news/snodland030217 1 12365 0 0 /news/551a931e43321 1 17336 0 0 /news/551a9c0eba217 4 143330 1 0 /news/wearthreelionsonyourshirt 1 12011 0 0 /news/fisher021019 1 12882 0 0 /news/551a9cf59f4b7 2 15504 0 0 /news/maidstone190216 1 12979 0 0 /news/nolaninterestedinlordswoodvacancy-exclusiveinterview 1 12203 0 0 /news/corinthian100220 1 12172 0 0 /news/ontheairwavesourequaliserdidnotcrossthelineadmitsburman 1 19484 0 0 /news/folkestoneinvictagetcouncilbacking 1 15251 0 0 /news/pitchwillbeabogmundaywarned 1 13562 0 0 /news/elmstead030217 1 11800 0 0 /news/resultsdec2016 2 92097 0 0 /news/drmartens/eastern/folkestone/folkvroth061203.html 1 0 0 0 /news/greeniesfridaypreview-1 1 19085 0 0 /news/drmartens/eastern/folkestone/folkvhist030204.html 1 0 0 0 /news/nottches050621 4 98714 0 0 /news/gillinghamsyoungstersupforgrabstogainexpereinceinlocalnon-leaguefootball 1 15353 0 0 /archive-2006-2014/129 1 19829 0 0 /news/othernews/britishenergykentcountyleaguetablesfinal2004.html 1 0 0 0 /news/kentleague/erithtown/hernebay131204.html 1 0 0 0 /news/551bc5debd234 1 10826 0 0 /news/doverathletic0-3woking-dontwriteusoffyetsaysdoverathleticbossnickyforster 1 17775 0 0 /news/peckham060517 1 13143 0 0 /news/fleettown1-1chathamtown-milesitsabotuttimefortuneturnedinourfavour 1 12482 0 0 /news/551bc99dbe7a4/kentleague/greenwich/kentleague/tunbridgewells/tunverith111003.html 2 15653 0 0 /news/fishwest080823 4 126606 0 0 /news/551bc99dbe7a4/kentleague/greenwich/kentcounty/thamespoly20thjuly03.html 2 15653 0 0 /news/wehavetobeleivethatwecanwinplay-offssaysthamesmeadtownbosskeithmcmahon 1 14109 0 0 /news/lovellwemusthaveapositiveattitudeifwearetoachieveourgoals-exclusive 1 16872 0 0 /news/551a9bb000192 3 49472 0 0 /news/facupfourthqualifyingrounddraw-1 1 15715 0 0 /dartford-2003-2006/2 3 32597 0 0 /news/rusthall020817 1 12793 0 0 /news/didctham290918 3 72847 0 0 /news/tonbridgeangels1-1eastbourneborough-themostimportantthingwastostayup-tommywarrilow 1 27140 0 0 /news/551bc99dbe7a4/kentleague/maidstone/kentleague/maidstone/15thaug03.html 2 15653 0 0 /news/swalebrom030416 2 68370 0 0 /news/whitstablesnumberscomeononanightwheneverythingclicked 1 12782 0 0 /news/551bc5e19e402 2 17261 0 0 /news/smallingsignsfour-yeardealwithgiantsmanchesterunited 1 12558 0 0 /news/facarlsbergtrophysecondrounddraw 1 11480 0 0 /news/daishwevegottogopart-time 1 14465 0 0 /news/tonbconc180717 2 55689 0 0 /news/crayvalley060119 1 17491 0 0 /news/551a925089ec3 1 3689 0 0 /news/alliwantforchristmasaresomemorepointssayswhitstabletownbossnickysouthall 2 20331 0 0 /news/551bc5e65b49b 1 12880 0 0 /news/fatrophyquarter-finaldrawdaishpreparsfortoughlasteighttripatburtonalbion 1 12432 0 0 /archive-2006-2014/35 2 26091 0 0 /news/manchester280517 3 28431 0 0 /news/canterbury040915 1 13061 0 0 /news/kentleague/cray/crayvrams081103.html 1 0 0 0 /news/seagerdeservesrecognitionfornurturingakinde 1 13106 0 0 /news/doverathletic011220 1 11110 0 0 /news/canveyislandwillbelookingtobouncebackwarnsmargatebossiainoconnell 1 15061 0 0 /news/glebe190222 5 74940 0 0 /news/myplayersarehereattheclubtowinsomethingsayserithbelvederebossmickycollins 1 15336 0 0 /news/falanaillmakeadecisionwithinthenextweek-exclusiveinterview 1 15657 0 0 /news/tonbridgeangels0-1guildfordcity-wellfightonandgetthingsrightsaystommywarrilow 1 22767 0 0 /drmartens/eastern/folkestone/maidstone260705.html 1 9955 0 0 /news/bromalde21112017 1 14792 0 0 /news/lordswood090821 1 13112 0 0 /news/soccershorts290116 2 22314 0 0 /news/551a979853f9c 1 4286 0 0 /news/werefeelingabitdowninthedumpsbutwellhavetopickourselvesupsaysscottsaunders 1 15419 0 0 /news/stonesappointwilliamsasdirectoroffootball 1 13207 0 0 /news/championsdoverbossstartsplanningforrymanpremiercampaign 1 14555 0 0 /news/backingborotowembleyhubbardturnshisbackonborough-exclusive 1 17136 0 0 /news/551a9c0e6281d 2 17391 0 0 /news/croydonvbrom160803.html 1 0 0 0 /news/551bc5e756033 1 12625 0 0 /news/folkestone150205.html 1 0 0 0 /news/551a956bb6f22 1 4108 0 0 /news/mergerwillstrengthenbothclubssaysmikedrabble 1 12998 0 0 /news/zerotoherosmithrepaysjonesfaith 1 16620 0 0 /news/whyteholl230816 1 32669 0 0 /news/wewillcomeoutstrongerfromourfinancialconcernsvowsdormantcugley 1 15495 0 0 /news/conference/margate/25thjuly03.html 2 0 0 0 /news/beckenham100322 2 19710 0 0 /news/dealtown080920 2 20018 0 0 /news/kentleague/sladegreen/15thsept03.html 1 0 0 0 /news/551a9799117a9 1 5156 0 0 /news/bromley190320 2 17647 0 0 /news/phoenix220218 2 27474 0 0 /news/AFCtotton100905.html 1 0 0 0 /news/rustbeck251017 1 33440 0 0 /news/folkestoneinvicta190523 2 25879 0 0 /news/bromleysignwingerdeanlodgeonnon-contracttermsfromkingstonian 1 19685 0 0 /news/everyonehasacleanslatetoimpressmeduringpre-seasonsaysseager 1 13257 0 0 /news/imnotinterestedabouthowweperformonthedaysaysburman 1 16064 0 0 /news/wellspitchintostuntitlefavourites 1 13516 0 0 /news/levettwillgiveyoungsterstheirchanceatsevenoakssaysjames 1 20658 0 0 /news/itsdisappointingforeveryonewhoputtheeffortinsayshernebaybosssimonhalsey 1 16010 0 0 /news/sittingbourne2-2chipstead-ijusthopewecanimproveallthetimesaysjimward 1 18946 0 0 /news/sevenoakstown2-1erithtown-myplayerscanthandlethepressureadmitslividtonyrussell 1 35552 0 0 /news/goals021015 2 26865 0 0 /news/551bc99a777ad 2 17056 0 0 /news/drmartens/premier/dover/8thaug04.html 1 0 0 0 /news/sceflstatement230720 1 11812 0 0 /news/hollands280716 1 15070 0 0 /news/tonbridge070916 3 33899 0 0 /news/551bc5e3b30a5 1 12781 0 0 /news/idontfeelpressureatfootballsaysfisherbossbillywalton 1 13780 0 0 /news/551bc99b74d8c 2 18910 0 0 /news/551bc5e02453c 3 45730 1 1 /news/phoenixsports010920 2 24840 0 0 /news/crowborough280520 1 11579 0 0 /news/kingstonian2-1dulwichhamlet-iwanttobetopattheendoftheseasonsaysgavinrose 1 29317 0 0 /news/sandemanjoinstunbridgewellsmanagementteam 1 21161 0 0 /news/glebe100921 4 57854 0 0 /news/wardrallieshistiredtroops-exclusiveinterview 1 13219 0 0 /news/551bc5e4dac76 2 15276 0 0 /news/wellingtown150617 2 15350 0 0 /news/nugentquitsvickersinwakeof55budgetcuts 1 14364 0 0 /news/erithglebe060818 1 26739 0 0 /news/551a9798192f5 1 3515 0 0 /news/kentleague/ramsgate/4thmar04.html 1 0 0 0 /news/doverathletic170320 1 12586 0 0 /news/favershamtownlaunchchristmasbonanzaforgodalmingvisit 1 14731 0 0 /archive-2006-2014/3 3 44575 0 0 /news/kentleague/greenwich/20thjuly03.html 1 0 0 0 /news/beckcrow080317 1 38998 0 0 /news/doverathletic2-4maidstoneunited 1 16562 0 0 /news/kingmarg290118 3 64552 0 0 /news/favasewinnerseagerfeelsthepainafterelimination 1 11532 0 0 /news/cugleymakesdoublesigningintimeforbigkick-off 1 15360 0 0 /news/deresappointroystonandhunteruntiltheendoftheseason 1 20584 0 0 /news/epsovbrom061203.html 1 0 0 0 /news/kentishfootballcoukwelcomesvalsport 1 15225 0 0 /news/merirust180315 1 27217 0 0 /news/551bc5e12c070 1 12443 0 0 /news/tonbur170117 2 51977 0 0 /news/crayrams251118 3 76436 0 0 /news/kentleague/deal/Sampson15.html 1 0 0 0 /news/551a931eaa5cc 2 51992 0 0 /news/fisher190922 4 58598 0 0 /news/wealdstone1-0margate-welooktowinourlastthreegamestostayup-oconnell 1 19025 0 0 /news/thefoundationshavetobeinplacefirstsaysbeckschairman 1 20576 0 0 /news/iwanttoguidethedartsbackintotheconferencesaysburman 1 18112 0 0 /news/whitstabletown1-1folkestoneinvicta-whitstableslumptorockbottomdespiteendinggoaldrought 1 14625 0 0 /news/re-signingjakebeecroftisamassivestepforwardforwhitstabletownsaysbossjustinluchford 1 12282 0 0 /news/wellingunited300819 1 12175 0 0 /news/greenwichborough0-1erithtown-boroughsfootballwaslovleytowatch-oboyle 1 34368 0 0 /news/551bc5e5a5ae8 1 14321 0 0 /news/othernews/coneyhall110804.html 1 0 0 0 /news/ashford041215 1 11633 0 0 /news/crowborough290419 1 13984 0 0 /news/brackleytown190518 2 18672 0 0 /news/crayveritht111115 1 31493 0 0 /news/vcdhar020416 2 59983 0 0 /news/cugleyintalkswithtwoformerinvictamen 1 18032 0 0 /news/folkestone130616 2 24809 0 0 /news/ramsvbeck030404.html 1 0 0 0 /news/garyabbotttakessolechargeofcraywanderersaftermichaelpayestandsdown 1 13863 0 0 /news/drmartens/eastern/erith&belvedere/8thaug04.html 1 0 0 0 /news/thamesmeadtown2beckenhamtown1 1 14218 0 0 /news/midweekfixtures 1 11594 0 0 /news/lewishamnotbeinginthekentinvictaleaguewilldamagefootballinourborough-warnssimpson 1 21875 0 0 /news/folkestoneinvictastatement161220 2 23605 0 0 /news/elthampalace3-1apmcontrast-sansirotogreencourtroadisadropforwright-terrynaden 1 28322 0 0 /news/hythetownbossscottporterbringsinaaronlacyfrommargate 1 12782 0 0 /news/dartford1-4afctelfordunited-wehavebeenpunishedseverelyforourmistakessaystonyburman 1 24727 0 0 /news/crayvtunb271203.html 1 0 0 0 /news/551a931e403a0 1 13158 0 0 /news/resultsjanuary2021 2 42397 0 0 /news/phoeredh180921 5 185730 0 0 /news/551bc5de71f16 2 18620 0 0 /archive-2006-2014/24 2 25863 0 0 /news/baldacchinodemandscharacterfollowingunacceptabledisplay-exclusive 1 15692 0 0 /news/charltonathletic1-3gillingham-theywanteditmorethanusadmitsstuartweston 1 31800 0 0 /news/wellschairmanwantstobringcupbacktoculverden 1 12948 0 0 /news/soccershorts130516 2 50676 0 0 /news/goalkeeperscottchalmers-stevensoffersteenagersplacesathissocceracademyscholarship 1 12863 0 0 /news/wp-admin/css/colors/blue/ioxi-rex.php 1 0 0 0 /news/theboysareupforgoingonarunsaysward 1 14341 0 0 /news/18thjuly03.html 1 0 0 0 /news/soccershorts030623 5 51783 0 1 /news/hythetownunveillewisminglesigning 1 12559 0 0 /news/551a97989542e 2 23484 0 0 /news/tonbridge130417 2 28281 0 0 /news/whitstabletown160522 1 15124 0 0 /news/erithbelvedere0-4afcsudbury-iwillneverresigninsistsstrugglingbosschriscosgrove 1 29648 0 0 /news/farnieallmyplayersaregoodenoughtostart-exclusiveinterview 1 14086 0 0 /news/rochester310818 1 11905 0 0 /news/maidsaunders130515 2 16181 1 0 /news/craycars261006 3 69582 0 0 /news/phoenix080416 2 24503 0 0 /news/wereinaquarter-finalwhynotlooktowintherymanleaguecupsaysstonesbossjaysaunders 1 16500 0 0 /news/bearsted010916 1 12152 0 0 /news/mypriorityistoimprovewithlocalplayerssaysrusthallbossronaldson 1 14273 0 0 /news/canterbury300419 1 15238 0 0 /news/metpoltonb241115 2 55294 0 0 /news/dartford020520 2 19729 0 0 /news/carshaltonathletic2-0tonbridgeangels-iveletdownmymatecugleyadmitswarrilow-exclusive 1 20686 0 0 /news/kentfa270123 6 88115 1 0 /news/doverathletic2-3basingstoketown-hessenthalerblamesschoolboydefendingforfirsthomeloss 1 20960 0 0 /news/corinthian030317 1 12822 0 0 /news/thekentinvictaleagueisaresoundingsuccesssaysjohnmoules 1 16217 0 0 /news/551a931e3b03e 1 12623 0 0 /news/playerscantcommandhighwagesanymoresayscraychairmanhillman 1 23628 0 0 /news/551bc99dbe7a4/kentleague/sladegreen/drmartens/eastern/folkestone/8thjuly03.html 2 15653 0 0 /news/collbeck140818 1 28014 0 0 /news/551a96787cfee 3 46297 0 0 /news/martineedestepsdownasfisherchairman 1 12245 0 0 /news/youwanttoprogressasfarasyoucaninthefacupsaysclivewalker 1 15953 0 0 /news/fisher181016 1 13328 0 0 /news/chattalbot160515 3 33280 0 0 /news/dover190618 1 11584 0 0 /news/551a967757740 3 38637 0 0 /news/wewanttodevelopyoungerplayerssayskentfootballunitedbosssammacneil 2 20918 0 0 /news/bromley1-1tonbridgeangels-wehavetostarttakingourchancesadmitsbromleycoachneilsmith 1 29131 0 0 /news/drmartens/eastern/folkestone/chelmsford170804.html 1 0 0 0 /news/greenwich091118 2 27509 0 0 /news/drmartens/eastern/chatham/1stjuly03.html 1 0 0 0 /news/tonbridgeangels220620 1 11235 0 0 /news/551a9677ab156 2 16551 0 0 /news/FAStatement150520 2 15523 0 0 /news/dartsexpectanothersternfitnesstestagainstgills 1 15583 0 0 /southern-counties-east-football-league/40 1 20168 0 0 /news/551a97b26a7be 1 15020 0 0 /news/vcdathletic190522 2 24565 0 0 /news/warrilowforcedtowieldtheaxeaftertwoearlycupexits 1 13018 0 0 /news/erithbelvedere3-2crayvalleypapermills-ourclassshowedintheendsaysmickycollins 1 24698 0 0 /news/hernashf220122 5 168435 0 0 /news/margateallen040615 2 16999 0 0 /archive-2006-2014/20 2 26027 0 0 /news/kentskidsgetofftoawinningstart 1 11990 0 0 /news/soccershortsliamharwoodpenscontracttostayatbromley 1 17052 0 0 /news/weneedtostartdragginginthefanssaysthamesmeadtownbosskeithmcmahon 1 14472 0 0 /news/dealtown130123 4 64582 0 0 /news/sittingbourne0-0arleseytown 1 14644 0 0 /news/sportingclubthamesmead300922 1 13533 0 0 /news/tonbridgeangels3doverathletic2falanaimaluckyomeninplay-offfinals-exclusive 1 22750 0 0 /news/erithtownunveilenniogonnellaastheirnewmanager 2 15458 0 0 /news/everybodywillbethrowingmoneytowinthekentleaguenextseasonsaysfisherbossstevefirkins 1 15786 0 0 /news/bromvmarl171203.html 1 0 0 0 /news/thepressuresallonwellingandnotonussaysthamesmeadtownbosskeithmcmahon 1 15255 0 0 /news/wp-content/plugins/login/css.php 1 0 0 0 /news/ashford151105.html 1 0 0 0 /news/sevenoaks190918 2 32674 0 0 /news/theultimatedreamistoplayatwembleysaysashforrdunitedassistantmanagerjohnovard 1 16224 0 0 /news/drmartens/eastern/folkestone/salisbury140804.html 1 0 0 0 /news/dulwich020317 2 28925 0 0 /news/sheppey021218 1 13746 0 0 /news/3rddec04.html 1 0 0 0 /news/faversham180619 2 25723 0 0 /news/canterburycity150122 2 15958 0 0 /news/27thjuly05.html 1 0 0 0 /news/sportingclubthamesmead141023/ 3 38502 3 3 /news/twenty-fivegoalstrikeralfiemaysignsforconferencesouthfarnborough 1 5538 0 0 /news/barking190305.html 1 0 0 0 /news/rawlekeentostayonwithfleet 1 13144 0 0 /news/551bc5e9028ec 1 14412 0 0 /news/millwallunveilianhollowayastheirnewboss 2 19527 0 0 /news/kentleague/deal/dealvcray011103.html 1 0 0 0 /news/rochesterunited190820 1 11437 0 0 /news/burmanthebuckstopswithme 2 18173 0 0 /news/551a9799e06f3 1 5080 0 0 /news/buttonoutlineshisplansforopk 1 20396 0 0 /news/burmanreadyforsudburyshowdown 1 14045 0 0 /news/551a956c761e5 1 4771 0 0 /news/weredelightedwithourstartbutnotsurprisedsayswhitstablejoint-bossjimward 1 15682 0 0 /news/welling060417 1 12493 0 0 /news/erithbelvedere1-0erithtown-mysidehaveyetreachedtheirprimesaysoboyle 1 36339 0 0 /news/massexoduswilladdspicetobattleofkentsaysdoverbossmartinhayes 1 26681 0 0 /news/shorts200515 2 34849 0 0 /news/bromleyfaceuncertainfutureaschairmanputsclubupforsale 1 12447 0 0 /news/greecor250417 4 106596 1 1 /news/erithandbelvedere101019 1 12371 0 0 /news/england280916 2 33963 0 0 /news/bengal130805.html 1 0 0 0 /news/dover060805.html 1 0 0 0 /news/dover181005.html 1 0 0 0 /news/hythe080216 2 29821 0 0 /news/weregettingonwithadversitysaysinjury-hitramsgatebossjimward 1 14053 0 0 /news/croycroy220818 1 33500 0 0 /news/thisisabiggerthanforusthanthesalisburygamesaysstonesbossjaysaunders 1 16186 0 0 /news/warrilowwantspassionatesupportasheplotsgiantkilling-exclusive 1 16593 0 0 /dartford-2003-2006/3 3 32268 0 0 /news/ryman/bromley/chessington240704.html 1 0 0 0 /news/551bc5e10526e 1 21157 0 0 /news/sevenoaks080517 1 12143 0 0 /news/hopefullywellbeabitmoresuccessfulwiththeresultssayschathamtownbosskevinwatson 1 14499 0 0 /news/551bc99dbe7a4/drmartens/eastern/dartford/ryman/bromley/24thoct03.html 2 15653 0 0 /news/soccershorts110617 3 44311 0 0 /news/sevenoakspairquitduetolackofbackingfromclub-exclusive 1 12556 0 0 /news/osbornegoeswithhisheadheldhigh-burman 1 25710 0 0 /news/vcd041215 2 27193 0 0 /archive-2006-2014/139 1 19666 0 0 /news/metrogas221020 1 11144 0 0 /news/30thdec04.html 1 0 0 0 /news/tonbridgeangels1-2stainestown-welackeddesireandprideadmitswarrilow 1 20622 0 0 /news/fordwantstheplauditstogotofrostandwallis-exclusiveinterview 1 17643 0 0 /news/othernews/MUSHDec2004.html 1 0 0 0 /news/551bc99dbe7a4/kentcounty/kentleague/tunbridgewells/9thnov03.html 2 15653 0 0 /news/croydon230117 1 11736 0 0 /news/doverchairmancallsforvolunteerstopitchinaheadofclubsbiggesteverhomegame 1 12687 0 0 /news/hopefullynowpeoplewilltakeusabitmoreseriouslysayssittingbournebossgaryabbott 1 16864 0 0 /news/whitstabletownoperateonasoundfinancialfooting-brownett 1 15939 0 0 /news/isthmianleague290620 2 24549 0 0 /news/gillingham5-0haverhillrovers-retainingbothcupswasourtargetsaysjackwheeler 1 26449 0 0 /news/wellingunited0-1eastbourneborough-welackedbelief-admitsdisappointedday 1 28260 0 0 /news/hernlonc010416 2 63398 0 0 /news/551bc5e2e0fc9 1 11221 0 0 /news/8thdec05G.html 1 0 0 0 /news/hythwhit091223 20 97397 0 6 /news/551a96dc60721 3 34349 0 0 /news/tonbridgeangels2-1hayesyeadingunited-welefteveryoneontheedgeoftheirseats-warrilow 1 26989 0 0 /news/wilkinslooksforwardtomakinghiscomeback 1 16300 0 0 /news/bromu18ve&b040404.html 1 0 0 0 /news/carshaltonathletic1-2margate-ofcoursewecandefinitelystayupsaysupbeatoconnell 1 25285 0 0 /news/theroadtowembleyitsgoingtobeagoalscoringthrillerpredictfolkestone-exclusive 1 14571 0 0 /news/kentleague/tunbridgewells/13thaug04.html 1 0 0 0 /news/rusthall4-0bearsted-weshouldvedonebetterreflectsrusticsbossronaldson 1 26427 0 0 /news/wellingtown091019 1 14480 0 0 /news/clubsinvitedtoregistertheirinterestinnewstep6league 1 12920 0 0 /news/iwaspromisedeverythingbutthesepromiseswereneverkept-oboyle 1 15315 0 0 /news/ashfordtown2-3fleettown-lovellruesbeveneyredcardandcostlymistake 1 18654 0 0 /news/rusthall100818 2 18013 1 1 /news/tilbury020405.html 1 0 0 0 /news/ashfordunited140420 3 28826 0 0 /news/551a97999df1e 1 4531 0 0 /news/kentleague/ramsgate/11thnov03.html 1 0 0 0 /news/sittingbournebossgaryabbottunveilsjoevinessigning 1 18392 0 0 /news/folkestoneinvictafc.co.uk. 2 0 0 0 /news/hammerssnapupyoungramincludessaturdaysmainheadlines 2 25175 0 0 /news/weneedthewholesquaddoingtheirbitsaysnott 1 14488 0 0 /news/newsigningswillimproveussaysmcmahon 1 15528 0 0 /news/tonbridge300817 2 27140 0 0 /news/wevegotgoodplayerswhocanhandlethepressuresaysalexobrien 1 16813 0 0 /news/illsettlefortopfourfinishsaysgorman-exclusive 1 17794 0 0 /news/everyonewantstoplayinafinalsayserithbelvederemidfielderpaulspringett 1 16918 0 0 /news/hollandreflects130518 2 20471 0 0 /news/trottexpectshighpressurisedthanettussle-exclusive 1 15216 0 0 /news/iwanttotakedoverupsayswhite 1 13805 0 0 /news/walkerpleasedwithpre-seasonpreparations 1 14350 0 0 /news/readersupsetwithbromleysreaction 1 15803 0 0 /folkestone-2003-2006/4 2 18177 0 0 /news/551a99e4ddf27 2 30414 0 0 /news/wewerentupforthefightadmitsyorath 1 13042 0 0 /news/stalbanscity0-0dartford-burmandrawscomfortfromsaintsstalemate 1 14042 0 0 /news/wellkickofftheseasonwithallgunsblazingsayshayes 1 14820 0 0 /news/ashfordtown2-3hastingsunited-wemuststartgettingwinsinsistsadlington-exclusive 1 18010 0 0 /news/margate030317 1 15848 0 0 /news/551bc99cd20a8 2 26157 0 0 /news/elthampalace0-3sevenacresidcup-idontapologiseforthreateningrefinsistspaulmann 1 29957 0 0 /news/weknewwereinadifficultsituationsaysdartfordbosstonyburman 1 14273 0 0 /news/26thaug03.html 1 0 0 0 /news/saturdayssoccer18thmarch2006 1 12686 0 0 /news/wokifolk241118 2 56034 0 0 /news/551a97b1183b7 1 13727 0 0 /news/dartfordshomecomingdartford4-2horshamymcadartsreturnhomeinstyle 1 16558 0 0 /news/longservingpettitbidsfarewelltoramsgate 1 11472 0 0 /news/wehavetodothebusinessathomesaysdoverbossmartinhayes 1 21627 0 0 /news/stonesunveiltheirsixthsummersigning 1 11576 0 0 /news/craycant170319 2 47616 0 0 /news/budgetcutsforcedmetoleaveramsgaterevealsroyston 1 11869 0 0 /news/551bc99d50232 2 26153 0 0 /news/wevegottohaveastructureinplaceofproducingourownplayerssaysfavershambossrayturner 1 17166 0 0 /news/551a979ab1b9c 1 5790 0 0 /news/stansfeld201121 4 51190 0 0 /news/hernebaybosssimonhalseywarnshissideagainstcomplancency 1 16386 0 0 /news/551bc5e2cbf33 1 11997 0 0 /news/conferencepairgetcampaignsunderway 1 14214 0 0 /news/rochbans180815 1 26717 0 0 /news/iveenjoyedmytimeatfisherbutimundecidedatthemomentsaysco-managermartinford 1 14657 0 0 /news/weneedtoconcentratealloureffortsonachievingincreasedincomesaysfolkestonesjimpellatt 1 14023 0 0 /news/chathamtown0enfieldtown2 2 17505 0 0 /news/551bc5e53a87a 1 20213 0 0 /news/holmuckf311020A 4 163674 0 0 /news/hythram160319 2 72760 0 0 /news/ashford100416 1 14564 0 0 /news/allourmemberclubsbackednortonspromotion-sayskentleague 1 12263 0 0 /news/rymanpremierleaguedayofdestinyitsdowntowhohasthemostbottlesaysstonesbosswalker 1 41553 0 0 /news/551a956c3837c 3 22533 0 0 /news/maidstoneunited3-2borehamwood-twowinsoutoftwoputsstonesingoodheart 1 14442 0 0 /news/cashflowproblemsforceswarrilowtoditchferguson 1 20855 0 0 /news/crayhors081221 3 66524 0 0 /news/ramsgate301020 2 25819 0 0 /news/thamesmeadtown3-2whitstabletown-weretryingtogettheclubbackonitsfeetsaysmcmahon 1 29098 0 0 /news/thamesmeadtown0-0heybridgeswifts-thistiecouldevengothedistancewarnskeithmcmahon 1 31347 0 0 /news/drmartens/premier/dover/22jan04.html 1 0 0 0 /news/promotionracewillgorighttothewiresayslovell 1 12830 0 0 /news/topmanianjenkinsgetsonhismarksforcharitymarathonrun 1 12505 0 0 /news/551a97b0db2ea 2 28002 0 0 /news/crayvalley230516 1 12208 0 0 /news/martinrelishinghisdreammovetopalace 1 14493 0 0 /news/bromley140817 1 15960 0 0 /news/westandagoodchanceofgettingtowembleysaysdartfordco-chairmandavidskinner 1 14123 0 0 /news/chathamchairmanurgesgillsfanstobringafriendfortrophytie-exclusive 1 13096 0 0 /news/favershamtown020622 3 27109 0 0 /archive-2006-2014/213 1 19372 0 0 /news/vickersunveilrickybennettastheirnewmanager 1 12012 0 0 /news/551bc5e695d2e 1 18567 0 0 /news/drmartens/eastern/dartford/dartvfolk240204.html 1 0 0 0 /news/maldon041204.html 1 0 0 0 /news/551bc99ca268b 2 32088 0 0 /news/wellgiveitthebestwevegotsaysleatherheadkeeperderenibrahim 1 19505 0 0 /news/wembleyblownawaybyimpressivehernebay 1 13614 0 0 /news/wereacoupleyearsintoourfive-yearplantogetintothekentleaguesayspiggott 1 15659 0 0 /news/canterburystadium230415 1 11654 0 0 /news/lastseasonsheartbreakwillspurusonsayswhitesdefendercloke-exclusiveinterviews 1 12574 0 0 /lordswood-2003-2006/3 2 14519 0 0 /news/tonbridgeangels220421 1 11611 0 0 /news/wemayhavetocutthebudgetwarnsday 1 15964 0 0 /news/seagersunbeatensidefacesterntest-exclusiveinterview 1 14154 0 0 /news/hythfolk200719 3 78136 0 0 /news/conference/margate/margate.html 1 0 0 0 /news/newchairmanmustputinthegraftsaysingleston 1 15957 0 0 /news/theweekahead-2 1 18111 0 0 /news/warrilowexpectingbloodandthunderderby 1 19643 0 0 /news/iunderstandgeorgelandaisreasonsforwantingtogosayshernebaybosssimonhalsey 1 11413 0 0 /news/seagerasksforpositivityforwhitstablesmake-or-breakweek 1 15294 0 0 /news/fiskno-oneishappywithourleaguepositionexclusive 2 15996 0 0 /news/theexcitementaroundtheclubhasbeengreatsaysmaidstoneunitedmidfielderjackparkinson 2 19950 0 0 /drmartens/eastern/erith&belvedere/sevenoaks100905.html 1 9955 0 0 /news/551a9718c1d28 2 14464 0 0 /news/551bc99d13107 2 24688 0 0 /news/chairmancallsforsupportaswhitstablebidtobeatthedrop 1 16394 0 0 /archive-2006-2014/250 1 19433 0 0 /news/551bc5da8a215 4 61258 0 0 /news/walthamforest270905.html 1 0 0 0 /news/doverathletic210720 1 11907 0 0 /news/strikerwattspartscompanywithfisherathletic 1 12596 0 0 /news/drmartens/eastern/sittingbourne/tilbury300804.html 1 0 0 0 /news/favershamtown0crockenhill0 1 15346 0 0 /news/551a931deb1be 3 32353 0 0 /news/craywanderers3doverathletic1 2 26167 0 0 /news/551bc5e07516c 1 26235 0 0 /news/thamesmeadtownrecordtheirhighestwinasakentleagueclub 2 41237 0 0 /news/551a92501d7b8 2 16193 0 0 /news/551a9c9201580 2 17580 0 0 /news/disciplinehasprobablycostusaplaceintheplay-offsadmitsfavershamtownboss 1 13861 0 0 /news/footballassociationplaceafcfisherinkentleague 1 13622 0 0 /news/ivedonemyjobandmoresoileavehernebaywithmyheadheldhighsayssimonhalsey 1 15175 0 0 /news/tonbridgeangels4-0hendon-wemuststayintheplay-offspotssayswarrilow 1 20813 0 0 /news/crowboroughathletic051121 1 14275 0 0 /news/soccershorts030721 2 33609 0 0 /news/NationalLeagueStatement010721 2 16860 0 0 /news/folkbish071221 2 50970 0 0 /news/hernebaydeer210515 1 11463 0 0 /news/551a9bafde43f 3 25834 0 0 /news/tunbridgewells1-5thamesmeadtown 1 16897 0 0 /news/551bc5e5834e3 4 30352 3 1 /news/wellingunited020822 1 11046 0 0 /news/doverromptovictoryintable-toppingshowdown 1 11393 0 0 /news/someoftheladsarenotuptostandardadmitsfisherjoint-bossmartinford 1 13065 0 0 /news/othernews/ConeyHall151104.html 1 0 0 0 /news/28thsept03.html 1 0 0 0 /news/551a956ca571a 3 22786 0 0 /news/soccershortsbeckenhamtownhopefulofsigninglegendarystrikerteddysheringham 1 31928 0 0 /news/folkestone150719 3 26438 0 0 /news/rymantvfailstoliftoff-fornow 1 10930 0 0 /news/kfu030317 1 12071 0 0 /news/wp-content/plugins/Cache/Cache.php 1 0 0 0 /news/whitstable080617 1 11716 0 0 /news/afccroy281016 1 12173 0 0 /news/soccershortswhitstableplayersoffertopayfansadmissionafterunacceptableawaydisplay 1 22637 0 0 /news/whithast031219 2 55967 0 0 /news/551a95b3d83f8 3 32209 0 0 /news/theleaguemustawardusthepointssaysyorath 1 12238 0 0 /news/holmbans240916 1 31275 0 0 /news/bromley1-2hamptonrichd-werecognisewereinamassiverelegationbattleadmitsgoldberg 1 22164 0 0 /news/crowboroughathletic200522 1 12796 0 0 /news/551a956c97753 3 21370 0 0 /news/farnieleftintheshade-exclusive 1 13173 0 0 /news/bromley211117 2 20640 0 0 /news/phoenix080116 2 24265 0 0 /news/thamesmead271115 2 24875 0 0 /news/dockersunveilhugginssigning 1 19338 0 0 /news/guiversigningwillgivefavershamaliftsaysluchford-exclusive 1 16628 0 0 /news/hernebay090720 2 27151 0 0 /news/551a925104700 2 20121 0 0 /news/dealkenn231021 4 130546 0 0 /isthmian-league/56 3 42621 0 0 /news/551bc5e1e65fe 2 18852 0 0 /news/craywanderers2-3tootingmitcham-concedingheadedgoalsareaconcerntomesaysianjenkins 1 26169 0 0 /news/afccroydonathletic030120 3 22932 2 2 /news/ihaventthrownthetowelinorleftasinkingshipsaysjoefrancis 1 14957 0 0 /news/croydon4-1epsomewell-maybeicanaffordtogoandbuytracksuitsformyplayerssaysgill 1 26414 0 0 /news/kilcullenstandsdownasfleetchairman 1 13258 0 0 /news/deal050205.html 1 0 0 0 /news/nationalleague220116 1 12672 0 0 /news/kentfootballunited250222 1 13078 0 0 /news/551bc5dc8a64d 3 38654 0 0 /news/onethingthatistopofmylististoenjoymyfootballsaysjasonlillis 1 15033 0 0 /news/ijusthopegavynhasgooddayesatdaggerssayswarrilow 1 17904 0 0 /news/craysev200817 3 86552 0 0 /news/walkerurgesfanstobackteamandstopcriticism 1 14872 0 0 /news/sittingbourne1harlowtown1 1 13946 0 0 /news/edwardskentseniorcupcryingoutformakeover 1 16993 0 0 /news/tonbridge030217 5 36560 3 3 /news/551bc99dbe7a4/kentleague/hernebay/drmartens/eastern/folkestone/folkevsitt230903.html 2 15653 0 0 /news/resultsaugsept2016 3 165486 0 0 /news/551bc99b678f7 1 5907 0 0 /news/bromleyontheorientwhatanopportunitytocreateandmakealitltebitofhistorysaysjones 1 18804 0 0 /news/551bc99dbe7a4/othernews/kentleague/cray/crayvchesfav221103.html 2 15653 0 0 /news/folkestone121017 2 30353 0 0 /news/margateunveilgroundimprovementsplanforhartsdownpark 1 13514 0 0 /news/thechairmanhassaidhewillnotcutmybudget-cugley 1 19114 0 0 /news/dartford121017 2 18866 0 0 /news/soccershorts260621 2 30037 0 0 /news/rusttonb080518 1 42127 0 0 /news/brommaid020917 2 47026 0 0 /news/crayhast170819 3 54578 0 0 /news/saturdaysbigkentfacuptieisprobablythehottestticketintownsaysnickysouthall 1 15283 0 0 /news/gloverrejectsbromleymovetostayatashfordtown 1 11229 0 0 /news/erithandbelv260715 1 12582 0 0 /news/551a97984c542 1 4136 0 0 /news/ramsgate120620 6 38742 1 2 /news/551bc5e512af0 1 18736 0 0 /news/craywanderers0-2ashfordtownmatchabandonedathalftime 1 16295 0 0 /news/lovellkscupclashhasthemakingsoffagoodgame 1 15141 0 0 /news/starstrikerjonmainshowndoorbytonbridgeangels 1 13652 0 0 /news/lewisham080319 1 12909 0 0 /news/18thjune05.html 2 0 0 0 /news/soccershortsnewlycrownedchampionsholmesdalebeginsearchfornewmanager 1 14995 0 0 /news/facarlsbergtrophythirdrounddraw 1 11748 0 0 /news/erithglebe250817 1 31125 0 0 /news/sittingbournereadytounveilnewboss 1 12777 0 0 /news/waltoncassitt041015 3 67755 0 0 /archive-2006-2014/110 1 20394 0 0 /news/newboysforcedtositonsidelinesforwingslucrativecurtainraiser 1 19180 0 0 /news/551a97b27afd8 1 14614 0 0 /news/maidstone240119 1 13243 0 0 /news/shorts200615 2 46941 0 0 /news/fisher110119 1 13211 0 0 /news/cugleyunveilsbriggsashissecondsummersigning 1 10772 0 0 /news/fixtures17-18thfebruary2006 1 17013 0 0 /news/551a9c0f1f54f 2 27976 0 0 /news/wellingunited291019 1 11720 0 0 /news/kingstonian281105.html 1 0 0 0 /news/lifesabeechfornewangelsstopper 1 13020 0 0 /news/favasesecondroundspecialcroydonsignformerfootballleaguegoalkeeper-exclusiveinterviews 1 20437 0 0 /news/551a967882130 3 45230 0 0 /news/wellbebetterpreparednextseasonsayslisney 1 16319 0 0 /news/eltham201116 1 15445 0 0 /news/crayhari111222 6 163141 0 0 /news/suttbill220716 1 27502 0 0 /news/drmartens/eastern/erith&belvedere/e&bvfolk010104.html 1 0 0 0 /news/11thnov04.html 1 0 0 0 /news/ashfordunited240423 7 43662 3 4 /news/fisherbeginsearchfornewmanagerafterpartingcompanywithgarylisney 1 13902 0 0 /news/theweekahead-11 1 13033 0 0 /news/wewontputtheclubatriskbytryingtoliveaboveitsmeanssaysdulwichhamletbossgavinrose 1 13304 0 0 /news/warrilow200615 2 34912 0 0 /news/lyddtown060516 1 13000 0 0 /news/alongsidethefacupthefatrophyisrightuptheresaysmaidstoneunitedbossjaysaunders 2 22572 0 0 /news/ihadsomegreatdaysandgoodmemoriesduringmyyeightyearsatarsenalreflectsmartinhayes 1 15813 0 0 /news/littlebeingrockbottomhasntforcedmetoquit 1 14021 0 0 /news/bromley240818 2 16721 0 0 /news/551bc5ded1923 1 21988 0 0 /news/551a97990ce5e 1 5440 0 0 /news/551bc5de93496 1 11988 0 0 /news/dartford0-2hastingsunitedarrowsinflictdartsfirstloss 1 14357 0 0 /news/craywanderers1-5lewes-someplayersmustlookatthemselvesinmirrorandshowsomeheart-bird 2 35428 0 0 /news/hythetown070919 2 24591 0 0 /news/favershamapplyforpromotionintorymanleague 1 12795 0 0 /news/wembleywinnersfanslinestreetstohonourkentheroes 1 11716 0 0 /southern-counties-east-football-league/33 1 20828 0 0 /news/sevenoakstown2-2beckenhamtown-itsalltoplayforagreerivals 1 33620 0 0 /news/metrodavies080515 1 16669 0 0 /news/myremitisonlytokeepwhitstablesrymanleaguestatussayscaretakerlane 1 21514 0 0 /news/iwantamassivereactionfrommyplayersinsistsdartsbosstonyburman 1 16810 0 0 /news/wedontbelieivethetitleraceisoversayshollandsblairbosspaulpiggott 1 18055 0 0 /news/pm.php 1 0 0 0 /news/facupspecialhumeexpectsabigperformancefromhisside 1 13109 0 0 /news/williamsontheendofbitter-sweetderbydaydefeat 1 13164 0 0 /news/eltham280816 1 13612 0 0 /news/imhappyatthefleetsaysheroicstoppercronin 1 14643 0 0 /news/kentleague/lordswood/lordsvcray251003.html 1 0 0 0 /news/weletdolbydownadmitsskippergooding-exclusive 1 16413 0 0 /news/maidstruro080516 2 36791 0 0 /news/fiftypointswillkeepusuppredictsfrancis 1 18419 0 0 /news/afccroydonathletic111023 2 17492 0 1 /news/551bc5e5191d0 1 11402 0 0 /news/cantebelv221115 1 30530 0 0 /news/bromley2-4suttonunited-werenotoutoftheraceforpromotionsaysmarkgoldberg 2 36173 0 0 /news/afccroydonathletic170818 2 15221 1 1 /news/abbottsignsformertractorboyintimefortrophytie 1 14982 0 0 /news/dulwichhamlet031219 2 18451 0 0 /news/sevenoakstownunveildouble-winnermickycollinsastheirnewboss 2 19850 0 0 /news/seageraskstitlerivalswecanhandlethepressurecanyou-exclusiveinterview 1 16300 0 0 /news/daishpromiseschangesforweymouthtrip 1 13886 0 0 /news/hernebay161004.html 1 0 0 0 /news/soccershortsderesbringinquartet 1 30299 0 0 /news/othernews/1stsept04.html 1 0 0 0 /news/551bc5e8712fd 1 12316 0 0 /news/kingstonian1-2sittingbourne-wecangoonandwintitlesaysabbott 1 25570 0 0 /news/charltonsstarsplaybelvederetoraisemoneyforillyoungster 1 13187 0 0 /news/kentleague/deal/Sampson10.html 1 0 0 0 /news/favgill070717 2 52023 0 0 /news/vcdathletic200821 2 26425 0 0 /news/ramsgate0-1sittingbourne-lovellgivestrialiststimetoimpress-exclusiveinterview 1 19729 0 0 /news/huntleyissuesunder-performingbecksafivematchultimatum 1 14241 0 0 /news/551bc99cdd1ad 2 20115 0 0 /news/vcdathletic2-2croydon 1 17444 0 0 /news/hungerfordtown2-2greenwichboroughaet-last-gaspsmithkeepswembleydreamalive 1 22788 0 0 /news/gillingham240120 2 27325 0 0 /news/551a931e2c02d 1 11836 0 0 /news/underdogsaimingtobringtrophyhome-exclusiveinterviews 1 13547 0 0 /news/youdontwinthekentleaguebyplayingprettyfootballallthetimeadmitshalsey 1 20248 0 0 /news/imconfidentwecangotomoleseyandgetaresultsaysneilcugley 1 13625 0 0 /news/wp-content/plugins/editor/css.php 1 0 0 0 /news/551bc99dbe7a4/drmartens/eastern/tonbridge/kentleague/lordswood/lordsvbeckfavase200903.html 2 15653 0 0 /news/beckenhamtownadmitdefeatinsheringhampublicitystunt 1 19987 0 0 /news/551a9799b2fa8 1 4709 0 0 /news/breakingnews9pmdartsswitchtorymanonenorth 1 10514 0 0 /news/backingthefleettowembleygloryidlovetoseethemwinatwembleysayslovell-exclusive 1 14016 0 0 /news/chatham300804.html 1 0 0 0 /news/thisismystrongesteversquadsayschathambosspaulfoley 1 21020 0 0 /archive-2006-2014/234 1 19236 0 0 /news/hernebay2-2chipstead-batteredchips 1 16975 0 0 /news/silvermedalistgetschathamyoungstersontheirmarks 1 13654 0 0 /news/tonbridge290416 2 25629 0 0 /news/craywands101116 3 26517 0 0 /news/sevenoakstown0-2corinthian-wereonasteeplearningcurveadmitssevenoakscoachferguson 1 23806 0 0 /news/551a96781ecce 2 27672 0 0 /news/thecrazygangcometofleetforskinnerstestimonial 1 12461 0 0 /news/supportersplantoresuscitatesunkenfish 1 12527 0 0 /news/hollands220417 1 13970 0 0 /news/20thaug04A.html 1 0 0 0 /news/folkestoneinvicta230721 2 24703 0 0 /news/craywandsredb270915 3 64934 0 0 /news/wehavetobeatourbesttobeatashfordsaysdealtownbossderekhares 1 16400 0 0 /news/kentleague/erithtown/1stoct04.html 1 0 0 0 /news/551a9c92de6e8 2 25913 0 0 /news/2nddec04.html 1 0 0 0 /news/kspogleb210222/ 2 0 0 0 /news/othernews/seal260904.html 1 0 0 0 /archive-2006-2014/153 1 19656 0 0 /news/soccershortstonbridgeangelsunveiljohnmaggsasgeneralmanager 2 32162 0 0 /assets/ 2 6124 0 0 /news/wearegoingthroughabadpatchadmitssheppeyunitedbosskevinhake 1 11782 0 0 /news/adambirchallwilladdthatlittlebitofqualitytothesquadsaysdartfordbosstonyburman 1 13829 0 0 /news/kentleague/sevenoaks/16thaug03.html 1 0 0 0 /news/doverathleticbossmartinhayesreleasesquartet 1 14915 0 0 /news/maidstoneunited0a0sittingbourne-themainproblemwasthebreakerwentsaysbournechairman 1 16464 0 0 /news/maidstone170716 1 15125 0 0 /news/551bc5e6de5d7 1 16410 0 0 /fisher-2003-2006/2 3 25875 0 0 /news/hernevafcwimfav181003.html 1 0 0 0 /news/tommysampsonbenefitnightletsraisefundsfortommy 1 14362 0 0 /news/28thoct05.html 1 0 0 0 /news/westdeal231019 1 34507 0 0 /news/551bc99dbe7a4 2 90582 0 0 /news/margatebossiainoconnellwillgivetrialistsplentyoftime 1 18492 0 0 /news/afccroydonathletic230922 1 11760 0 0 /news/doverathleticunveilcollinandlovellsignings 1 15812 0 0 /news/fcelmstead2-1oldroan-theclubsreallybuzzingsayselmsteadbossfabiorossi 1 29631 0 0 /news/soccershortsrobbinsrelishingtelfordshowdown 1 25266 0 0 /news/folkestoneinvicta3-1gravesendnorthfleet 1 15031 0 0 /archive-2006-2014/226 1 19109 0 0 /news/halseydrillswinningmentalityintobaysplayers 1 20288 0 0 /news/kentleague/sporting/sportvslade181003.html 1 0 0 0 /news/drmartens/premier/dover/kingstonian060904.html 1 0 0 0 /news/scottlindseyreturnstofolkestoneinvicta 1 13320 0 0 /news/eveshamunited1-2bromley-theygaveusonehellofagameadmitsmarkgoldberg 2 53082 0 0 /news/551a97b24d6d1 1 15640 0 0 /news/saturdaysmatchreports-3 1 9955 0 0 /news/sittingbourne110320 3 43185 1 1 /news/551bc99dbe7a4/kentleague/lordswood/drmartens/eastern/sittingbourne/banburyvsitt111003.html 2 15653 0 0 /news/hollcray050419 1 30299 0 0 /news/551a96db99f47 1 4116 0 0 /news/fisher260216 1 13821 0 0 /news/551a95b404901 3 44938 0 0 /news/551a979882f7c 2 21962 0 0 /news-conference-2003-2006/ 1 2510 0 0 /news/cantbigg240219 3 49558 2 2 /news/sevenoakstown5-0canterburycity-weretryingtobuildasuccessfulclubsaysmickyhazard 1 40035 0 0 /news/vickersgroundlooksapicture 1 12825 0 0 /login/ 1 11052 0 0 /news/myaimistobondeveryonesaysnewfolkestoneinvictachairman 1 24948 0 0 /news/wecanbearoundthetopcometheendoftheseasonsaysmaidstoneunitedcoachjackparkinson 1 17559 0 0 /news/kentleague/VCD/vcd.html 1 0 0 0 /news/ramsgate1-3bromley-wardslamsrefovercostlyblunders 1 23109 0 0 /news/rivalofferscashforstrikergash 1 13186 0 0 /news/drmartens/eastern/folkestone/stamvfolk240104.html 1 0 0 0 /news/hythfolk270422 2 66359 0 0 /news/hollandsandblair101121 1 13237 0 0 /news/wellingunited2-1lutontown-forustogetinsecondroundisamassiveachievementsaysday 1 31427 0 0 /news/cugleycashwillbespentonthepitchduringthesummer 1 21150 0 0 /news/suffolkshowdownthisisntthetitledecidersaysburman-exclusive 1 15538 0 0 /news/movingtothamesmeadwasntadifficultchoicetomakesaysbexleyboroughbossliamkelly 1 13114 0 0 /news/beckenham180219 1 13170 0 0 /news/botterillisthefinalpieceinourjigsawsaysluchford 1 15850 0 0 /news/ashfordtown0-1tilbury-imdisappointedthatwereoutsayslovell 1 17101 0 0 /news/551bc5dd5a682 2 18521 0 0 /news/faversham200720 2 23515 0 0 /news/thamesmead240818 2 30560 0 0 /news/thefacupthirdqualifyingrounddraw-1 1 13803 0 0 /news/551a931e86ef7 2 33256 0 0 /news/daishkeelingwilladdadimensiontoourplay 1 12003 0 0 /news/holmbrid090915 1 31650 0 0 /news/youcantblamethemforleavingadmitsgibbons 1 13426 0 0 /news/margateproposeone-yearcva 1 12667 0 0 /news/551a9c927f0ea 3 40837 0 0 /news/551bc5d9f398b 4 35652 1 0 /news/551bc5dfd4136 3 33127 0 0 /news/hallsathletic150517 1 17005 0 0 /news/invictastrikerjonestogoundertheknife 1 17543 0 0 /news/551a9cf4df079 2 20296 0 0 /news/greenways250518 1 14214 0 0 /news/moeisa230718 2 24893 0 0 /news/fisher2-2crawleydowngatwick-wehadtherubofthegreenadmitssimonhalsey 1 29269 0 0 /news/hessenthalerreflectsonfleetwoodwinitwasareallygoodperformanceandagreatresult 1 21294 0 0 /news/abbottlooksforwardtohisvisittothepolice 1 12817 0 0 /news/margate0-2craywanderers-weshouldbehigheruptheleagueadmitsmargatebossiainoconnell 1 23139 0 0 /news/kentleague/thamesmead/14thjuly04.html 1 0 0 0 /news/dealerit110223 1 38264 0 0 /news/stalbanscity2-2bromley-werebehindtargetatthemomentadmitsbromleybossmarkgoldberg 1 27024 0 0 /news/551a97b17f01b 1 16494 0 0 /news/8thmar05A.html 1 0 0 0 /news/paulegan280620 1 11469 0 0 /news/ashfordtown2-1kingstonian 1 13831 0 0 /news/dalersunveilhughesastheirnewcoach 1 16147 0 0 /news/shockoverdeathofyoungangel 1 12491 0 0 /news/theresstillalongwaytogointhetitleracesaystable-toppinghessenthaler 1 14278 0 0 /news/apmcontrast110316 2 19197 0 0 /news/tonbridgeangels130720 1 10730 0 0 /news/551a99e3c0f32 1 12127 0 0 /news/enfieldtown031205.html 1 0 0 0 /news/kentcounty/21stoct03.html 1 0 0 0 /news/lingdeal021223/southern-counties-east-football-league 1 13054 0 0 /news/glebe291221 7 25921 6 6 /archive-2006-2014/46 1 20955 0 0 /news/marcuscassisusissuesbromleybossmarkgoldbergagentlereminderofhisgoalscoringprowess 1 19773 0 0 /news/551a931e310e1 1 11230 0 0 /news/sittingbourne090119 2 23985 0 0 /news/welling090717 1 13810 0 0 /news/kentleague/4thnov03.html 1 0 0 0 /news/dolbypaystributetoprolificstrikers 1 15157 0 0 /news/551a96779274b 2 17956 0 0 /news/imstillnotquitesurehowchipsteadbeatustwicelastseasonadmitsneilcugley 1 14711 0 0 /news/BHTown131205.html 1 0 0 0 /news/wevegotagoodsolidbasetoworkonsayslovell 1 20670 0 0 /news/warrilowseesmingleasareplacementforminshull 1 13552 0 0 /news/wp-content/plugins/prenota/alpha.php 1 0 0 0 /news/erithtown010623 4 47674 0 0 /news/dartford2-7tottenhamhotspur 1 20521 0 0 /news/folkestonesigncolchesterstrikeronloan 1 12132 0 0 /news/14thfeb05.html 1 0 0 0 /news/551a97b1f234f 1 17394 0 0 /news/551a9718e9ed0 3 34349 0 0 /news/daishcriticiseshissidesworthethicduringstaffordshocker 1 15630 0 0 /news/drmartens/premier/dover/tonbridge301004.html 1 0 0 0 /news/551bc5e36d9c0 1 19564 0 0 /news/itallaboutusandwhatwedosaysangelsassistantalexobrien 1 14504 0 0 /news/results/londonseniorcup.html 1 0 0 0 /news/20thdec04.html 1 0 0 0 /news/maidstoneunited0-1waltoncasuals-alltheywantedtodowaswastetimesaysjaysaunders 1 19308 0 0 /news/551a96781bf99 3 32776 0 0 /news/wewontbetakinganyprisionersoverthefestiveperiodsaysward 1 18564 0 0 /news/551a9c914f572 3 35684 0 0 /news/551bc99aa82d8 2 17451 0 0 /news/craywanderers3-1thamesmeadtown-isaidwewouldjustconcentrateonthefootball-joefrancis 1 27710 0 0 /news/margate021120 2 27369 0 0 /news/dartfordryanhayes130518 4 23707 2 1 /news/itsagreatopportunitytogetsomesilverwarefortheclubsaysashfordassistantjohnovard 1 14384 0 0 /news/simple.php 1 0 0 0 /news/551a956b9d66d 1 3777 0 0 /news/551bc99dbe7a4/kentleague/maidstone/ryman/bromley/7thdec03.html 2 15653 0 0 /news/thamesmead020106.html 1 0 0 0 /news/kentleaguetitledeciderstandanddeliverexclusiveinterviews 1 26779 0 0 /news/resultsoctober2017 3 116217 0 0 /news/averyhasntputafootwrongandiwanttokeephimsaysbinks-exclusive 1 13680 0 0 /news/harrtonb260817 2 52278 0 0 /news/sundayrepresentsanopportunitytoputadifficultweekbehindussaysfavershamtownbossturner 1 14407 0 0 /news/sheppey310820 1 13287 0 0 /news/551bc99dbe7a4/ryman/news/tonbridge%20invicta%20030104.html 2 15653 0 0 /news/afccroydonathletic130923 2 16472 0 0 /news/wealwaysbouncebackfromabaddefeatinsistsbecksnumbertwomichaelmarks 1 17071 0 0 /news/othernews/gotravelkentleaguetables.html 1 0 0 0 /news/seagerkeepshisunbeatensidesfeetontheground 1 11839 0 0 /news/theressomuchpressureonmyyoungsideadmitsmiles-exclusiveinterview 1 14884 0 0 /news/folkestoneinvicta1-0chelmsfordcity 1 16540 0 0 /news/drmartens/eastern/ashford/23rdaug04.html 1 0 0 0 /news/551bc99ac1ae4 1 4661 0 0 /news/22ndsept05.html 1 0 0 0 /news/bromley020621 2 20511 0 0 /news/expectationsremainthesamedespiterowlandsigningsaysluchford 1 14269 0 0 /news/folkestoneinvicta1-0ramsgate-drydenpouncestogivefolkestonejoyoverrams 1 15799 0 0 /news/wearetoojekyllandhydeatthemomentadmitscrayvalleybossstevechapman 1 14059 0 0 /news/551a9718bfd4d 3 27299 0 0 /news/551bc99dbe7a4/conference/gravesend/othernews/ksc1stround.html 2 15653 0 0 /news/wevegottobeatourbesttoproducegiantkillingsaysjustinluchford 1 16610 0 0 /news/551bc5e4e7b69 1 12522 0 0 /news/welooktoguidewhitstableupthetablesaysbossnickysouthall 1 13448 0 0 /news/crayrams150818 3 73621 0 0 /archive-2006-2014/58 1 20768 0 0 /news/kentleague/ramsgate/4thnov03.html 1 0 0 0 /news/sevenoaks190719 2 25389 0 0 /news/tunbridgewells130123 1 13572 0 0 /news/mangotsfield081005.html 1 0 0 0 /news/551a925088e78 1 3216 0 0 /news/kimbleslamsdismaldefenderduringcupshocker-exclusiveinterview 1 11152 0 0 /news/myplayershavegottoshowtheirtalentsonthebigstagesaysdoverbossmartinhayes 1 18791 0 0 /news/551a9798ebb4a 1 5484 0 0 /news/erithandbelvedere071222 1 11687 0 0 /news/551bc5dd3536d 2 20197 0 0 /news/kfu250518 2 15197 0 0 /news/jamiedayisstilladartfordplayerinsistsdartschairman 1 14857 0 0 /news/holmesdalechairmanpleasegiveusthechancetoplaykentleaguefootball-exclusiveinterview 1 17040 0 0 /news/wereadecentsideandweneedtobewinninggamessaystunbridgewellsbossmartinlarkin 1 15432 0 0 /news/holmchip040815 1 35724 0 0 /news/551bc5e42efd7 1 2881 1 0 /news/welldealwitheverythingthatisthrownatussayscugley 1 15234 0 0 /news/hythetown1-0burgesshilltown-itsabouttimewegotalatewinnersaysscottporter 1 22596 0 0 /news/daishwecantaffordtokeeppart-timeplayers 2 14085 0 0 /news/woodstocksports0-4corinthian-imhopingwecanpullsomethingoutofthebagsaysbentaylor 1 26902 0 0 /news/bromley120118 1 12483 0 0 /news/wevegotladswhowillrunthroughabrickwallforsittingbournesaysbossjimward 2 19816 1 0 /news/dealphoe250323 2 52871 0 0 /news/idehill210820 1 11335 0 0 /news/tunbridgewells301105.html 1 0 0 0 /news/othernews/britishenergykentcountyleaguetables140304.html 1 0 0 0 /archive-2006-2014/56 1 20502 0 0 /news/drmartens/eastern/folkestone/kingvfolk170104.html 1 0 0 0 /news/ithinkwevemadetherightmovesaysaylesfordpapermillschairmanbrianreynolds 1 16702 0 0 /news/551a97b16b7bc 1 16560 0 0 /news/thefacupfourthqualifyingrounddraw-1 1 12370 0 0 /news/ontheairwavesnewwingsbossfordpromiseschangesandhasconcernsoverplayersfitness 1 19814 0 0 /news/doversettowieldtheaxe 1 13927 0 0 /news/tootingbec210522 1 18267 0 0 /news/551bc5dab54ea 4 30112 0 0 /news/drmartens/premier/welling/23jan04.html 1 0 0 0 /news/ashfordtown0-1bromley-new-lookashfordimpressduringfirstouting 1 13114 0 0 /news/551bc99b421ba 2 13383 0 0 /news/soccershortsstonesdealtgroundfundingblow 1 19001 0 0 /news/551a979aadc7c 1 5036 0 0 /news/wellingtown280719 1 14740 0 0 /news/whitehawk2-2favershamtown-iwouldhavetakenapointbeforethegameadmitshappyluchford 1 37472 0 0 /news/weworkedreallyhardtotrytokeepdaneasonattheclubsayshernebaychairmantrevorkennett 1 12238 0 0 /news/551a9cf4e9f45 2 14843 0 0 /news/marghern300917 2 70541 0 0 /news/mrniceguysmithfollowshisamericandream 1 23767 0 0 /news/kentleague/tunbridgewells/7thnov04.html 1 0 0 0 /news/skipperpaullorrainecommitsfuturetoebbsfleetunited 1 11992 0 0 /news/sheringhamsbeckenhamdebutputonhold 1 21763 0 0 /news/sittingbourne1-0hythetown-abbottintwotug-of-warfightsthispre-season 1 28221 0 0 /news/burmanaddsstrengthtohistitle-chasingsquad-exclusive 1 30929 0 0 /news/lewibrid151018 2 45601 0 0 /news/sheppeyunited270519A 1 12395 0 0 /news/longhurstsdeparturesparksreturnofrespectedduo 1 11828 0 0 /news/soccershortsblackmandevereuxandhessenthalerunveiledasassistantmanagers 2 34282 0 0 /news/erithtown180915 1 12130 0 0 /news/551a97b125e86 1 14791 0 0 /news/thamesmead140816 2 26397 0 0 /news/mar.php 1 0 0 0 /news/551bc5e5c4b04 1 13683 0 0 /news/dartford1-1portvale-wegotawaywithmurderadmitsportvalebossmickyadams 1 23138 0 0 /news/trottimbuildingateamofwinners-exclusiveinterview 1 20554 0 0 /news/hessenthalerplottingacoupleoftrophyupsets-exclusive 1 15449 0 0 /news/phoenix301016 3 35298 0 0 /news/551a967728f96 2 17641 0 0 /news/551a931e40052 1 9710 0 0 /news/dartford2-1favershamtown-iwashopingtomakeabitofhistoryfortheclubsaysrayturner 1 26839 0 0 /news/dontforgettoputyourclocksbackanhouratbedtimetonight 1 10646 0 0 /news/theclubfeelproudofadeyusuffsprogressatdaggerssayschathamtownbosskevinwatson 1 15170 0 0 /news/afcwimbledonsvisitwillhelpusoutfinanciallysaysbeckenhamtownbossjasonhuntley 1 18686 0 0 /news/comeandwatchourgoodproducturgesfolkestoneboss 2 20545 0 0 /news/hythetownwintheracetore-signmickelborough 1 12681 0 0 /news/ryman/bromley/bromvdartksc071003.html 1 0 0 0 /news/craywanderers4-1corinthian-casuals-jenkinsplansfortitledecider 1 16766 0 0 /news/punjabunited201023 4 39330 1 2 /news/drydenoutforjustonemonth 1 12465 0 0 /archive-2006-2014/48 2 25387 0 0 /news/bromleychairman180919 2 18346 0 0 /news/waltoncasuals180105.html 1 0 0 0 /news/lewes110220 2 24605 0 0 /news/craysitt111022 8 172744 1 1 /news/stonesgiventheall-cleartostagemuch-delayedtrophytieathomelands 1 18394 0 0 /news/otford080517 1 15259 0 0 /news/wellingunitedbeginsearchfornewmanagementteam 1 12972 0 0 /news/ramsgateunveildeanhillastheirnewmanager 2 21099 1 1 /news/craysitt231218 3 82598 0 0 /news/551a99e47da6b 1 16461 0 0 /news/wevegotanimportantmonthcomingupsaysburman 1 20519 0 0 /news/soccershortsliamdaishstransferdealingshanginthebalance 5 120170 4 4 /news/wewanttobetterourselvessayshythetownbossscottporter 1 16110 0 0 /news/sheppeyunited310722 2 26703 0 0 /news/haveimissedit-yesandnosayssevenoakstownbosssimonjones 1 12679 0 0 /news/icanseeushammeringsomesidewarnsfavershamtownassistantclivewalker 1 14161 0 0 /news/18thsept04.html 1 0 0 0 /news/erithbelvedere0-1maidstoneunited 1 11065 0 0 /news/hollands&blair120920 1 12835 0 0 /news/wejustwerentgoodenoughadmitsrelegatedward 1 15409 0 0 /news/wardpleasedwithramsopeningmatchfitnesslevels-exclusive 1 12299 0 0 /news/crayvalley020817 1 15226 0 0 /news/ourbuilduptothenewinvictaleagueseasonhasbeenexcellentsayssammacneil 1 13821 0 0 /news/drmartens/premier/dover/2ndaug04.html 1 0 0 0 /news/weneedtostartscoringgoalssaystrott-exclusiveinterview 1 24680 0 0 /news/551a9c0e490e6 2 18092 0 0 /news/rusthall300418 1 11238 0 0 /news/weregoingtobeadifficultsidetobeatthisseasonsayshernebaybosssamdenly 1 13831 0 0 /news/hythetown2-1doverathletic-fiskshockedashissideproducegiant-killing 1 21412 0 0 /news/welovebeingtheunderdogsayshythetownbossscottporter 1 14885 0 0 /news/beckenham201017 1 13036 0 0 /news/suttchip100518 1 28145 0 0 /news/9thsept03.html 1 0 0 0 /news/wecandobetteronourownbigpitchsayshernebaybosssimonhalsey 1 14302 0 0 /news/welearntafterthethreebridgesgamethatwejustcantturnupandrollteamsoversayssaunders 1 16327 0 0 /news/kentleague/lordswood/31stoct04.html 1 0 0 0 /news/redhillnotreadytowintheleagueyetadmitsbossmcintyre 1 15939 0 0 /news/lyddtown050216 1 12491 0 0 /news/drmartens/eastern/sittingbourne/27thnov04.html 1 0 0 0 /news/craywanderers0-1tonbridgeangels-idsettlefor1-0becauseawinsawinsaysalexobrien 1 35413 0 0 /news/phoenixsports2-1hollandsblair-wevegottolearnquicksayssteveoboyle 1 29783 0 0 /news/ashframs261119 3 82817 0 0 /news/551bc99b0ab56 2 17788 0 0 /news/StanPunj160418 3 43576 1 1 /eastern-2003-2006/ 1 2460 0 0 /news/itsbeenveryhardthisseasonnotgoingupsaysdepartinghildenboroughbossandrewmckechnie 1 15144 0 0 /news/ramsgate250519 2 24765 0 0 /news/soccershortskentclubspleasedwithpre-seasonpreparations 1 24526 0 0 /news/551a9250562dc 3 34963 0 0 /archive-2006-2014/224 1 19391 0 0 /news/drmartens/eastern/dartford/6thoct03.html 1 0 0 0 /news/folkestonesignbenjaminfromwellingunited 1 15430 0 0 /news/tunbphoe040423 4 152814 0 0 /news/wellingtown250522 1 15842 0 0 /news/weneedthesupporterstogetbehindtheboyssaysbromleycoachneilsmith 1 17432 0 0 /news/redbridge101205.html 1 0 0 0 /news/551a9797cf1cd 1 4220 0 0 /news/551a96dbc4a19 2 14309 0 0 /news/wellingunited3-1bromley-wereprovinghowgoodwearesaysford 1 19438 0 0 /news/drmartens/premier/dover/22ndnov04.html 1 0 0 0 /southern-counties-east-football-league/49 1 20100 0 0 /news/kentleague/tunbridgewells/18thaug04A.html 1 0 0 0 /news/551bc99dbe7a4/nationwide/gillingham/ryman/bromley/4thjan04.html 2 15653 0 0 /news/551bc99c4b2a4 2 24797 0 0 /news/congratulationsramsgatefootballclubrymanleaguecupwinners2008 1 9832 0 0 /news/bromley161218 2 19540 0 0 /news/wellingunited190919 1 13284 0 0 /news/tosponsorkentishfootballtelephonestephenmccartneyon07979418360 1 9835 0 0 /news/551a96dc1b831 3 33974 0 0 /news/bromley180919 2 19549 0 0 /news/croydon250421 4 55810 0 0 /news/greenwich011216 2 29151 0 0 /news/551a931dd5817 1 11332 0 0 /news/sittingbourne220619 2 38615 0 0 /news/drmartens/premier/dover/dovervfolk170204.html 1 0 0 0 /news/551bc5e7729b7 1 15186 0 0 /news/idontthinkwecankeepthisclubgoingwarnsgreenwichboroughbossstevefirkins 1 27411 0 0 /news/thebottomlineissurvivalinsistsangelschairman-exclusiveinterview 1 16527 0 0 /news/wingsbossjamiedayrelishingarsenalvisit 1 12366 0 0 /news/uxbridge221005.html 1 0 0 0 /news/fisherfacupreplay210904.html 1 0 0 0 /news/maliniwillunearthplayerstoplayfornothing-exclusiveinterview 1 16555 0 0 /news/welling260116 1 13360 0 0 /news/johnwilfort030317 1 12892 0 0 /national-league/32 2 24696 0 0 /news/thame040915 2 26283 0 0 /news/margate010719 2 22872 0 0 /news/doverathleticcountcostfollowingunacceptable11minuteabandonment 1 14524 0 0 /news/rymanleaguenewsinbriefcomingsandgoings 1 16388 0 0 /news/thamesmeadtown1-2craywanderers-iwontputastrongsideoutinthisagainsayskeithmcmahon 1 32456 0 0 /news/chathamtown1-6whitehawk-embarrassing 1 19456 0 0 /lordswood-2003-2006 13 171545 0 0 /news/551a956be4366 1 4936 0 0 /news/newboysgivenchancetoshineagainstaverygoodnon-leagueside 1 16854 0 0 /news/ryman/bromley/23rdjune03.html 1 0 0 0 //config.json 1 0 0 1 /news/hernvslad061203.html 1 0 0 0 /news/beckchat310123 3 62644 0 0 /news/iwanttohelpdoverwintheleaguesaysnewstrikerlovell 1 14392 0 0 /news/facupspecialstonesconfidentastheybidtoplaythebigboys 1 13978 0 0 /news/doverathletic140221 1 11869 0 0 /news/bromleytiewelchandfuseinidowntocontractsuntiltheendofnextseason 1 12761 0 0 /news/iwanttoputpressureonmyforwardssaysmcmahon 1 17029 0 0 /news/drmartens/eastern/tonbridge/26thnov04.html 1 0 0 0 /news/551a9c916d2b3 2 20628 0 0 /news/MaidSaunders030415 2 26709 0 0 /news/bromley3-2crystalpalace-ourplaywasthecreamonthetopsaysbromleybossmarkgoldberg 2 32083 0 0 /news/crayvalley130815 1 13010 0 0 /news/sevenoaksupsetwithbengalsgreatprovocation 1 11848 0 0 /news/551a9c91c4c24 2 17592 0 0 /news/erithandbelvedere221222 1 15243 0 0 /tier-football/5 2 20093 0 0 /news/551a97b140506 1 12729 0 0 /news/treblechasingwestwickhamemulateipswichtownbywinningprestigiouscup-exclusiveinterview 1 12475 0 0 /news/starjimmybullardtorefereecharityclashatphoenixsports 1 14016 0 0 /news/potthern140822 5 133495 0 0 /news/551bc99d04290 2 27091 0 0 /news/whenbiggerclubscomeafterourplayersitisdifficulttoturnthemdownsaysjamieday 1 12981 0 0 /news/551bc5de30125 1 11179 0 0 /news/cgi-bin/xmrlpc.php 1 0 0 0 /news/551a9677d3432 2 16208 0 0 /news/ebbsfleetunitedbossliamdaishcontinuessquadrebuildingprogramme 1 21454 0 0 /news/hamble200805.html 2 0 0 0 /news/corinthianhavethebesttrainingfacilitiesinkentinsistscoachdouglas 1 20698 0 0 /news/cumberbatchrallieshistroopsfordoverdate 1 12788 0 0 /news/551bc99dbe7a4/drmartens/eastern/dartford/kentleague/sporting/20thjuly03.html 2 15653 0 0 /news/corinthian-casuals2-3whitstabletown-iknewhowmuchitmeanttomyclubsaysheroicdenly 1 46215 0 0 /news/alltheleaguesinonepaper 1 12239 0 0 /news/folkestoneinvicta2maldontown0exclusiveinterview 1 15333 0 0 /news/rusthall091218 1 12544 0 0 /news/wewillneedtobeflyingfromthefirstminutesayswoodstocksportsassistantchriscooper 1 14370 0 0 /news/guildfordcity050121 1 12343 0 0 /news/newromneyhelphytheintheirhourofneed 1 12693 0 0 /isthmian-league/26 3 44795 0 0 /news/onagooddaybromleywillbeatanyoneintheleaguewarnsdoverathleticbosschriskinnear 1 14338 0 0 /news/551a9c9173983 2 15196 0 0 /news/dover030816 1 11494 0 0 /news/weregoingintotheunknownadmitspromotedholmesdalechairman-exclusive 1 13555 0 0 /news/folkestoneputstrikerdrydenontransferlist 1 14404 0 0 /archive-2006-2014/236 1 19297 0 0 /news/finalshouldbeplayedatprincesparkbemoansgorman 1 13692 0 0 /news/551bc99b39646 2 15165 0 0 /news/ramsgate-fc.co.uk 2 0 0 0 /news/mundayfocusesonstartingwellatwhitstable 1 20181 0 0 /news/afccbear100917 1 31136 0 0 /news/imcertainlyambitious-managingatahigherlevelinspiresmesaystonyrussell 1 13438 0 0 /news/8thaug05.html 1 0 0 0 /news/chairmanhasgroundsforoptimismaheadofplay-offs-exclusive 1 17073 0 0 /news/iwanttotaketheclubforwardbutweneedthefanssupportsayswhitstablechairmangaryjohnson 1 18970 0 0 /news/22stjune05.html 2 0 0 0 /news/canterbury230715 2 19380 1 1 /news/551a9c91d9f95 2 16257 0 0 /news/13thoct04.html 1 0 0 0 /news/kingstonian100905.html 1 0 0 0 /news/gillingham160615 1 13922 0 0 /news/551bc99dbe7a4/kentleague/erithtown/drmartens/eastern/ashford/ashvbromleyfac130903.html 2 15653 0 0 /news/nottwantsgoodbackingagainstdarts 1 18278 0 0 /news/strikerbremnerlistenstooffers 1 14841 0 0 /news/wemustturnoverbillericayinsistsfuriouscraychairman 1 21318 0 0 /news/kentseniorcupsemi-finaldraw 1 9948 0 0 /news/greenwich180817 2 25929 0 0 /news/wecanstillmakeplay-offssayslovell 1 13194 0 0 /news/icannotwaittostepoutatpriestfieldsaysemmatune 1 14722 0 0 /news/corinthian120218 1 11792 0 0 /news/drmartens/premier/dover/19thsept04.html 1 0 0 0 /news/charltonathleticunveilbobpeetersastheirnewboss 2 19882 0 0 /news/weneedtocontinuethegoodworksayshernebaybosssamdenly 1 15097 0 0 /news/vcdrom131216 3 71289 0 0 /news/ithoughtwewerealwaysupagainstittogetthisgameonsaysdulwichhamletbossgavinrose 1 18566 0 0 /news/wevetriedeverythingtokeepbealessayswarrilow-exclusive 1 14967 0 0 /news/551bc5db15f0c 4 34528 0 1 /news/EssexSeniorLeagueStatement240320 1 11201 0 0 /news/:https://www.jsgm.co.uk/ 1 0 0 0 /news/1stjan06.html 2 0 0 0 /news/dealmarg080717 3 72567 0 0 /news/holmpunj250123 4 138690 0 0 /news/dartford0-1hamptonrichmondborough-welackedthecuttingedgeadmitsmuggedburman 1 24244 0 0 /news/smellsliketeenspirit-beckssignlionspaironloan 1 13279 0 0 /news/thefleetatwembleyletsbringthetrophyhome 1 13978 0 0 /news/dealtown080416 1 11074 0 0 /news/folkestoneinvictatopayofftheirdebtsthreemonthsearly 2 17820 0 0 //.env 3 10856 2 0 /news/lewishamborough050821 1 11935 0 0 /news/walkerstaysatfaversham 1 15183 0 0 /news/iwasntgoingtochangemybeliefsandprinciples-justinluchford 1 16643 0 0 /news/22ndjune04.html 1 0 0 0 /news/551bc5e6ee423 1 19996 0 0 /news/551bc5de32dbd 1 13061 0 0 /news/longhurst181015 2 34841 0 0 /news/hernebay300616 3 25822 0 0 /news/hythetown3-4lordswood-itwasembarrassingfrommypointofviewfumesscottporter 1 25935 0 0 /news/kentleague/ramsgate/11thmar04.html 1 0 0 0 /news/kfu111215 1 15184 0 0 /news/angelschairmanourerraticformistotallyunacceptableexclusiveinterview 2 21958 0 0 /news/itwillbeagreatopenertotheseasonanticipateshernebaybosssimonhalsey 1 21777 0 0 /news/551a9799e46f7 1 5027 0 0 /news/lyddtown180723 4 46926 0 0 /news/dulwleis130115 2 49947 0 0 /news/551bc99dbe7a4/kentleague/ramsgate/othernews/26thoct03.html 2 15653 0 0 /news/northwoodrelishesdualfornumberonejersey-exclusive 1 14929 0 0 /news/hythe020405.html 1 0 0 0 /news/doverwillwaitfortheirstarstriker 1 16076 0 0 /news/crayvalleyatwembley160519B 2 21877 1 1 /news/24thnov05.html 1 0 0 0 /news/551a956c73a29 1 3420 0 0 /news/dartfordputfatrophytieback24hourstobeatbigfreeze 1 10921 0 0 /news/wellingunitedsplashouttomeetconferencepremiergroundgrading 1 14599 0 0 /news/thamesmead140917 2 35584 0 0 /news/resultsoctober2022 3 173332 0 0 /news/kentfootballunited090919 1 16949 0 0 /news/humehitwithsix-matchtouchlineban 1 13715 0 0 /news/maidstone271205.html 1 0 0 0 /news/ryman/bromley/carsvbromfat011103.html 1 0 0 0 /news/ebbsfleet230718 2 17180 0 0 /news/551bc5de65be2 1 11486 0 0 /news/princesparkspecialwelcomehomedarts 1 21028 0 0 /news/ournewchairmanisntgoingtopumploadsofmoneyintotheclubsaysjohncumberbatch 1 17047 0 0 /news/beatingbenficawasjustamazingsayssevenoakstowncoachmickyhazard 1 12119 0 0 /news/551bc99dbe7a4/kentleague/cray/kentleague/ramsgate/30thjune03.html 2 15653 0 0 /news/groundsforconcernforkentleagueclubs 1 16216 0 0 /news/kentleague/cray/crayvhern121103.html 1 0 0 0 /news/chatham151015 10 77360 5 6 /news/suttonunited3-2margate-keisterdidnotswearatthereferee-insistsyorath 1 26686 0 0 /news/canterbury091118 1 13187 0 0 /news/dartfordstarsditchtheirfootballbootstoplaycricket 1 14211 0 0 /news/bromvworth140204.html 1 0 0 0 /news/play-offlivekentsidesfeeltheagonyandecstasyofplay-offfootball 1 50281 0 0 /news/551a96db8328c 1 7318 0 0 /news/lanesettosignhissquadatendofseasonbash 1 15428 0 0 /news/551bc99b0e1bc 2 17793 0 0 /news/551a9250ef4fa 2 28381 0 0 /news/hendonquitsafter18daysshockergillinghamhavecrossedthelinefumesdoverchairmanparmenter 1 16288 0 0 /news/theeasterfootballprogramme 1 17501 0 0 /kent-invicta-league/12 2 25107 0 0 /news/crayvalley2-0afccroydonathletic-wereamillionmilesawayfromwembleysaysstevechapman 2 34988 0 0 /news/drmartens/eastern/ashford/18thsept03.html 1 0 0 0 /news/bromley-wakelingconcernedwithsevengamewinlessrun 2 22147 0 0 /news/playerswillkeeptheirshirtsiftheyplaywellsaysnewlyappointedwhitstablebosspeternott 1 23453 0 0 /news/suttonathletic190822 1 12903 0 0 /news/ithinkweredueafacuprunsayswellingunitedbossjamieday 1 15034 0 0 /news/weveshownthatwecancompetesaystonbridgeangelsbosstommywarrilow 1 12628 0 0 /news/ifwecandenthastingsandguernseysaspirationsthatwouldbegreatforussaysjimward 1 15929 0 0 /news/soccershortssittingbourneinviteapplicantsformanagerialvacancy 1 20000 0 0 /news/rusthall060116 7 41849 5 6 /news/wevegotnothingtoloseandeverythingtogainsaysvickersbossrickybennett 1 14822 0 0 /sittingbourne-2003-2006/4 2 29614 0 0 /news/phoeash110415 1 28525 0 0 /news/551a9799eeba1 1 5713 0 0 /news/doverchairmantellswingerthedealisstillonthetable 1 11925 0 0 /news/wellsct160218 1 29741 0 0 /news/wevegotapointtoproveadmitsshearer 1 13222 0 0 /folkestone-2003-2006/3 2 18211 0 0 /news/barkingside3-0erithbelvedere-pressuremountsonchriscosgrove 2 26426 0 0 /news/551a9797d1aeb 1 4249 0 0 /bromley-2003-2006/www.heineken.co.uk/www.heineken.co.uk/ 1 3221 0 0 /news/fisherreturntotheirrootsforfansmeeting 1 13594 0 0 /news/14thnov04.html 1 0 0 0 /news/beckenhamtown1-2kingslynntown-myplayerscouldntgiveusanymoresaysguttedmarks 1 40024 0 0 /news/tonbbrai050923 9 234185 2 1 /news/drmartens/eastern/tonbridge/8thoct04.html 1 0 0 0 /news/drmartens/eastern/sittingbourne/dartford240804.html 1 0 0 0 /news/551bc5e87b16c 1 11264 0 0 /news/illneverwalkawayfromtheclubilovesayscraywanderersbossianjenkins 1 15688 0 0 /news/betternewsforhamshare 2 14163 0 0 /news/backingkenttowembleyboroughhandedawaytieinlastsixteen 1 12701 0 0 /news/crayvalley1-2lordswood-hopefullyhelltakeusupnextseasonsaysstevechapman 2 40218 0 0 /news/551bc5e5bc762 1 12646 0 0 /isthmian-league/61 2 36130 0 0 /news/lewisham111119 1 11089 0 0 /news/ramsgate200919 2 22765 0 0 /news/drmartens/eastern/dartford/11thoct04.html 1 0 0 0 /news/results/kentleaguetables6thdec.html 2 0 0 0 /news/551bc5e4a8b70 2 18553 0 0 /news/myplayershavebondedreallywellsayssevenoakstownbosssimonjones 1 12944 0 0 /news/cugleysearchesforattackmindedplayers 1 15087 0 0 /news/thamesmeadcompletedoubletransferswoop 1 12987 0 0 /news/hessenthaler-hiscareertodate 1 16829 0 0 /news/kentfootballunited151119 1 12943 0 0 /archive-2006-2014/81 1 20835 0 0 /news/chairmanmccarthyquitsbeckenhamtown 1 11650 0 0 /news/phoetonb311015 2 59180 0 0 /news/iwanttowintheleaguesaysobrien 1 18902 0 0 /news/rusthall241220 1 11617 0 0 /news/conference/margate/carshalton160804.html 1 0 0 0 /news/erithandbelvedere201123 7 103604 1 1 /news/9thjune05.html 1 0 0 0 /news/gillingham0-2westhamunited-wejustcantseemtoputtheballinthenetsaysjamesmarrs 1 28242 0 0 /news/551bc5e8b318c 1 11793 0 0 /news/tunbshep260917 1 35878 0 0 /news/chatham081204.html 1 0 0 0 /news/wemustbefocusedandprofessionaltoavoidcupupsetsayscugley 1 13369 0 0 /news/sct241116 1 11712 0 0 /news/wearemakingsteadyprogressathythetownsaysbosstimdixon 1 13312 0 0 /news/551bc5dd1bcd2 1 11495 0 0 /news/551a979a7c044 1 4918 0 0 /archive-2006-2014/228 1 19778 0 0 /news/immakingafewnewsigningstotryandturnthetidesaysstonesbossandyford 1 17136 0 0 /news/cultheroratchfordreturnstofootball 1 13536 0 0 /news/weregoingtoeastleightowinsaysdoverathleticbosschriskinnear 1 14727 0 0 /news/fisher111223 52 288288 3 24 /news/lancinggroundimprovementsforcefavershamcupswitch 1 11270 0 0 /news/lordswood270716 1 12798 0 0 /news/sheplanc150423 2 63653 0 0 /news/logsdondemandsachangeinsevenoaksfortunes-exclusiveinterviews 2 28584 0 0 /news/wardadmitshewaswrongtoberaterefereefollowinglatepenaltydrama-exclusive 1 12886 0 0 /news/stonesheroicdefenderchargedoverseriousoffence 1 11099 0 0 /news/dartssealgroundsharedealwithlions 1 15133 0 0 /news/stansfeld101221 4 55258 0 0 /news/dartford0-2crystalpalace-sawyerhandsoverthedartsingoodshape 1 19640 0 0 /news/sportingclubthamesmead300819 1 13766 0 0 /news/dealtown120722 4 47638 0 0 /news/kingshill221118 1 11358 0 0 /news/margate030821 2 24773 0 0 /isthmian-league/57 3 43726 0 0 /news/cugleywaitsforoffersfordryden 1 15940 0 0 /news/deresfansset-upkentleaguepredictionleague 1 11611 0 0 /news/erithandbelvedere050320 1 13486 0 0 /news/551a99e54237e 1 18743 0 0 /news/551a9c917ad43 3 35706 0 0 /news/551bc5e58e0c7 2 22384 0 0 /archive-2006-2014/27 2 25514 0 0 /news/wellingtown091020 1 13865 0 0 /news/.well-known/acme-challenge/atomlib.php 1 0 0 0 /news/wellingtown301118 1 11961 0 0 /news/bromleybeginsearchforplayersfornewladiesside 1 14147 0 0 /news/littlehampton310805.html 1 0 0 0 /news/551a9c0e5beaa 2 14340 0 0 /news/corinthian251218 1 14706 0 0 /cray-2003-2006/www.heineken.co.uk/www.heineken.co.uk/ 1 3208 0 0 /news/theresnopressureatallonourladssaysfolkestoneinvictabossneilcugley 1 16168 0 0 /archive-2006-2014/16 2 25690 0 0 /news/tunwells010715 1 12429 0 0 /news/chatham020818 1 14773 0 0 /news/conference/margate/12thjuly04.html 1 0 0 0 /news/551a97b20b42d 1 14333 0 0 /news/thebigkickoffthamesmeadtown2-0croydon-trademarkdimmockgoalsettlesopeningdayclash 1 20239 0 0 /news/wellhythe101216 4 101569 2 2 /news/dulwichhamlet2-1folkestoneinvicta-ithoughtwewerepooradmitsfolkestonebossneilcugley 2 32544 1 1 /news/soccershortsmysidecanholdtheirownintherymanpremier-burman 1 16308 0 0 /news/greenwichboroughlookforwardtotheirhistoricday 1 13832 0 0 /news/favstrike050715 1 12607 0 0 /news/managershavetheireyesonthebigprize-exclusiveinterviews 1 29535 0 0 /news/weredesperatetogetbackinactionsaysfolkestoneinvictabossneilcugley 1 16159 0 0 /news/phoenix270715 2 31752 0 0 /news/lordswood060621 4 50090 0 0 /news/sheppey270519 1 12073 0 0 /news/bromley050815 2 18808 0 0 /news/wingsplayatthefleetonthursdaynight 1 11906 0 0 /news/welling210416 1 11785 0 0 /news/ebbsfleetunited080722 1 12636 0 0 /news/itstimetogetourseasonupandrunningsayscrayvalleybosspaulgross 1 14669 0 0 /news/kingstonian3-0ashfordtown-lovellksthree-goalvictorywasflattering 1 20123 0 0 /news/beckguil160322 5 133204 0 0 /news/doverathleticsponsorshiptalksareprogressingwellsayschairman 1 12562 0 0 /news/exeter130805.html 1 0 0 0 /news/551bc99dbe7a4/kentleague/sladegreen/kentleague/tunbridgewells/7thjuly03.html 2 15653 0 0 /news/iwantthefavershamtownjobsayscurrentcoachpiggott-exclusive 1 14953 0 0 /news/ioxi-rex3.php7 1 0 0 0 /news/ourlastfivegamesoftheseasonaredifficultsaysramsgatebossjimward 1 20357 0 0 /news/greenwich210417 3 28906 0 0 /news/mcmahonplaylikethatagainandwellgetknockedout-exclusive 1 13858 0 0 /news/wp-admin/index.php 1 0 0 0 /news/iwilllearnunderdaishsayscollins 1 16142 0 0 /news/kentleague/hythe/beckenham110904.html 1 0 0 0 /news/fisher210916 1 13740 0 0 /folkestone-2003-2006 14 176961 1 1 /news/551a925065c97 2 16388 0 0 /news/drmartens/eastern/tonbridge/23rdnov03.html 2 0 0 0 /news/drmartens/eastern/chatham/10thnov03.html 1 0 0 0 /news/kingstonian2-0margate-wecouldvegotsomethingfromthegameadmitsbutler 1 31761 0 0 /news/kentleague/sporting/sportvlord131203.html 1 0 0 0 /news/iwanttodowellatthefleetinsistsdebolla 1 13092 0 0 /news/faversham310119 3 29367 0 0 /news/ware2-1thamesmeadtown-meadsufferlateheartbreakonrymandebut 1 13065 0 0 /news/crockenhillsubmitplanningpermissionforfloodlights-exclusive 1 13359 0 0 /news/idbemadtoleavemaidstoneunitednowadmitswalker 1 12721 0 0 /news/551bc5e28f88a 1 17768 0 0 /news/bromley1-0worcestercity-weredelightedwereinthehatsaysbromleybossmarkgoldberg 1 30455 0 0 /news/craywanderers110823 3 34226 0 1 /news/greenwich200519A 2 29310 0 0 /news/werefightingtokeepourheadsabovewateradmitsward 1 13061 0 0 /news/551a979877ebf 1 3567 0 0 /news/kentcountyleagueselectssquad 1 11346 0 0 /news/dartford020519 2 15068 0 0 /news/luckhasntgoneforusthisyearadmitshollandsblairbosspaulpiggott 1 17098 0 0 /news/wp-content/plugins/ubh/up.php 1 0 0 0 /news/iwontupsetanyofourrivalsbysayingstupidthings-burman 1 16820 0 0 /news/wp-admin/user/xmrlpc.php 2 0 0 0 /news/burmanletsmakedartfordbetterthanitalreadyis 2 15079 0 0 /news/tunbridgewells2-0hadleighunited-wevereachedsemiswithoutspendingapenny-martinlarkin 1 28566 0 0 /news/folkestoneinvictap-pstainestown 1 10032 0 0 /news/fordhitsbackatstonescriticism 1 11857 0 0 /news/kentleagueunveilnewsponsorshipdeal 1 12120 0 0 /news/hythehaveplentyinreserveexclusive 2 19175 0 0 /news/craywands170116 3 35651 0 0 /news/martinscoopsbecksawards 2 13778 0 0 /news/ashfordravagedbyinjuriesforymcavisit-exclusiveinterview 1 23797 0 0 /news/folkestone220719 2 25864 0 0 /news/mcmahonunveilscaptureoftiesseandmott 1 14151 0 0 /news/wellworkhardonthebitsimnothappywithsayserithbelvederebossmickycollins 1 12955 0 0 /news/folkestoneinvicta1-0worthing 1 13838 0 0 /news/craywanderers250321A 3 30531 0 0 /news/551a931df3571 2 29788 0 0 /news/folkestone100716 2 29503 0 0 /news/17thdec03.html 1 0 0 0 /news/kspodeal070221 2 58580 0 0 /news/londonfa081015 2 33218 0 0 /news/551bc99dbe7a4/kentleague/erithtown/drmartens/cupdraw.html 2 15653 0 0 /news/favegree081217 1 13057 0 0 /news/folkestone301104.html 1 0 0 0 /news/croydon240818 1 14228 0 0 /news/conference/margate/16thoct.html 1 0 0 0 /news/551bc5e403395 1 15560 0 0 /news/sevenoakstown180721 2 25321 0 0 /news/drmartens/eastern/erith&belvedere/19thjuly04.html 1 0 0 0 /news/burmanplottingfacupupset 1 14638 0 0 /news/refereefittodrivehomedespitehealthscare 1 11532 0 0 /news/ryman/bromley/9thjuly03.html 1 0 0 0 /news/drmartens/premier/dover/28thoct04.html 1 0 0 0 /news/551a97b15c54b 1 17294 0 0 /news/phoenixsports270919 2 28133 0 0 /news/thestandardoffootballinmedwayisgoingupsayshollandsblairbosspaulpiggott 1 13767 0 0 /news/Ebelphoe150415 1 36404 0 0 /news/resultsaprilandmay2023 4 187069 0 0 /news/canterbury130715 1 14813 0 0 /news/551a967807c16 2 15264 0 0 /news/craywands251215 3 35443 0 0 /news/dartvsitt160304.html 1 0 0 0 /news/tommywarrilowbringsjohnbealesbackhometolongmeadstadium 1 13320 0 0 /news/wevegottolearnquicklyadmitscox-exclusive 1 17075 0 0 /news/551bc99e580c8 2 15846 0 0 /news/soccershorts050617 2 36824 0 0 /news/theboysthriveonplayingbiggamesagainsthigheroppositionsayshythetownbossscottporter 1 16616 0 0 /news/corinthian-casuals1-1hythetown5-4pens-wehavetokillteamsoffsaysscottporter 1 20732 0 0 /news/rochesterunited3-1phoenixsports-benchbust-upmarskentinvictaleagueshield 1 29245 0 0 /news/folkestone250720 2 26459 0 0 /news/edgardavidsisamassiveplayerandamassivenameinthegamesayswellingunitedbossjamieday 2 19299 0 0 /news/551bc99dbe7a4/conference/margate/ryman/bromley/26thjune03.html 2 15653 0 0 /news/favershamtowndoesneedalittlebitofhelptogotothenextlevelsaysrayturner 1 18928 0 0 /news/doverathletic4-1ramsgate-hessenthalersecondhalfdisplaywasajoytowatch 1 20934 0 0 /news/canterburycitybeginsearchforreserveteammanager 1 11160 0 0 /news/kentleague/sevenoaks/j'darcy260804.html 1 0 0 0 /news/sittingbourne1-1waltoncasuals-someofourfansaregettingaheadofthemselves-dannyward 1 19159 0 0 /news/pixielottcry290316 2 34418 0 0 /news/551a9cf51a8a6 3 43944 0 0 /news/iwanttowinthekentseniorcupsayswhitstabletownbosspeternott 1 21719 0 0 /news/chessington240704.html 1 0 0 0 /news/thamesmeadtown3-0wellingunited-wellmakesurewellgetitrightvowswellingbossjamieday 1 28225 0 0 /news/551bc5e8c3e98 1 11695 0 0 /news/thamesmeadtown0-2dartford-weshowedtherewasntahugegapsayskeithmcmahon 1 27214 0 0 /news/551a96771febb 2 16089 0 0 /news/551a979adf25f 1 5558 0 0 /news/werenotthefinishedarticlesaystable-toppingrobbins 1 13576 0 0 /drmartens/premier/welling/margate021104.html 1 9955 0 0 /archive-2006-2014/232 1 18886 0 0 /news/dartscoachhashighhopesforteenagegoalkeeperibrahim 1 14213 0 0 /news/tunwells030915 1 14815 0 0 /news/551a956bcfd65 3 22454 1 0 /news/ihopemyteamperformtwogamesinarowsayscroydonbossdicksongill 1 14420 0 0 /news/wewillbedoingourlevelbesttoprogressupthetableinsistsmunday 1 15111 0 0 /thamesmead-2003-2006/2 2 17462 0 1 /news/551a99e3695d8 1 10766 0 0 /news/551a9c919dfe1 3 48532 0 0 /news/sittingbourneadapttolifeintherymanleague-exclusiveinterview 1 13002 0 0 /news/wellingtown030523 1 11749 0 0 /news/theclubismovingintherightdirectionsayscorinthianbossmattlonghurst 1 15474 0 0 /dartford-2003-2006 14 174292 1 1 /news/ifwerenotchallengingimsuremyjobwillbeindoubtsaysstonesbossjaysaunders 1 18631 0 0 /news/starsturnoutforwingslegendbrown 1 12875 0 0 /news/doyouwanttoworkfromhometosellbanneradvertisingapplynowstarttomorrow 1 10639 0 0 /news/dartford100518 2 17546 0 0 /news/iwantedtoplaythegameinsistshughes 1 17645 0 0 /news/551a925031fd6 1 3706 0 0 /news/itwasclearchrissmallinghadthepotentialtoplayatamuchhigherlevelsaysproudlloydhume 1 15024 0 0 /isthmian-league/19 3 42295 0 0 /news/table-toppingcugleyispleasedwiththetogethernesswithinhisranks 1 13770 0 0 /news/dartford1-2gillingham-sawyerpleasedwithgoalscoringtrialistbonner 1 35702 0 0 /news/thamesmead080616 2 30572 0 0 /news/tunbridgewells110222 1 13752 0 0 /news/soccershortsonsongdrydenamajordoubtfordoverathleticstrophytussle 1 18495 0 0 /news/thebigkickoffdaishcompletesdoublesigningoneveofnewseason 1 11658 0 0 /news/aldershot280904.html 1 0 0 0 /news/othernews/FixDec2004.html 1 0 0 0 /news/2ndjune05A.html 1 0 0 0 /news/soccershortskingstoniansignstrikernathanielpinneyfromtonbridgeangels 1 19608 0 0 /news/waspsanslow260515 2 29850 0 0 /news/551bc99dbe7a4/conference/margate/othernews/30thjune03.html 2 15653 0 0 /news/southwark040617 2 22412 0 0 /news/bromley0-0ebbsfleetunited-itsbeenagreatdaysaysbromleybossmarkgoldberg 2 38771 0 0 /news/threenewclubsforkentcountyleague 1 16078 0 0 /news/sitthythe080416 2 27398 0 0 /news/23rdjune05.html 1 0 0 0 /news/dartford2borehamwood2-burmanwhodareswillwinthatplay-offplaceexclusiveinterview 2 24890 0 0 /news/ryman/bromley/MPvbrom070204.html 1 0 0 0 /news/othernews/coneyhall040304.html 1 0 0 0 /news/perfectionistlegendarystrikerwillnotplayforashfordtownclaimscumberbatch-exclusive 1 15677 0 0 /news/crayvalley310119 1 13373 0 0 /news/551bc5e78981d 1 16002 0 0 /southern-counties-east-football-league/46 1 20164 0 0 /news/551a9250e2ff7 4 43893 0 0 /news/ivefallenoutoflovewiththegameadmitsbexleyboroughownerliamkelly 1 14152 0 0 /news/thamnorw240117 2 58998 0 0 /news/11thfeb05.html 1 0 0 0 /news/kentleague/cray/5thnov04.html 1 0 0 0 /news/wevegottobringtheplayersbackdowntoearthsaysdockersassistanttonyrussell 1 18770 0 0 /news/hernwhit271221 5 213022 0 0 /news/abbottifwedontmaketheplay-offswevegotourselvestoblame 1 12859 0 0 /news/551a9cf505ce2 3 40127 0 0 /news/drmartens/eastern/folkestone/hastvfolk151103.html 1 0 0 0 /news/hythetown040322 5 80155 0 0 /news/dartfordhonoursyko-atruegentleman 2 17856 0 0 /news/craybiller280715 3 61398 0 0 /news/drmartens/eastern/erith&belvedere/29thnov04.html 1 0 0 0 /news/551bc99dbe7a4/drmartens/eastern/erith&belvedere/kentleague/sladegreen/chessingtonvsladefr260703.html 2 15653 0 0 /news/whitstable140617 1 13596 0 0 /news/workstartsonnewstonesstadiuminjanuary 1 12822 0 0 /news/angelsbidfarewelltoskipperchopperaris 1 14101 0 0 /news/doverathletic3-1cambridgecity-itsnicetoseejonwallisbackonsongsaysmartinhayes 1 35954 0 0 /news/551bc5e73e0b7 1 14675 0 0 /news/oursoleaimistomatainourrymanstatussayswhitstablechairman-exclusive 1 17290 0 0 /news/sporstan270120 1 11391 0 0 /news/wehavealottolookforwardtosaysgillinghamskippervickyashton-jones 2 22360 1 1 /news/drmartens/eastern/folkestone/chatvfolk200304.html 1 0 0 0 /news/doverathleticstrengthentheirboardwiththreenewadditions 1 14078 0 0 /news/thefaknowourfeelingsaboutplayinginrymanonenorthsaysbinks 1 14541 0 0 /news/12thjuly05.html 1 0 0 0 /news/13thjune05.html 1 0 0 0 /news/recordsigningrooksettoleaveangels 1 19434 0 0 /news/wevegottokeepgrindingoutresultssaysmaidstoneunitedbossjaysaunders 1 13960 0 0 /news/fisherchairmancomplainsaboutfixtureallocation 1 15597 0 0 /news/greenwich230717 2 28099 0 0 /news/wedontwantittobejustagoodday-wewanttobeatdartfordsayscraysjoefrancis 1 16734 0 0 /news/wehavealottoliveuptoadmitsfirkins 1 16077 0 0 /news/stonesbeginsearchforanewsponsor 1 12125 0 0 /news/bromleygointothenewseasonlookingforprogress 1 20673 0 0 /news/551bc5de44677 1 11729 0 0 /news/bromley230718 2 14747 0 0 /news/ilford1-0thamesmeadtown-illoffertowalkifwedontmakeplay-offswarnskeithmcmahon 1 22246 0 0 /news/afcfleyt190519 2 23318 0 0 /news/justiceasfathrowouttrophycheatshiston 1 15502 0 0 /news/atitlechallengebringsthebestoutofourplayerssayshollandsblairbosspaulpiggott 2 18240 0 0 /news/rustwell300722 4 146434 0 0 /news/sevenoaks171217 1 14320 0 0 /news/margate061215 1 11790 0 0 /news/hernebay180920 3 29543 0 0 /ashford-2003-2006/2 3 20894 0 0 /news/551a9c923cd13 3 49229 0 0 /news/joefordcup210719 1 11914 0 0 /news/kentleague/sladegreen/15thsept04.html 1 0 0 0 /news/551a9cf525d84 3 46019 0 0 /news/oneofmychallengesistoliftmyplayersforleaguegamessayslisney 1 13641 0 0 /news/31stmar04.html 1 0 0 0 /news/wellingunited300121 2 14968 0 0 /news/ashfordtownp-pwhitstabletown-homelandsleftinthedarkaspowerfailurehaltskentderby 1 28724 0 0 /archive-2006-2014/238 1 19627 0 0 /news/larkfieldandnewhythe201023 3 29581 0 0 /news/coneyhall2-2universityofkent-managersshouldsnapupourplayerssaystomparkinson 1 26305 0 0 /news/551a9cf4ccbaf 2 17841 0 0 /news/kentcountyleagueannounceextendedsponsorshipdeal 2 19094 0 0 /news/drmartens/eastern/erith&belvedere/9thaug04.html 1 0 0 0 /news/kentleaguewelcomefavershamtown 1 12961 0 0 /news/gormanbelieveshissidecanwinpromotion-exclusiveinterviews 1 14816 0 0 /news/glebe201116 1 13781 0 0 /news/6thaug04.html 2 0 0 0 /news/kennington030120 1 12503 0 0 /news/theresmoretocomefromusinsiststonbridgeangelsbosstommywarrilow 1 16110 0 0 /news/GWR251005.html 1 0 0 0 /news/corinthian1-2lordswood-weveduginandwevecomeawaywiththreepointssaysjasonlillis 2 43805 0 0 /news/11thmay05.html 1 0 0 0 /news/chessington010621 2 14848 0 0 /news/sevenapm080116 1 12560 0 0 /news/facarlsbergtrophyfirstrounddraw-wingsbossjamiedayrelishingtriptolutontown 1 16492 0 0 /news/tonbslou070123 1 33540 0 0 /news/imnottakingburgesshillforgrantedsaysdartfordbosstonyburman 1 14769 0 0 /news/vcdathleticpmaidstoneunitedp 1 9913 0 0 /news/drmartens/eastern/folkestone/crawley270704.html 1 0 0 0 /news/551a9c92b7d8d 2 18617 0 0 /news/drmartens/premier/welling/8thoct04.html 1 0 0 0 /news/551bc5dc98f3b 3 33838 0 0 /news/hythetown240822 5 84445 0 0 /news/thenewboardiscommittedtochangethestructure-folkestoneinvicta 1 14924 0 0 /news/551bc5e167363 1 17267 0 0 /news/551a9bafee835 3 31164 0 0 /news/four-teamkendocuptopayfittingtributetothelatekenthurgood 1 12937 0 0 /news/ourgirlsdontwanttogivethecupupsayscharltonathleticbossstuartweston 1 14593 0 0 /news/sofaritsbeenagoodstarttotheseasonsayshernebaybosssamdenly 1 13609 0 0 /news/hendonwasthewrongmaninthefirstplacesayshayes 1 15343 0 0 /national-league/5 5 51433 0 0 /news/20thfeb05.html 1 0 0 0 /news/wehaventgottheresourcestodelveintotransfermarketsaysramsgatebossjimward 1 19047 0 0 /news/551a97990a98c 1 3853 0 0 /news/folkestoneinvicta100723 2 27895 0 0 /news/crowshep020522 5 171375 0 0 /news/drmartens/eastern/erith&belvedere/26thoct04.html 1 0 0 0 /news/551a956b7d438 3 24518 0 0 /news/craywanderers1-2dartford-letstrytogettothesecondroundthisyearsaystonyburman 1 27616 0 0 /news/dockersswitchboroughgame 2 13688 0 0 /news/551bc99dbe7a4/kentleague/sladegreen/drmartens/eastern/chatham/17thoct03.html 2 15653 0 0 /news/drmartens/eastern/erith&belvedere/beaconsfield170804.html 1 0 0 0 /news/flanaganscoopsfourfolkestoneawards 1 16914 0 0 /news/statattackrickyfreemanleadsgoalscoringchartwith15goals-crocksstartwith9defeats 1 15094 0 0 /news/croydon210804.html 1 0 0 0 /news/551bc99b78194 1 3344 0 0 /news/werelookinggoodsayssatisfiedvickersbossfoley 1 16633 0 0 /news/ouraimistogetintotheplay-offssayshessenthaler 1 15986 0 0 /news/ramslitt040223 2 69479 0 0 /news/wp-content/plugins/ioptimizations/abruzi.php 1 0 0 0 /news/holmesdale090815 1 15959 0 0 /news/551a956b9fb57 1 3363 0 0 /news/imlookingforwardtoanewchallengeatambitioustunbridgewellssaysstrikerpaulbooth 1 20659 0 0 /news/dartford0-1forestgreenrovers 1 16516 0 0 /news/kentleague/VCD/27thaug04.html 1 0 0 0 /news/kennington280320 1 12490 0 0 /news/551bc5e8e4266 1 16801 0 0 /news/bromwell010316 2 40815 0 0 /news/whitespitch-intogettheirhomegamesplayed 1 16717 0 0 /news/tonbridgeangelsbosstommywarrilowsettogivepromotedsideachance 1 13172 0 0 /news/imexpectingadourgameagainsteastbournetownsaysjimward 1 14501 0 0 /news/favershamlendahelpinghand 1 11605 0 0 /news/favershamtown0-0merstham-idhaveaskedformymoneybackafterthatadmitsjustinluchford 1 28588 0 0 /news/551a9250aa4fd 3 27031 0 0 /news/whitstablerelishhessenthalervisit-exclusive 1 12850 0 0 /news/beatingangelswasadelightadmitsgibbons-exclusiveinterview 1 14094 0 0 /news/ryman/bromley/horsvbrom091203.html 1 0 0 0 /news/551a9250f260d/10thjune05.html 2 6643 0 0 /news/551a9718dcf5d 3 35152 0 0 /news/folkestoneinvictaholdingprogrammefaironsunday 1 10289 0 0 /news/othernews/9thsept04.html 1 0 0 0 /news/17thaug05G.html 1 0 0 0 /news/lewishamborough3-0coneyhall-ouravenuesleadtotherymanleaguesaysambitiousqueely 1 31562 0 0 /news/imnotbittersayscordiceashissalterslanereigncomestoanend 1 17122 0 0 /news/551a967873562 3 42667 0 0 /news/matchreportswellshavekeepersentoffasderesneteight 1 22811 0 0 /news/551a979859ceb 2 16878 0 0 /news/wellgivecashkingsarunfortheirmoneyvowsabbott 1 15950 0 0 /news/scrcor041216 1 32033 0 0 /news/horshamunveiljustinluchfordastheirnewboss 1 15642 0 0 /news/suttonath110518 1 15359 0 0 /news/folkestoneinvicta2-4carshaltonathleticineedcashorwewillgodownwarnscugley-exclusive 1 19279 0 0 /news/weranaroundlikeheadlesschickens-seager 1 14499 0 0 /news/allthegirlsareupforit-charltonathleticandgillinghamlockhornsinderbyshowdown 1 17227 0 0 /news/551bc99ad7291 1 6483 0 0 /news/drmartens/eastern/sittingbourne/barton131104.html 1 0 0 0 /news/retiredskinnerthinksabouthisnextmove 1 13233 0 0 /news/cugleyletsmakeagoodimpression-exclusiveinterview 1 15846 0 0 /news/itsprobablyourbiggestdayinourhistorysaysphoenixsportsjoint-bosstonybeckingham 1 17350 0 0 /news/thekentleagueshouldhelpitsclubsmoresayslarkin 1 31038 0 0 /news/dulwbrai070217 2 63546 0 0 /news/afccroydonathletic310818 1 12849 0 0 /news/mundaytellshisstrugglingplayerstostandupandbecounted 1 20462 0 0 /news/burnvsitt200304.html 1 0 0 0 /news/lordswoodbeginsearchfornewmanageraftersimonhalseyquits 1 12620 0 0 /news/tunbcray090418 2 63298 0 0 /news/fixturecongestionwillreallytestoursquad-daish 1 13793 0 0 /news/wecantcarryonlikethisadmitsworriedcugley 1 16802 0 0 /news/551a931e665ce 1 11393 0 0 /news/dulwichvbromu18210304.html 1 0 0 0 /news/bremneroptstoleavefolkestone 1 12034 0 0 /news/wefeelthetimeisrighttostepdownsayssevenoakstownchairmantonysmart 1 13559 0 0 /news/stevenageborough3-2ebbsfleetunited-fleetcomebackfromthedeadtokeepdreamalive 1 22852 0 0 /news/championsobrienpaystributetodartstravellingfans 1 16432 0 0 /news/dulwich270417 2 29129 0 0 /news/dover030517 1 12317 0 0 /news/charlherne270116 3 78468 0 0 /news/ryman/bromley/romfordvbromfr120803.html 2 0 0 0 /news/soccershortsthechallengetoourplayersistogettothenewyearunbeatensayslyddbosssmith 1 41162 0 0 /news/jenkinskeepshislover-exclusive 1 11740 0 0 /news/lordswood130615 2 17349 0 0 /news/25thaug03.html 1 0 0 0 /news/kentleague/deal/Sampson3.html 1 0 0 0 /news/551a96dc7d958 2 16589 0 0 /news/cablebrothersreunitedatthamesmead 1 11350 0 0 /news/bromleians220519 2 16730 0 0 /news/rochester270518 1 15009 0 0 /news/551bc99dbe7a4/kentleague/ramsgate/drmartens/eastern/folkestone/8thjuly03.html 2 15653 0 0 /news/bromalde300121 5 87710 0 0 /news/wp-content/themes/wp-pridmag/up.php 1 0 0 1 /kentleague-2003-2006 15 158822 2 1 /news/greenwich240417 2 102095 0 0 /news/sittfav310821 2 67671 0 0 /archive-2006-2014/117 1 20540 0 0 /news/sevenmaid250717 1 35403 0 0 /news/tonbridge070904.html 1 0 0 0 /news/beckenham270817 1 13102 0 0 /news/beckerithtown071015 1 29947 0 0 /news/hendon2-0craywanderers-jenkinsnotconcernedwithpoortimekeeping 1 26092 0 0 /news/rookiemanagerprovesdoubterswrong-exclusive 1 12397 0 1 /news/FAStatement100920 3 29043 0 0 /news/fisher0-2erithbelvedere-thiswinisntgoingtodecidetheleaguesaysmickycollins 1 29439 0 0 /archive-2006-2014/222 1 19536 0 0 /news/daishasksfanstodonatetowardshisbudget 1 13758 0 0 /national-league/21 2 24818 0 0 /news/glebe080716 1 12921 0 0 /news/lordswoodplayerscanexpectgruellingpre-seasonwarnsguest 1 12909 0 0 /news/rochester181015 1 12708 0 0 /news/ex-stonecalledupforenglandsquad-beforemakingfulhamdebut 1 15085 0 0 /news-conference-2003-2006/contact 1 2510 0 0 /news/thamesmeadtown2-1erithbelvedere 1 14404 0 0 /news/vcd220305.html 1 0 0 0 /news/erithtownbosstonyrussellfacespre-seasonset-back 1 11640 0 0 /news/vcdathletic1tunbridgewells1exclusiveinterviews 1 15839 0 0 /news/ourplanistogetasmanylocalplayersplayingforsittingbournesaysjimward 1 16704 0 0 /news/IsthmianLeague120420 3 34309 0 0 /news/werealongwayfromthefinishedarticlesaysward 1 22498 0 0 /archive-2006-2014/291 2 21958 0 0 /news/wereconfidentgoingintopolicevisitsayslovell 1 13890 0 0 /news/nationalleague290119 1 12047 0 0 /news/foresthillpark180721 1 13189 0 0 /news/wp-content/plugins/seoo/wsoyanz1.php 1 0 0 0 /news/thamesmead300305.html 1 0 0 0 /news/confidenceishighgoingintoourlastsixgamessayssawyer 1 12681 0 0 /news/welling191017 2 18050 0 0 /news/gormandreamingofnationallimelight 1 13319 0 0 /news/551bc99c6afc3 2 19457 0 0 /news/28thjan05.html 1 0 0 0 /news/wellholdourowninnewleaguesaysmartin-exclusive 1 15276 0 0 /news/mileoak011105.html 1 0 0 0 /news/hopefullyitsthestartofsomethinggoodfortheclubsaysashfordunitedassistantjohnovard 1 13462 0 0 /news/sladeverit100404.html 1 0 0 0 /news/sevenoaks150718 2 27836 0 0 /news/margate010617 2 27649 0 0 /news/ashfordtown2-1godalmingtown-injuryscareforjones 1 15604 0 0 /news/cubopeck280820 1 32277 0 0 /news/strikerfranniecollinputspentopapertostayattonbridgeangels 1 11972 0 0 /news/maidstoneunited1-1eastbournetown-wegotwhatwedeservedadmitsjaysaunders 1 16576 0 0 /news/conferencesouthisgoingtobeevenstrongerthisyearwarnstonbridgeangelsbosstommywarrilow 1 17428 0 0 /news/dartsadvisedtokeeprivalfansapart-exclusiveinterviews 1 15191 0 0 /news/551bc99dbe7a4/kentcounty/drmartens/eastern/erith&belvedere/26thjune03.html 2 15653 0 0 /news/sevenoaksboundahwanpleasedwithmessagesofsupport 1 13889 0 0 /news/drmartens/premier/dover/15thjuly03.html 1 0 0 0 /news/ashfordtown1-0folkestoneinvicta-lovellstrikeclawsashfordoutofdropzone 1 26511 0 0 /news/weredelightedthatwecameawayfromeastbournewithapointsaysjimward 1 16073 0 0 /news/punjab010819 1 12260 0 0 /news/thefacupcomestokentforcraystelevisedtie 1 13929 0 0 /news/551a96db726b6 3 30094 0 0 /news/favasespecialwellpitchintoreachlastsixteensaysford-exclusiveinterview 1 16809 0 0 /news/lyddtown010819 1 12592 0 0 /news/craywandererssigninternationalstar 1 13228 0 0 /news/551a9c921de48 2 17171 0 0 /news/551a9c91e2796 2 20643 0 0 /news/17thnov03.html 1 0 0 0 /news/ksportunb020821 1 30056 0 0 /news/sittingbourne2-1fleettown-wedesperatelyneedthecrowdstopayourbills-abbott 1 23806 0 0 /news/vcd110904.html 1 0 0 0 /news/afccroy291216 1 13893 0 0 /news/sixrecentdepartureshavehitushardadmitslarkin 1 12000 0 0 /news/arbrdund220121 4 83150 0 0 /news/craywanderers0-4ebbsfleetunited-iwantmooretrophiessaysdaish 1 21447 0 0 /news/ebbsfleet010116 1 15767 0 0 /news/551a96dc6f521 3 41840 0 0 /news/lewisham220219 1 13279 0 0 /news/deal130217 1 12464 0 0 /news/dealtown080917 1 11996 0 0 /news/soccershorts100623 5 77608 1 0 /news/greenwich26062018 2 26109 0 0 /news/youthfootballinashfordisblossomingsaysshell 1 13562 0 0 /news/humeandwalkerjoinforcesatmaidstoneunited 1 13905 0 0 /news/ramsgate030422 5 66310 0 0 /news/resultsnovember2019 2 109961 0 0 /news/551bc99da4fb7 2 23697 0 0 /news/bigsummerexclusivemainstayswithangels 1 20500 0 0 /news/maidstone311016 1 15057 0 0 /news/crayvhoddlsc011003.html 1 0 0 0 /news/ksports170117 2 18905 0 0 /news/wellingunited0-0suttonunited-wecamebackhomeandfinishedthejoboffsaysjamieday 1 22749 0 0 /news/6thfeb05.html 1 0 0 0 /news/551bc5e3ca021 1 15299 0 0 /archive-2006-2014/18 2 25739 0 0 /news/551bc99dbe7a4/drmartens/premier/dover/kentcounty/17thdec03.html 2 15653 0 0 /news/ineedafewbobtobringincharacters-butler 1 20635 0 0 /news/theclubhavetoaskmeiftheywantmetotakethingsforwardsaysfavershamsrayturner 1 13316 0 0 /news/551a9c9324815 2 24556 0 0 /news/itsimportantformetocreategenuinecompetitionforplacessaysfavershamtownbossrayturner 1 13533 0 0 /news/bromleyvlewes190803.html 1 0 0 0 /news/551bc5e17a3bd 1 13674 0 0 /news/tonbridge180218 2 28065 0 0 /news/eritrust160222 4 109538 0 0 /news/kentleague/cray/folkestone061104.html 1 0 0 0 /news/fisher220219 1 12952 0 0 /news/warrilowhopestohavethefundstokeepstarstrikerrook 1 18546 0 0 /news/ramswillknockbrightonoutoffayouthcupinsistsbossperry-exclusiveinterview 1 12331 0 0 /news/charltonathletic030522 1 12032 0 0 /news/deanharrison040422 1 11990 0 0 /news/suttonunitedsignramsstrikerballforundisclosedfee 1 12554 0 0 /news/eritcray180817 2 20566 0 0 /drmartens/eastern/chatham/15thdec05.html 1 9955 0 0 /news/trioquitwhitstableduetofamilyreasons 1 11141 0 0 /news/beckenhamtown0-1westwickham-itdoesntgetanylowerthanthisadmitshuntley 1 24078 0 0 /news/soccershortsididconsiderhandinginmyresignationsaysfisherbossstevefirkins 1 28326 0 0 /news/551a9c92a6e44 2 16637 0 0 /news/shamefulstephensonhastobepunished 1 15324 0 0 /news/imexpectingthatweregoingtobeacomfortablemidtablesidesaysmartinford 2 21695 0 0 /news/551bc5daf1c60 3 37735 0 0 /news/cassitwasabigsurprisewhenfolkestonecameinforme 1 14933 0 0 /news/551bc99dbe7a4/nationwide/gillingham/kentleague/sladegreen/sladevbeck011103.html 2 15653 0 0 /news/IsthmianLeague110420 3 28798 0 0 /news/doverathletic230619 1 12021 0 0 /news/suttonathletic090123 1 13286 0 0 /news/thekentleaguetitleisupforgrabsadmitsmcmahon-exclusive 1 15980 0 0 /news/kidscanwatchfleetforfree 1 13527 0 0 /news/facupspecialwycombewillbeinforashockinsistsmain 1 12993 0 0 /news/dealtown290721 1 13588 0 0 /news/mcmahonhailsdimmockcaptureasreplacementfordartsboundcable-exclusive 1 18039 0 0 /news/pioneerstunbridgewellspondersyntheticpitchatculverdenstadium 1 17249 0 0 /news/wellingunited4-1tonbridgeangels-wevegottotryandwin10cupfinalssaysjamieday 1 32000 0 0 /news/bromchip301017 1 25795 0 0 /news/gormancondemnsmartinovercareerthreateningtackle-exclusive 1 16644 0 0 /news/hernebay110616 2 22266 0 0 /news/551a979815c1c 2 16622 0 0 /news/folkestoneinvicta2-3ramsgate-dannytwymanwastheherotodaysaysramsgatebossjimward 1 26717 0 0 /news/551a95b3b4329 2 17870 0 0 /news/13thsept04.html 1 0 0 0 /news/kentleague/whitstable/11thjuly03.html 1 0 0 0 /news/yourchancetoplayformaidstoneunited 1 10717 0 0 /news/crayvalley4-0woodstocksports-theleaguetableisabitembarrasingsaysleehockey 2 40243 0 0 /news/glebe260120 1 14215 0 0 /news/fisherstatement291219 3 22791 2 2 /news/itsnotimpossiblethinkingaboutbeatingthem-butwevegottoplaytoourmaximumsayshayes 1 16674 0 0 /news/rusticsdealtstrikerblows 2 13338 0 0 /news/bridon021015 2 16607 0 0 /news/AFCWimbledon121105.html 1 0 0 0 /news/kentleague/greenwich/greenvslade281003.html 1 0 0 0 /news/551bc99dbe7a4/kentleague/lordswood/kentleague/cray/crayvchesfav221103.html 2 15653 0 0 /news/brombarr240418 1 25183 0 0 /news/greenleyt220717 2 58639 0 0 /news/iwantwallistostaysayshessenthaler 1 15900 0 0 /news/fisher230917 1 12108 0 0 /news/corshamtown220122 2 20534 0 0 /news/croygreen270116 1 10866 0 0 /news/crowborough150117 1 15419 0 0 /news/bromley120218 1 14136 0 0 /news/icouldnotignoretheopportunitytomanageconferencepremiersidewellingunitedsaysjodybrown 1 20283 0 0 /news/strikercoopershownthedoor 1 10650 0 0 /news/nickreevesoptsformovetomaidstoneunited 1 11740 0 0 /news/theplayershavegottogooutthereanddoitsayshollandsblairbosspaulpiggott 2 18209 0 0 /news/greenwichborough1-2hythetown-itwasaveryprofessionalperformanceadmitsscottporter 1 24947 0 0 /news/horsham041005.html 1 0 0 0 /news/erithbelvedere0-5gillingham-icantthankgillsenoughforprestigiousgamesayscollins 1 23812 0 0 /news/meadsearchfornewplayers 1 12841 0 0 /news/versatileplayersareworththeirweightingoldsayserithtownbosssteveoboyle 1 15280 0 0 /news/wellingunited311219 1 13492 0 0 /news/sevencor150217 1 34243 0 0 /news/551a96773123f 2 17125 0 0 /news/dartford1-1stalbanscity2-4pens-thebestgoalkeepingdisplayforyears-burman 1 23021 0 0 /news/551bc99dbe7a4/drmartens/eastern/sittingbourne/drmartens/eastern/sittingbourne/burgessvsittfat011103.html 2 15653 0 0 /news/551a967838831 2 18360 0 0 /news/wp-includes/wlwmanifest.xml 6 0 0 5 /news/donttreatlordswoodlightlyhuntleytellshisside 1 18296 0 0 /news/fatrophyspecialhessenthalerseriousaboutextendedtrophyrun 1 13748 0 0 /news/elmesboostasstrikerreturnsfromlengthylay-off-exclusive 1 13797 0 0 /news/kentleague/tunbridgewells/tunbridgewells.html 1 0 0 0 /news/ramsgate1-1afcwimbledon-wecanlivewiththebigboyssaysward 1 24234 0 0 /news/lovellshakesupreserveside-exclusive 1 18134 0 0 /news/carsvbromfat011103.html 1 0 0 0 /news/chelmsfordcity3-2bromley 2 18727 0 0 /news/itsabigjobwithalottobedonesayscraywanderersnewbosskeithbird 1 21657 0 0 /news/asherith190915 1 32242 0 0 /news/dulwichhamlet3-2dartforddartssurrendernotverygoodsaysburman 1 16036 0 0 /news/idontthinkwinningtheleagueisthebe-allandendallformesaysvcdbosstonyrussell 1 16867 0 0 /news/551bc5e07c8b2 1 12133 0 0 /news/wp-content/plugins/dzs-zoomsounds/abruzi.php 1 0 0 0 /news/551bc5e43520a 1 4628 0 1 /news/boroughconfidentofobtaininglowestgroundgrading-exclusive 1 12805 0 0 /news/wellingunited130121 1 11583 0 0 /news/billericaytown2bromley2 2 17025 0 0 /news/fishercommunityday080415 1 13602 0 0 /news/glebe290316 1 12305 0 0 /news/551bc5e132192 1 11318 0 0 /isthmian-league/27 3 44893 0 0 /news/chesmarg291223 36 175784 0 13 /news/maidstoneunited2-1corinthian-casuals-thiswasgreameandrewsbestgamefortheclub-saunders 1 16059 0 0 /news/wewerentgoodenoughtodayadmitshessenthaler 1 15131 0 0 /news/ithinkitwouldbegoodforkentfootballifweplayeddartfordinplay-offfinalsaysjamieday 1 17597 0 0 /news/canterburycity241219 1 13010 0 0 /news/herncars081122 5 151810 0 0 /news/whitstabletown181022 1 12359 0 0 /news/leatherhead0doverathletic0 1 13324 0 0 /news/canterburycityhasthepotentialtobeoneofthebiggestclubsinkentsaysmurray 1 13083 0 0 /news/CONIFAFWorldCupBarawa300518 3 43684 0 0 /news/marktompkinstakesupgeneralmanagerroleaterithtown 1 14156 0 0 /news/stansfeld070220 1 13118 0 0 /news/erithbelvederevyaxley-gameon 3 27370 0 0 /news/551a979a87b13 1 4591 0 0 /news/551a931da78b4 1 12437 0 0 /news/dockersfightoffcompetitiontolandshinners 1 14213 0 0 /news/whitwhyt170115 2 58013 0 0 /news/edinburghleavesfisherduetonewbudgetrestrictions 1 12046 0 0 /news/otford230516 1 11975 0 0 /news/whitstable281217 1 13125 0 0 /news/sittdavis090415 2 28316 0 0 /news/ithinktheresafewtwistsandturnstogointhekentinvictatitleracesaysscottsaunders 1 13706 0 0 /news/551bc5e3af512 1 13760 0 0 /news/551bc5db0f5e0 3 24450 0 0 /news/chathamcompletepulmansigning-exclusive 1 11447 0 0 /news/othernews/SECFLTABS220204.html 1 0 0 0 /news/cugleyyoungstersarepartofourfuture 1 17098 0 0 /news/alfanew.php 1 0 0 0 /news/23rdjuly03.html 1 0 0 0 /news/wejustneedtotryandcompletethejobwevestartedsaysphoenixjoint-bosstonybeckingham 1 22930 0 0 /news/551a956b80aeb 1 5054 0 0 /news/oconnellexpectedtobeunveiledasmargatesnewboss 1 11581 0 0 /news/gbfccafc080416 1 14045 0 0 /news/ramsgatevice-chairmanaskswherewaseverybody 1 12462 0 0 /news/hythetown230620 2 23033 0 0 /news/heaslewoodwearerealisticwithwhatwecanachieve-exclusiveinterview 1 18067 0 0 /news/wp-content/plugins/classic-editor/wp-login.php 1 0 0 0 /news/welling190216 1 13359 0 0 /news/maidstone290818 1 12666 0 0 /news/551bc99c2ee8c 2 21692 0 0 /news/updatedmonday0945-travelchaosforkentcommuters 1 11307 0 0 /news/gillingham0-2doverathletic-doverheroesinhessclubheaven 1 27796 0 0 /news/thelongerwereinthevasethebettersaystunbridgewellsbossmartinlarkin 1 16027 0 0 /news/hythdork050316 2 52499 0 0 /news/wewanttowinasmanygamesaswecanandclimbupthetablesaysbeckenhamschrishiscock 2 29588 0 0 /news/rymanreportsmargatereclaimtopspot 1 24991 0 0 /news/conference/margate/9thjuly04.html 1 0 0 0 /news/trophygiantkillingmakesupforearlyfacupexitsayswhitstablechief 1 15682 0 0 /news/theclubneedstomoveforwardsayscraywanderersassistantjoefrancis 1 13761 0 0 /news/erithbel040817 1 14001 0 0 /news/favershamrelishingopeningtest 1 14174 0 0 /news/551a96db3909b 2 18481 0 0 /news/weneedtoaskourselvessomeseriousquestionsaboutwhywereverypooratpresentsayspalmer 1 14290 0 0 /news/newmargatebossoconnellbringssaundersbackforathirdspell 1 22570 0 0 /news/erithtownpartcompanywithjamescollinsafterelevengames 1 11395 0 0 /news/maidstoneunitedp-pchathamtown 1 11485 0 0 /news/551bc5e3f2796 1 14640 0 0 /news/bromley0-2eastbourneborough-wewereawfuladmitsbromleybossmarkgoldberg 1 23246 0 0 /news/phoenix310719 2 31750 0 0 /news/folkharl030318 2 61503 0 0 /news/croydonathletic100905.html 1 0 0 0 /news/freedrinkatrusthallsopeningleaguegame 1 12216 0 0 /news/resultsdecember2022 4 134699 0 0 /news/bromley171119 2 26059 0 0 /news/thamesmeadvramsgate160803.html 1 0 0 0 /news/551bc5dbba792 4 50050 0 0 /news/551bc5db98ca8 3 31464 0 0 /news/wellingunited3-2tonbridgeangels-ifyougivewhitnellachancehewillscoresaysday 1 37780 0 0 /news/itsgoodtohavemorrishbacksaysheaslewood-exclusiveinterview 1 17798 0 0 /news/resultsnov301116 2 114790 0 0 /hythe-2003-2006/www.heineken.co.uk/ 1 3205 0 0 /news/professionaloutlookpaysdividendsforinvicta 1 13261 0 0 /news/hendon3-0maidstoneunited-welackeddesireandweleteveryonedownfumesnott 1 32253 0 0 /news/kentleague/hernebay/24thsept03.html 1 0 0 0 /news/gavinhoare310119 1 11874 0 0 /news/wellbeupforfolkestoneinsistsashfordbosslovell 1 16479 0 0 /news/kentleague/lordswood/deal161004.html 1 0 0 0 /news/wearelookingtoretaintheplatesayshernebaymanageranthonydeer 1 15879 0 0 /news/craywands201218 3 32098 0 0 /news/dulwwest061118 1 28530 0 0 /news/othernews/AEI251004.html 1 0 0 0 /news/whitstabletownreceive20applicationsforvacantmanagersjob 1 12869 0 0 /news/burmanpraisessquadprofessionalism 1 18167 0 0 /news/facupspecialmccarthytheyoungsterswantsuccess-exclusiveinterview 1 17042 0 0 /news/craybright160116 3 70808 0 0 /news/oboyleweareindesperateneedofawin 1 13476 0 0 /news/sportingclubthamesmead250822 2 18674 1 1 /news/551bc5e687649 1 13436 0 0 /news/bridholm050915 2 44448 0 0 /news/charlton171217 2 18481 0 0 /news/cugleywantstodistancehimselffromhendon 1 14758 0 0 /news/maidstone260620 1 11313 0 0 /news/tonbridgeangels4-0carshaltonathletic-ouraimnowistoplaysuttonnextyear-obrien 1 34932 0 0 /news/drmartens/eastern/sittingbourne/fisher160804.html 1 0 0 0 /news/dulwichhamlet2-2folkestoneinvicta-wevegottodefendbettersayscugley-exclusive 1 19037 0 0 /news/chathamtown0-2harrowborough-wedidntcausethemenoughthreatgoingforward-kevinwatson 1 14523 0 0 /news/imdelightedtobebackasmanageratsittingbournesaysnickdavis 1 15538 0 0 /news/folkestone300317 2 29937 0 0 /news/deresbossmickycollinswantsafacuprun 1 15197 0 0 /news/pre-seasonfriendlies2010 1 75601 0 0 /news/soccershortssittingbournebossgaryabbotthappytothrowin16-year-oldagainstleatherhead 1 66593 0 0 /news/chathamtown1-0ashfordtowngoodgerslatewinnerleavesashfordshell-shocked 1 16523 0 0 /news/kentseniortrophyfinalidswaptrophygloryforrymanfootballsaysmcmahon-exclusive 1 14538 0 0 /news/19thfeb04.html 1 0 0 0 /news/greenwich030118 2 27214 0 0 /news/harttorq200621 4 105170 0 0 /news/craywands060418 3 32951 0 0 /news/hythe171016 2 26010 0 0 /news/invictahailsuccessfulfamilyfunday 1 14117 0 0 /news/crowborough130619 1 12247 0 0 /news/dartford290618 2 14967 0 0 /news/maidstone230715 2 18736 0 0 /news/wevebroughtasquadintohaveagosaysmickycollins 1 12387 0 0 /news/barnesoptstomovetomaidstoneunited 2 21678 0 0 /news/bromleys13-mansquadseekrevengeonharrow 2 17140 0 0 /news/hessenthalerruescupshowdownwithkentrivals 1 18193 0 0 /news/tonbridgeangels0-2doverathletic-wewanttodoaswellaswecansaysdoverbosschriskinnear 1 27816 0 0 /news/22nddec03.html 1 0 0 0 /news/cogggleb120921 5 131090 0 0 /news/hythetown250416 2 37028 0 0 /news/tonbridgeangelsacceptofferforlegge 1 14389 0 0 /southern-counties-east-football-league/18 1 21127 0 0 /news/hernebay0-0hythetown-hythehaventcompletelygotbothhandsonthetitleyetsayshalsey 1 32274 0 0 /news/walthamforest190305.html 1 0 0 0 /news/kingstonian5-2craywanderers-theyweremuchmuchstrongerthanusonthedaysaysianjenkins 1 23230 0 0 /news/everyonenowattheclubareallpullingintherightdirectionsayschipsteadbossleeroots 1 15819 0 0 /news/kentishdebatekentcupcompetitions 1 11126 0 0 /news/abbottrevealssecretbehindimpressiveawayform 1 15035 0 0 /news/maidstone190205.html 1 0 0 0 /news/551bc5e3ab125 1 13826 0 0 /news/mixedfortunesforourconferencepaironopeningdaydaishpennockinterviews 1 18433 0 0 /news/kentleague/deal/deal.html 1 0 0 0 /news/walkerremainspatientwithstrikersearch 1 13439 0 0 /news/craywanderers1-0crystalpalace-werelookingtobouncebackatfirstattemptsayskeithbird 2 35037 0 0 /news/oboyleaddsyouthandexperiencetohissquad 1 13538 0 0 /news/corinthian011017 1 13785 0 0 /news/551a96dc5a426 3 44563 0 0 /news/kentrivalsbidtobankthemuch-neededloot 1 19143 0 0 /news/100wellssettoapplyforpromotion 1 12088 0 0 /news/facupdrawkentderbywerenotthereyetsaysobrien 1 26840 0 0 /news/everyoneisupforourtriptosalisburysaysdoverathleticbosschriskinnear 1 12182 0 0 /news/craywanderers2-2ebbsfleetunited-jenkinstodiscussbetterfinancialpackageforhamici 1 43330 0 0 /news/551a9bafd452b 3 26265 0 0 /news/wehaveplayerstohandlethepressuresaysburman-exclusive 1 13804 0 0 /news/restructuringwhosegoingwhere 1 16796 0 0 /news/charltcardiff100515 2 33432 0 0 /news/bromhava270818 2 40515 0 0 /news/wewillbouncestraightbackvowsconfidentpettit 1 17297 0 0 /news/itspleasingtostartgettingonthescoresheetagainsaysjamespinnock 1 15503 0 0 /news/drmartens/eastern/ashford/18thsept03a.html 1 0 0 0 /news/greenwich071204.html 1 0 0 0 /news/kentleaguecupfinaltompkinssetforfinalswansong-exclusive 1 13888 0 0 /news/rochestercity210220 1 11302 0 0 /news/leytonorient3-0bromley-imdisappointedthatwedidntscoresaysbromleybossmarkgoldberg 2 51336 0 0 /news/dartford3-1charltonathletic-letshaveanenjoyabledaylikewehadlastyearsaystonyburman 1 21953 0 0 /news/kentleague/cray/crayvsudb210204.html 1 0 0 0 /news/favershamaimingfortopfivefinish 1 21094 0 0 /news/sittingbourne210417 2 24786 0 0 /news/daishpraiseshisminnows-matchreportsfromourtopgames 1 34012 0 0 /news/12thsept05G.html 1 0 0 0 /news/kentleague/VCD/19thnov04.html 1 0 0 0 /news/carruthersreturnstoashfordtown 1 12291 0 0 /news/.well-known/acme-challenge/xmrlpc.php 1 0 0 0 /news/phoenixsports200819 2 27631 0 0 /news/pennockiwanttomovewingsforwardintotheconferenceexclusiveinterview 1 13557 0 0 /news/wellwhite151016 2 35713 0 0 /news/ebbsfleetunited1-0burtonalbionaet-longcallstheshotsasfleetmarchclosertowembleyarch 1 20067 0 0 /news/thisisundoubtedlytheworstplayershortageihaveenduredin4yearsofmanagementadmitsfoley 1 16452 0 0 /news/erithtown220620 1 10956 0 0 /isthmian-league/60 2 38139 0 0 /archive-2006-2014/257 1 19295 0 0 /news/551a925094dcb 4 40990 0 0 /news/bromley021017 1 13524 0 0 /news/chathamtown2-0craywanderers-werelowonconfidenceatthemomentadmitsjenkins 1 21796 0 0 /news/551bc5e891adb 1 11886 0 0 /news/franniecollinisnotgoingtodartfordconfirmstonbridgeangelsbosstommywarrilow 1 14024 0 0 /news/chatham090217 3 34380 0 0 /news/crayashf260217 1 37672 0 0 /news/8thmar05.html 1 0 0 0 /news/thestructureoftheclubisgettingstretchedbecauseweneedhelpnowwarnstommywarrilow 1 18922 0 0 /news/551a931dd7635 1 11093 0 0 /news/hythe241116 2 25140 0 0 /news/thenexttwogamesarevitallyimportantsayslovell 1 15063 0 0 /news/551bc5e1d8b5e 2 21520 0 1 /news/ramslookingforplayersfornewly-formedladiesteam 1 12286 0 0 /news/wp-admin/css/colors/blue/atomlib.php 1 0 0 0 /news/tunbridgewells220522 1 14323 0 0 /news/wp-consar.php 1 0 0 0 /news/erithbel090217 1 14624 0 0 /news/bearsted280719 2 17515 1 0 /news/conference/margate/29thjan04.html 1 0 0 0 /news/lordswood1-2tunbridgewells-thosethatworkhardestgettherewardsinlifesaysmartinlarkin 1 28170 0 0 /news/chipstead2-0hernebayaet-hernebaymissthechancetoprogress 1 19632 0 0 /news/13thaug05.html 1 0 0 0 /news/iwanttogetasfaraswecaninthefacupsayswellingunitedbossjamieday 2 18412 0 0 /news/cugleypraiseshistroopsfortheirsupport 1 17999 0 0 /news/brackvbrom300903.html 1 0 0 0 /news/letusentertainyou-exclusiveinterview 1 16794 0 0 /news/wecangothewholehoggadmitsdartsbossburman 1 14798 0 0 /news/ifwecanshowthesamecommitmentwecangetaresultsaysthamesmeadtownbosskeithmcmahon 1 16498 0 0 /news/kirkwattswillbesorelymissedsaystommywarrilow 1 17263 0 0 /drmartens/premier/welling/31stmar05.html 2 12477 0 0 /news/551bc99dbe7a4/kentleague/hernebay/kentleague/sladegreen/sladevwhitstable111003.html 2 15653 0 0 /news/kentleague/tunbridgewells/18thnov04.html 1 0 0 0 /news/seagerrelishesreturnofinjuredtrio 1 13545 0 0 /news/ifweplayaswecanweoughttogettheresultthatwewantsaysneilcugley 1 13845 0 0 /news/crockenhillbossstevedeveruxstrengthenshismanagementteam 2 16372 0 0 /news/ipleadforeveryonetodoasundanceinwhitstablesayschairmangaryjohnson 1 22976 0 0 /news/hytheheroesportershockshappeninthefacup-whycantitbeus 1 20984 0 0 /news/tonbridgeangels0-2doverathletic-browningssickeninginjurymarsrecordbreakingdoversday 1 38600 0 0 /news/thecloseryougettothatfirstroundthebetteritbecomessaysmargatejoint-bosssimonosborn 1 14816 0 0 /news/metcalfproudoflordswoodstrainingfacilities 1 20813 0 0 /news/551a956c462c6 3 25259 0 0 /news/overtonbeginscomebacktrail 1 12239 0 0 /kent-county-league/9 3 41594 0 0 /news/heybridgeswifts2-0folkestoneinvicta 1 15379 0 0 /news/ambitiousopkmoveintodansonsformerhome 1 12766 0 0 /archive-2006-2014/61 1 20897 0 0 /news/thereiscompetitionforplacesupfrontsayswellingunitedbossjamieday 1 11323 0 0 /news/tilbury030105.html 1 0 0 0 /news/coneyhallchairmanconfidentaboutleagueswitch-exclusive 1 14514 0 0 /news/woking2-1doverathletic-wevegoteverychanceatourplaceinsistshessenthaler 1 33981 0 0 /news/daishaddsloan-signingtohissquad 2 13044 0 0 /news/bracfolk150119 3 69672 0 0 /news/dover280517 1 12309 0 0 /news/farnobg310716 1 11855 0 0 /news/chelmsfordcity130819 2 15739 0 0 /news/deresmaketheirmarkwithcassiusseasonlongloandeal 1 17742 0 0 /news/magpiesflyintohelpbromleyscash-flowproblems 1 18699 0 0 /news/drmartens/eastern/dartford/26thoct04.html 1 0 0 0 /news/holmbridfavaserep090915 1 14564 0 0 /news/drmartens/eastern/tonbridge/26thjune03.html 1 0 0 0 /news/welling090218 1 11786 0 0 /news/551bc5e40b233 1 15403 0 0 /news/sevenoakstown2-2sporingbengal-weplayedlikeapubsideadmitssevenoaksbosskeithlevett 1 26646 0 0 /news/robbinsexplainshythetowndeparture-exclusiveinterview 1 12686 0 0 /news/itsabouttimeweremovedthosestainessaysward-exclusive 1 15484 0 0 /news/thamesmead181015 2 28109 0 0 /news/TheFAStatement141019 3 39443 0 0 /news/erithbelvedere0-3erithtown-performanceslikethatgetmanagerssackedwarnsjulianleigh 1 38058 0 0 /news/backbypopulardemandgreeniesfridaypreview-footballreturnstokent 2 19973 0 0 /news/metrogas220522 6 63238 0 0 /news/crayvbeck220116 1 10839 0 0 /news/myambitionistoprogressmycoachingcareerashighasitwilltakemesayswillgraham 1 15905 0 0 /news/551a971910414 3 30721 0 0 /news/vcd191115 2 28070 0 0 /news/551bc99b34fe9 1 3856 0 0 /news/4thmar05.html 1 0 0 0 /news/kentleague/lordswood/lordsvbeckfavase200903.html 1 0 0 0 /news/fordaddslawsontohisfire-power 1 15237 0 0 /news/thamesmead170917 2 29544 0 0 /news/takingthingsforwardatsevenoakswouldhavebeendifficultadmitschathamboundkeithlevett 1 13008 0 0 /news/551a956b6efbd 1 3798 0 0 /news/afccroydonathletic221218 1 13637 0 0 /news/craywanderers090522 3 37543 0 0 /news/maidstone100519 1 11736 0 0 /news/wevenotthrowninthetowelsayscosgrove 1 15944 0 0 /news/stevenstakeoverdelaysareharmingpreparationsfornewseason 1 13072 0 0 /news/wevegottobuildonourwinoverkssaysinjuryhitstonesbosspeternott 1 20162 0 0 /news/phoedere130916 2 52860 0 0 /news/kennington111019 1 12464 0 0 /news/elmstead190615 1 23148 0 0 /news/sevenhors200816 1 31628 0 0 /news/erithandbelvedere290323 1 15881 0 0 /isthmian-league/6 5 83848 0 0 /news/551bc5e1dcd35 2 16987 0 0 /news/nextseasonwillbeafreshstartsayscraywanderersbosskeithbird 1 14827 0 0 /news/conference/gravesend/1stnov03.html 1 0 0 0 /news/551bc99dbe7a4/kentleague/maidstone/drmartens/eastern/sittingbourne/sittvtonb221103.html 2 15653 0 0 /news/ryman/bromley/bromvbans211003.html 1 0 0 0 /news/greenfolk010917 2 25358 0 0 /news/phoenixsports4-1fisher-wevecomeawayfromapotentialbananaskinunscathedsaysbeckingham 1 31308 0 0 /news/afchornchurch2-1tonbridgeangels-angelsjobwillgenerateplentyofinterest-exclusive 1 19031 0 0 /news/burmandescribespitchatbourneparkacowpatfollowingstonesshocker 1 18045 0 0 /news/faversham070220 2 27123 0 0 /news/jenkinsadmitswereuneracheivingandweshouldbehigherinthetable 1 15783 0 0 /news/myjobistokeepwhitstablesrymanleaguestatussaysmunday 1 25572 0 0 /news/551a9c929b00a 2 20247 0 0 /news/551a9797d6919 1 3088 0 0 /news/vcdathletic0maidstoneunited2 4 30591 2 2 /news/crayvalley090417 1 16020 0 0 /news/stonesmanagementteambackstadiumpriorities 1 14570 0 0 /news/wevegotanopportunitytoholdontosecondplacesaysfavershamtownbossrayturner 1 12778 0 0 /news/FAStatement260320 6 35611 3 3 /news/dockersbossoboylebringsincable 1 15705 0 0 /news/facupsecondqualifyingroundreviseddraw 1 11833 0 0 /news/folkestoneinvicta0-1maidstoneunited-theagonyandtheecstasy 1 20724 0 0 /news/551bc99dbe7a4/drmartens/eastern/sittingbourne/drmartens/eastern/sittingbourne/sittingbournevwhyteleafe130903.html 2 15653 0 0 /news/oldbholm120717 1 33405 0 0 /news/ithinkitsgoingtobealotharderthisyearwarnswellingunitedbossjamieday 1 15665 0 0 /news/beckenhamtown4-2corinthian-theresnodisgraceinlosingtobeckenhamadmitsjamescollins 3 71564 0 0 /news/iwasreadytowalkawayfromthegameadmitsadamburchell 1 15353 0 0 /news/fatrophyspecialwemustkeepfocusedineverygamesayswalker 1 13735 0 0 /news/folkestone260518 2 26185 0 0 /news/551a931ebd799 2 28678 0 0 /news/wevesilencedourcriticswithcuprompsayscosgrove 1 16709 0 0 /news/thamesmeadtown1-2ashfordtown-injuriesmountupforashford 1 19053 0 0 /news/BromGoldberg030415 2 22383 0 0 /southern-counties-east-football-league/9 2 41135 0 0 /news/wellstruggletokeepholdoffalfiemaysayscorinthianbossmattlonghurst 1 14690 0 0 /news/weneedhelptoprogresssaystreblewinningblairboss 1 15230 0 0 /news/imexpectingatoughgameagainstrochestersaysvickersbossrickybennett 1 13325 0 0 /news/itwouldbedifficultformygirlstoleavehernebaysaysproudbossanthonydeer 1 16193 0 0 /news/iamdelightedtoplayfortheseniorsidesaysloyalfootballertomholmes 1 12442 0 0 /news/551a97b09f8b0 2 24962 0 0 /news/fleetmarchingtothewembleyarchletsmakeitadaytoremember-daish 1 16545 0 0 /news/fivestarfleet 1 13605 0 0 /news/551bc99dbe7a4/conference/gravesend/drmartens/eastern/dartford/1Jan2004.html 2 15653 0 0 /news/doverathletic050121 1 10923 0 0 /news/551a967835d07 2 17370 0 0 /news/551bc5dd4376c 2 19670 0 0 /news/tonbridgeangels180722 1 12539 0 0 /news/551a97b09a698 1 11370 0 0 /news/soccershortsjohnovardquitsashfordunited 1 24539 0 0 /news/shekicksmagazineunveiledaskentwomenscupandplatetitlesponsors 1 19068 0 0 /news/551bc5e18f0ad 2 29090 0 0 /news/hythetownmakelloydblackmantheirfirstsummersigning 1 15264 0 0 /news/tonbridgeangels2-0bognorregistown-patched-upangelsturnugly 1 26412 0 0 /news/craydeal210416 2 38771 1 1 /news/becktunw100315 1 25118 0 0 /national-league/20 2 24596 0 0 /news/weveprovedalotofpeoplewrongsayssittingbournejoint-bossjimward 1 18334 0 0 /news/tunbridgewells030120 1 13444 0 0 /news/othernews/youthleaguefixtures230104.html 1 0 0 0 /news/margate4-1clevedontown-ithoughtwehandledthepressurewellsaysmargatebosssimonosborn 1 29279 0 0 /news/551a967769a97 3 43017 0 0 /news/watford1-2millwalllionesses-lionessesroarbacktowinfirstleaguecupgame 1 18512 0 0 /news/551a9797edf0d 2 17088 0 0 /news/margate200718 2 22632 0 0 /news/rymanleague140117 2 26266 0 0 /news/favershamtownplewishamboroughp 1 11252 0 0 /news/relegatedfolkestoneinvictakeepfaithwithcugley 1 19024 0 0 /news/greenvcd111016 2 64248 0 0 /news/FAStatement110920 3 28662 0 0 /news/thefaworldwidebettingbanwillupholdtheintegrityoffootballinengland 1 21856 0 0 /news/craysudb151215 3 67310 0 0 /news/weareallveryexcitedatthewaytheclubisgrowingsayscorinthiancoachmattlonghurst 1 12938 0 0 /news/551bc5dfec943 1 17267 0 0 /news/551bc5e2ae300 1 21512 0 0 /news/551bc5e14328f 1 12691 0 0 /news/craymers120918 1 30587 0 0 /news/kentleague/sladegreen/17thjuly03.html 1 0 0 0 /news/humeexpectssuccessontheroad 1 13092 0 0 /news/ashfsitt250918 3 73373 0 0 /news/littlereturnstohisspiritualhomesladegreen 1 13305 0 0 /news/ramsgate100816 2 24571 0 0 /news/ebbsfleet230720 1 10849 0 0 /news/ryman/bromley/20thdec03.html 1 0 0 0 /news/crayvalley021221 3 31444 0 0 /news/wardpaystributetochairmanashepreparsformoreofthesamenextseason 1 13246 0 0 /news/tunvslade130903.html 1 0 0 0 /news/wearekeepingoureyesfullyonthepursestringssayswarrilow 1 21471 0 0 /news/551bc5e655a12 1 12539 0 0 /drmartens/premier/dover/folkestone280305.html 9 45354 8 8 /news/strugglinghythetownsufferfinancialheartache 1 13843 0 0 /news/goalscoringmachineabbottgivenall-cleartomakecomeback-exclusive 1 19240 0 0 /news/welling040118 1 14956 0 0 /news/wereenjoyingourtimewhilstwereontheupsayshollandsblairbosspaulpiggott 1 16142 0 0 /news/beckenham020120 1 12687 0 0 /news/kentleague/hernebay/hernvslad061203.html 1 0 0 0 /news/gravesendnorthfleetladies3longlaneladies2 1 12584 0 0 /news/allmystrikersaregoingtoplayatsomestageoftheseasonsayserithtownbosstonyrussell 1 13757 0 0 /news/bearsdeal231018 1 34499 0 0 /news/thechairmanhastoldustokeepsittingbourneintherymanleaguesaysnickdavis 1 17651 0 0 /news/551bc99dbe7a4/kentleague/cray/kentleague/thamesmead/18thnov03.html 2 15653 0 0 /news/551bc5e333849 2 16193 1 1 /news/30thmay05.html 1 0 0 0 /news/beckerit031018 1 26001 0 0 /news/glebe020919 1 11340 0 0 /news/5thsept05G.html 1 0 0 0 /news/lordswood220219 1 12403 0 0 /news/cordiceourdestinyisverymuchinourhands 2 19111 0 0 /southern-counties-east-football-league/64 1 18000 0 0 /news/soccershortsfolkestonesignbulgarianfind 1 11334 0 0 /news/glebabbe100419 1 27260 0 0 /news/tohavegillinghaminthesuperleaguewouldboostwomensfootballinkentsayschairman 1 24426 0 0 /news/kentcounty/2ndjuly03.html 1 0 0 0 /news/dolbywereinaprimeposition 2 16453 0 0 /news/551bc99dbe7a4/drmartens/eastern/tonbridge/drmartens/premier/welling/17thsept03.html 2 15653 0 0 /national-league/2 4 45444 0 0 /news/itwasreallyimportantthatwestrengthenedthesideafteradisappointingdecembersaysbrown 2 29093 0 0 /news/drmartens/premier/dover/1stnov04.html 1 0 0 0 /news/crayhythe210916 3 68146 0 0 /news/dovermissoutonconferencetarget 1 12202 0 0 /news/angelsreleasewattstocuttheircloth 1 15346 0 0 /news/ramsgate091218 2 25078 0 0 /news/551a97b0ebb8d 2 33356 0 0 /index 1 13871 0 0 /news/oldbroms040317 1 16602 0 0 /news/wevegottokeepourfeetonthegroundsayswellingbossjamieday 1 23508 0 0 /news/29thnov04.html 1 0 0 0 /news/molesey2-0craywanderersaban75minswebringthebestoutofpowersaysfrancis-exclusive 1 18778 0 0 /news/ramstoot150417 2 60926 0 0 /news/folkestoneinvicta1-3stainestown-cugleysufferssickeningdefeat 1 15495 0 0 /news/551a979979b92 1 4852 0 0 /news/erithbelvedere1-2aveley-ourmainaimistostayupsayschriscosgrove 1 27400 0 0 /news/551bc99dbe7a4/drmartens/eastern/tonbridge/drmartens/eastern/folkestone/folkvfishlgecup111103.html 2 15653 0 0 /news/www.heineken.co.uk/ 1 0 0 0 /news/lordswoodvvcd160803.html 1 0 0 0 /news/shortwoodunited1-2hernebay-wejustwanteditthatlittlebitmoresaysherostevehanson 1 29333 0 0 /news/isthmianleague170820 2 28219 0 0 /news/rusthall310818 1 11957 0 0 /news/canterbury050816 1 13195 0 0 /news/brendoncasswillfireustowardskentleaguetitlesaysporter 1 21177 0 0 /news/londonseniortrophyfinal2021foresthillpark 1 16213 0 0 /news/fisherproblemsmountbothonandoffthepitch 1 13106 0 0 /national-league/www.heineken.co.uk/ 1 4852 0 0 /news/wevegotachancetoputourselvesintherecordbookssaysdoverathleticbossmartinhayes 1 16643 0 0 /news/beckenham100818 1 12571 0 0 /news/charltonathletic0-2gillingham-weshouldbewinningthiseveryyearsaysgillinghambossvarley 1 24041 0 0 /news/thefatladyhasnotstartedsingingsaysmunday 1 18613 0 0 /news/cugleyalotofprideisatstakeagainstmargate 1 16699 0 0 /news/551bc99d6d03f 2 25955 0 0 /news/quartetwalkoutoftunbridgewellsfollowingfarniesacking-exclusive 1 14177 0 0 /news/whitstabletown1-2vcdathletic 1 17279 0 0 /news/wevegottodowhateverittakestowinthetiesaysdoverathleticbosschriskinnear 1 17298 0 0 /news/25thmar04.html 1 0 0 0 /news/maidstoneunited0-1dartford-welackedpassionandfightfumesangrystonesboss 1 18846 0 0 /news/elthrust040217 1 15863 0 0 /news/photographicevidenceofsuttonmanagerdoswelllashingoutonangelsskipperstorey 1 13950 0 0 /news/551bc5e752861 2 21565 0 0 /news/apm080416 2 15760 0 0 /news/551a99e5518bf 1 15020 0 0 /news/billericayforcerymanleagueintohastyswitch 1 19646 0 0 /news/stainestown1bromley2 1 16370 0 0 /news/bromley1-3wellingunited-wingswinderbywithsecondhalfcomeback 1 15871 0 0 /news/19thmay04.html 1 0 0 0 /news/wehaveunderachievedconsideringthesquadwehaveadmitschathamtownbosskevinwatson 1 13629 0 0 /news/dealtown101019 1 12187 0 0 /news/551bc5dea193b 1 11698 0 0 /news/imonlygoingtosettleforfirstplacenextseasonvowslovell-exclusive 1 16059 0 0 /news/itsobviousweneedtoimproveasateamsayshythetownbosstimdixon 1 14320 0 0 /news/apmcon170815 2 15204 0 0 /news/kentleaguecupfinalgeorgecastsasidehismedals-exclusive 1 13655 0 0 /news/stevenage0-0maidstoneunited-theplayersandsupporterswereoutstandingsaysproudsaunders 1 25628 0 0 /news/chatwalt220816 3 65164 0 0 /news/wiskerlivesuptohisbilling 1 12926 0 0 /news/ebbsfleetunited1-3maidstoneunited-itsthebeginningofanimportantweekforus-hume 1 21141 0 0 /news/greenwich200217 2 26202 0 0 /news/wellelms091217 1 34224 0 0 /news/wedeservetobewherewearesaystable-toppingseager 1 16382 0 0 /news/illhavenoproblempickingtheplayersupoffthefloorsaysebbsfleetunitedbossstevebrown 1 14626 0 0 /news/hythe231004.html 1 0 0 0 /news/beckenham300721 4 70638 0 0 /news/551bc99dbe7a4/nationwide/gillingham/ryman/bromley/16thnov03.html 2 15653 0 0 /news/imtakingmargatecuptieseriouslysaysabbott 1 15554 0 0 /news/wereonabitofalearningcurvesaysramsgatebossjimward 1 16266 0 0 /news/551bc99bb8b74 2 23713 0 0 /news/craywandererspartcompanywithkeithbird 2 17804 0 0 /news/craywanderersacademyhasexceededallexpectationssaysanslow 1 21367 0 0 /news/drmartens/eastern/dartford/erith231004.html 1 0 0 0 /news/angelsmakestarkeysstaypermanent 1 10988 0 0 /news/hernashf180922 5 179705 0 0 /news/wellingunited050623 3 28702 0 0 /news/551a956be8587 1 4336 0 0 /news/theweekahead 1 17593 0 0 /news/drydenreturnstofolkestoneontwo-yearcontract 1 11145 0 0 /news/dolbyrelishingplay-offfinalshowdown 2 21082 0 0 /news/tonbridgereserveteambossleighoptimisticwinningkentintermediatecup-exclusiveinterview 1 15958 0 0 /news/wehavenothingtofearinsistsfrancis 1 19130 0 0 /news/551a92502acab 4 35592 0 0 /news/551a9718bea53 3 26847 0 0 /news/ifwecangetintotheplay-offsidbehappysayswellingunitedbossjamieday 1 14367 0 0 /news/folkestoneinvicta0-1horsham 1 15282 0 0 /news/551bc5dea7213 1 11642 0 0 /news/kingstonian071105.html 1 0 0 0 /news/dartford2-1newportcounty-dartsbosstonyburmanhowcanitoptoday 1 19770 0 0 /news/itllbenicetofinallygetgoingsaysashfordunitedbosspaulchambers 1 13695 0 0 /news/gwr020405.html 1 0 0 0 /news/fisher6-1chichestercity-ifeltalittlebitmorecomfortaletonightsaysfisherbossfirkins 1 22822 0 0 /news/tonbbath051122 4 128614 0 0 /news/dartscontentwithaperiodofconsolidation 1 13910 0 0 /news/22ndaug05G.html 1 0 0 0 /news/canterburycity051121 1 13609 0 0 /news/551bc99ace1ba 1 5568 0 0 /news/croyath210417 1 14120 0 0 /news/horsfolk310819 2 66716 0 0 /news/lovellkeenonglydereturn 1 11829 0 0 /news/551bc99dbe7a4/kentleague/sevenoaks/ryman/bromley/whytvbrom060104A.html 2 15653 0 0 /news/chatspartcompanywithobrienandwatts 1 12404 0 0 /news/sevenacresidcup2-3hollandsblair-thirdisnotgoodenoughforussayspaulpiggott 1 27368 0 0 /news/hfsphaml290820 1 28493 0 0 /drmartens/eastern/ashford/bromley181204.html 1 9955 0 0 /news/sheppeyunitedfc.co.uk 1 0 0 0 /news/jenkinswantscupcashtostrengthenhisteam 1 12024 0 0 /news/doverathleticbossnickyforsterunveilsthesigningofwingerjamiesmith 1 11677 0 0 /news/551bc99dbe7a4/kentleague/sladegreen/drmartens/eastern/sittingbourne/28thaug03.html 2 15653 0 0 /news/ebbsfleet220518 1 12452 0 0 /news/hopefullywecangoallawayandgetpromotioninfrontofourownfanssayshessenthaler 1 15217 0 0 /news/wingshavestrongpresenceatdansonfestival 1 12310 0 0 /news/iurgethesupporterstocomeandsupportusoverthisdifficultspellsaysstonesbosspeternott 1 21105 0 0 /news/resultsaugustseptember2012 1 61621 0 0 /news/doverathleticchairmanleftfrustratedovereastbournesnegativetactics 1 14494 0 0 /news/rochesterunited191221 1 11570 0 0 /news/soccershortsfleetgoalkeepercroninrecalledbyengland 1 21582 0 0 /news/NationalLeague241220 2 17606 0 0 /news/wetakeyouthfootballveryseriouslysayserithtownbosstonyrussell 1 14858 0 0 /news/kentleague/thamesmead/2ndaug04.html 1 0 0 0 /news/hythe181015 2 27096 0 0 /news/glebe170120 1 12461 0 0 /news/wp-content/plugins/revslider/css.php 1 0 0 0 /news/tunbridgewells230918 1 13634 0 0 /news/idlovetoputthesilverwareonthetablesayscorinthianbossmattlonghurst 1 14342 0 0 /news/551bc99d185b4 2 22765 0 0 /news/551bc5ddee900 1 10950 0 0 /news/sevewhit071222 5 145940 0 0 /news/fastatement240517 2 27687 0 0 /news/managementpairsignnewcontractstostayatstonebridgeroad 1 11075 0 0 /news/greenwich130815 1 13364 0 0 /news/greenslim130915 1 28083 0 0 /news/smithdropsdowntwodivisionstosignforcanterburycity 1 11141 0 0 /news/yourchancetoplayforashfordtown 1 10429 0 0 /news/wemustremainfocusedinourpromotionchargesayslovell 1 14272 0 0 /news/dulwichhamletfansmeetthelandlordstodiscussclubsfuture 1 14096 0 0 /news/newlyappointedsierraleonacoachroseniorselectsbromleystar 1 10888 0 0 /news/crowborough010616 1 12413 0 0 /news/dartford2-2bromley-wewantedtobethefirstsidetobeatbromleysaysdartsbosstonyburman 1 47408 0 0 /news/551bc5e74cc22 1 16714 0 0 /news/25thapr04.html 1 0 0 0 /news/drmartens/eastern/tonbridge/16thsept04.html 1 0 0 0 /news/drmartens/premier/dover/braintree280804.html 1 0 0 0 /news/bromley180517 2 16597 0 0 /news/folkestoneappealoverfacharge 1 10795 0 0 /news/editorspleafaomrjerrydolkechairmanbromleyfc 1 12104 0 0 /news/dolbylooksforwardtoreturningtofootball 1 12488 0 0 /news/551bc5e14e2e4 1 11770 0 0 /news/iregretmovingtodartfordadmitscarley 1 13517 0 0 /news/coneyhallappointhullettastheirnewmanager 1 10956 0 0 /news/lureofbiggergatespesuadedcasstoleavechathamforrivalsdartford-exclusiveinterviews 1 16578 0 0 /news/chairmanspraiseforhome-grownyoungsters 1 13720 0 0 /news/holmesdale200116 1 17028 0 0 /news/soccershortsmargatewerewithinhoursofclosingdown-piper 1 30273 0 0 /news/erithandbelvedere091020 1 13807 0 0 /news/551bc99b25b22 1 5850 0 0 /news/crayvmaid100504.html 1 0 0 0 /national-league/28 2 24599 0 0 /news/551a9250421da 1 3582 0 0 /news/beckfave010423 5 58150 0 0 /news/hollands120319 1 15042 0 0 /news/glebbeck111221 4 133622 0 0 /news/551bc99dbe7a4/ryman/bromley/kentleague/maidstone/maidvfolk171203.html 2 15653 0 0 /news/551a96784e723 2 16691 0 0 /news/DCMSStatement270121 3 29393 0 0 /news/itwillbenicetobeunderdogsthisseasonsaysashfordunitedassistantmanagerjohnovard 1 14086 0 0 /news/lordswoodwillstartclimbingthetablevowsmetcalf 1 15357 0 0 /news/theycanttakeawaymyplayersheartanddesiresayshernebaybosssimonhalsey 1 18397 0 0 /news/beckenham230720 2 17554 0 0 /news/weknowthe3gpitchisthefutureoffootballsaysmaidstoneunitedco-ownerterrycasey 1 20984 0 0 /isthmian-league/39 2 25353 0 0 /news/thamesmeadtown0-0metropolitanpolice-itsamassivepointgainedforussayskeithmcmahon 1 32099 0 0 /news/sct060718 1 13385 0 0 /news/oconnellbeatingthedropisdefinitelyon 1 15249 0 0 /news/551a956c2abc1 1 4458 0 0 /news/551bc5e064f29 1 20846 0 0 /news/551a9250b6811 2 15666 0 0 /news/soccershortsimstayingattootingsaysvines-exclusives 1 18607 0 0 /news/berkhamsted250904.html 1 0 0 0 /news/corinthian030920 1 17500 0 0 /news/551bc5e2c003c 1 11896 0 0 /news/eastthurrockunited0-3folkestoneinvicta 1 17052 0 0 /news/imquitedelightedreallyhowitsgonesayssevenacresidcupbossleehills 1 17441 0 0 /news/favershamtown051021 2 23285 0 0 /news/551bc5e6cff99 1 21843 0 0 /news/ebbsfleet020120 1 12423 0 0 /news/wellingunited1-1charltonathletic-iwillgivetrialistsanotherchancetoimpresssaysford 1 24070 0 0 /news/wellingunitedbossjamiedayurgesfanstosupportwarm-upfixtures 1 21141 0 0 /news/3rdoct04.html 1 0 0 0 /news/margate060421 2 24645 0 0 /news/551a9798691e4 1 5492 0 0 /news/dulwichhamlet0-2sittingbourne-no-onewillwanttoplayusinplay-offssaysabbott 1 17260 0 0 /news/kentmanagersreactiontomouth-wateringfacupthirdqualifyingroundties 1 21422 0 0 /news/phoechar041219 2 59940 0 0 /news/gessstunningstrikehelpswhitstablebeatbedfont 1 15024 0 0 /news/551a97b098897 1 10971 0 0 /news/woodstockfolding200415 1 11933 0 0 /news/crowboroughathletic191022 1 13263 0 0 /news/lordswood280420 1 12139 0 0 /news/weregoingtogivesomeonearightpastingwarnsmargatebossashby 1 12028 0 0 /news/ryman/bromley/22ndaug04.html 1 0 0 0 /news/doverchasepromotion 1 11611 0 0 /news/drmartens/eastern/folkestone/hendon121004.html 1 0 0 0 /news/551bc5df562eb 1 12786 0 0 /news/vickerscupclashwilltakethepressureoffussayshythetownbossscottporter 1 13621 0 0 /news/ifplayersarentattrainingthentheywontplaywarnsmiltonfulstonbossaaronperry 1 16878 0 0 /news/551bc99dbe7a4/kentleague/sevenoaks/kentleague/cray/crayvsporting160803.html 2 15653 0 0 /news/27thsept04.html 2 0 0 0 /news/551a96780d78c 2 19093 0 0 /news/551bc99dbe7a4/drmartens/eastern/sittingbourne/kentleague/whitstable/21stjuly03.html 2 15653 0 0 /news/yourcompanycansponsorthiswebsiteforjust3000 1 10248 0 0 /news/551a96dbb8ade 3 26570 0 0 /news/551bc99b3fe26 2 16111 0 0 /news/itsimperativethatwewinatchipsteadsaysmunday 1 21488 0 0 /news/kentsleadinghotshots-lastupdated22032012 1 12227 0 0 /news/abbottthinksaboutplayingthreeupfrontagainstwhitstable 1 14625 0 0 /news/sittingbournechairmanpaystributetooutgoingreserveteamboss 1 12487 0 0 /news/robbinsquitscash-strappedtunbridgewells 1 13642 0 0 /news/sheppey140617 2 22168 0 0 /news/7thdec03.html 1 0 0 0 /news/551a9718a8399 3 31485 0 0 /news/margate010218 2 26202 0 0 /news/wemustremainfocusedandcollectthreepointssayshume 1 14350 0 0 /news/ashford010116 1 11736 0 0 /news/ebbsfleetunitedcontinuesearchfortrainingbase 1 20978 0 0 /news/apmbrowning260415 2 16084 0 0 /news/kissi070116 1 13511 0 0 /news/dulwichextremelyconfidentthatshowdownwithdoverwillgoahead 1 12904 0 0 /news/551bc5e2f2547 1 14849 0 0 /news/chatham030317 6 40124 3 3 /news/551a9cf5a1fc1 2 17747 0 0 /news/exclusivefavasesecondqualifyingroundpreviews 1 29983 0 0 /news/itsoneofthoseseasonsoflearningsaysgreenwichboroughbossgerrycox 1 15961 0 0 /news/wellinglaunchinitiativetoraisemoneyfornewfloodlights 1 12538 0 0 /news/opkfixupfriendlieswithhalfadozenkentleaguesides 1 15316 0 0 /news/margateunveilyouthprogramme 1 13344 0 0 /news/sevenoakstown0-2dulwichhamlet-ladyluckdesertedusadmitsdisappointedjones 1 29621 0 0 /news/othernews/gotravelkentleaguetables170304.html 1 0 0 0 /news/gillsladies300915 2 26876 0 0 /news/staplehurst170620 1 12036 0 0 /news/10thoct03.html 1 0 0 0 /news/kentproxi3-5georgehowardkentleaguexi-afantasticdayforgeorgehowardsaysmickycollins 1 34775 0 0 /news/margateunveilfirstsummersigning 2 13820 0 0 /news/bromley280719 2 18406 0 0 /news/551a97b21c405 1 14678 0 0 /news/cugleyreflectsonthehighsandlowsoflastseason 1 12972 0 0 /news/formermanchesterunitedstrikersignsforkentleaguecroydon-exclusive 1 12830 0 0 /news/gillslonc250315 1 32671 0 0 /news/itfeelsgoodtobejoint-topadmitslovell-exclusive 1 14750 0 0 /news/551a9798d675d 1 6539 0 0 /news/doverathletic0-0afcwimbledon-werodeourlucktodayadmitsbrown 1 19210 0 0 /news/canveyisland161020 3 26608 0 0 /news/leagueformgoesoutofthewindowinthefacupsayshessenthaler 1 19610 0 0 /news/dartsutt051116 2 39485 0 0 /news/thamhyth160817 2 54904 0 0 /news/metcalfiknowthechallengesthatlieaheadatlordswood 1 14467 0 0 /news/carterton210904.html 1 0 0 0 /national-league/11 4 49345 0 0 /news/snodsutt240922 4 137854 0 0 /archive-2006-2014/214 1 19901 0 0 /news/thefacupisalwaysadifficultcompetitionwarnssemi-finalistpaulmccarthy 1 23919 0 0 /news/wilkinsmakesswiftreturntodover 1 12598 0 0 /news/releasedplayersonthemarketlookingfornewclubs 1 12882 0 0 /news/NationalLeagueStatement180221 2 15841 0 0 /news/banscher040419 1 17531 0 0 /news/fleetfinallygetclearanceforscottishwingeranderson 1 12048 0 0 /news/wemustchopdownsomewoodsaystrott 1 12482 0 0 /news/xleet-shell.php 1 0 0 0 /news/24thmar05.html 1 0 0 0 /news/britishgassponsorsouthernleague 1 11609 0 0 /news/fisher2-2ashfordunited-wevegottolickourwoundssaysjohnovard 1 34316 0 0 /news/glebe131122 1 19234 0 0 /news/ashfordbeginsearchfornewyouthcoach 1 11688 0 0 /news/weretryingtogetasmanypointsaspossiblesaysthamesmeadtownbosskeithmcmahon 1 15741 0 0 /news/iwanttogetoutthereanddothebusinesssaysgillinghamstrikeradambirchall 1 14633 0 0 /news/cugleyswoopsforbrightonkeeper 1 11035 0 0 /news/sampsonreturnshomeandvowstowinatwembleyagain-exclusive 1 13074 0 0 /news/iwilldeliverthetrophysayswalker 1 14002 0 0 /news/maidenheadunited0-0doverathletic-imhappywithapointsayshessenthaler 1 18928 0 0 /news/londonbridge040617 2 29376 0 0 /news/southallsetfordoverreturn 1 13545 0 0 /archive-2006-2014/130 1 20187 0 0 /news/greenwichborough2-3whyteleafe-wearerefusingtolosesayswhyteleafebossjohnfowler 1 31205 0 0 /news/ourlastfourgameshastakenitstollsayssittingbournebossgaryabbott 1 12624 0 0 /news/551a97b0bee23 2 31752 0 0 /news/ryman/bromley/MolevBrom010104.html 2 0 0 0 /news/lordswood2-2greenwichborough-lordswoodisagreatplacetobearoundatthemomentsayslillis 1 20464 0 0 /news/leatherhead210517 2 22532 0 0 /news/fisher0-2hythetown-imsuretheresmanymoregoalstocomefrombrendoncasswarnsporter 1 34159 0 0 /news/iwanttotaketheclubforwardsaysmargatessurprisechoicebutler 1 19334 0 0 /news/wingsplayer-managerjamiedaytriestolifthistiredtroops 1 16130 0 0 /news/kentleague/whitstable/27thnov03.html 1 0 0 0 /news/crayvalley281217 1 13952 0 0 /news/drmartens/eastern/dartford/12thnov04.html 2 0 0 0 /news/551a96dbf2a42 1 3583 0 0 /news/IsthmianLeague210320 3 26353 0 0 /news/tomorrowwillbemylastgameinchargeofsittingbournesaysmarcseager 1 18473 0 0 /news/doverathleticunveilchriskinnearastheirnewboss 1 13292 0 0 /news/theclubhasmovedonquiteabitinthelast10yearssaysfcelmsteadchairmantonyalliband 1 15240 0 0 /kent-invicta-league/5 3 43039 0 0 /news/daishswoopsforwokingdefendermacdonald 1 12476 0 0 /news/heybridgeswifts0-0dartford-burmanbeginssearchforcodyreplacement 1 17032 0 0 /news/spennymoortown2-1tunbridgewells-wegaveiteverythingonadaytoremembersaysjasonbourne 2 53884 0 0 /news/rivalslockhornsformoreimportantleagueclash-exclusiveinterviews 1 13828 0 0 /news/conference/margate/25thsept04.html 2 0 0 0 /news/hernebay0-2chathamtown-weweregenerallyawfuladmitshernebaybosssimonhalsey 1 19142 0 0 /news/dartford190819 2 15715 0 0 /news/ramsgate020223 2 30311 0 0 /news/erithbelvedere0-2vcdathletic-wedidntwanttoexittwocupsinaweeksaysrickybennett 1 24297 0 0 /folkestone-2003-2006/6 2 17996 0 0 /news/mersbird010515 2 30696 0 0 /news/wehave90minutestonailourpre-seasonsayshalsey 1 15622 0 0 /news/551a931e0d453 1 10276 0 0 /news/holmesdaleneedasugardaddytoprogressfurthersayscoachgrantwatts 1 21457 0 0 /news/tonbridge210617 2 23082 0 0 /news/tonbridgebosswarrilowaddsmorequalitytolongmead 1 13462 0 0 /news/stansfeld240921 1 13000 0 0 /news/failurethiscloseisnotanoptioninmybooksayshernebaybosssimonhalsey 1 16821 0 0 /news/sceflstatement131120 1 11925 0 0 /news/dartford270217 2 15692 0 0 /news/551bc99dbe7a4/drmartens/eastern/folkestone/kentleague/hernebay/hernvlords111003.html 2 15653 0 0 /news/26thnov04.html 1 0 0 0 /news/551a97b25403d 1 13096 0 0 /news/millwallchairman200320 2 26673 0 0 /news/551a96dba27e4 2 14353 0 0 /news/3rdsept04.html 1 0 0 0 /news/greerust230919 1 31331 0 0 /news/drmartens/premier/welling/preseason.html 1 0 0 0 /news/sittingbourne090217 2 27358 0 0 /news/kentleague/lordswood/1stdec03.html 1 0 0 0 /news/24thapr05.html 1 0 0 0 /news/craywands310318 3 28483 0 0 /news/551a956c3bb7e 2 20694 0 0 /news/vickersquartetshineininauguralkeeperwarstournament-exclusive 1 15251 0 0 /news/wp-content/plugins/linkpreview/db.php 1 0 0 0 /news/dartford2-5gillingham-wegavegillinghamagamesaysdartfordbosstonyburman 1 21346 0 0 /news/holdertobeskipperofasuccessfulfavershamtownsidewouldbeagreathonour 1 18368 0 0 /news/thefacupisaroadthatleadstogreatexcitingthingssaysramsgatebossjimward 1 13718 0 0 /news/theweekahead-13 1 14567 0 0 /news/wokiwell120519 1 26551 0 0 /news/551a97190a71f 3 37896 0 0 /news/myplayershavebeenwarnedaboutlyddsayscorinthianbossjamescollins 1 13712 0 0 /news/punjab270819 1 12379 0 0 /news/dartford0-1chester-itsgettingveryverydifficultforusadmitsdartfordbosstonyburman 2 34018 0 0 /news/wardplotshistoricfatrophygiantkilling 1 18120 0 0 /news/holmesdale280419 1 13692 0 0 /news/headtoheadiwouldntliketoputmymoneyononeortheothersaystommysampson 1 28399 0 0 /news/snodlandtown030719 1 14161 0 0 /news/wp-content/themes/wp.php 1 0 0 0 /news/hollands200117 1 13358 0 0 /news/dulwichhamlet150922 1 12883 0 0 /news/vcdathletic2-2tootingmitchamunited-smithpleasedwithhisattackingoptions 1 19325 0 0 /news/551bc5e0dd569 1 13441 0 0 /news/wewillworktogettheclubbackonitsfeetvowsdealtowndirectorphillipmoore 1 11839 0 0 /news/fisher2-1ringwoodtown-miraclemanrobhughessendsfisherthrough 1 44087 0 0 /news/fcelmstead200917 1 12145 0 0 /news/thamesmead171205.html 1 0 0 0 /news/wehavetogetourheadsrightforcorinthiansaysfisherbossstevefirkins 1 13820 0 0 /news/chipstead060715 2 15808 0 0 /news/maidstone050320 1 14596 0 0 /news/ebbsfleetunited1-0altrincham-itwasimportanttowinaheadofourbusymonth-daish 1 18703 0 0 /news/livecoveragedoverathletic1-0burgesshilltownresultdoverarechampions 1 27224 0 0 /news/kentinvictaleagueconfirmfirstsixteenparticipants 1 12597 0 0 /news/thamesmead180915 2 25653 0 0 /news/551a9799ab276 1 5176 0 0 /news/itsaderbygameanythingcanhappensayshernebaybosssamdenly 1 15961 0 0 /news/kentyouth/02-03honours.html 1 0 0 0 /news/editorsnote 1 12561 0 0 /news/21stsep05.html 1 0 0 0 /news/crayvalley101120 3 30760 0 0 /news/farnieswoopsforwinter-nolan-exclusiveinterview 1 14738 0 0 /news/farnbex090516 1 15459 0 0 /news/lingdeal021223/home 1 13054 0 0 /news/drmartens/eastern/folkestone/yeading210804.html 1 0 0 0 /news/angelsreadytostandanddeliver 1 10816 0 0 /news/551bc5dfb3b91 1 11710 0 0 /news/croydon0-4hartleywintney-iwillbehappywithmidtablefinishsayscroydonbossdicksongill 2 33834 0 0 /news/tunbridgewells3-4croydon 1 16080 0 0 /news/sittingbourne180219 2 32136 0 0 /isthmian-league/37 3 45145 0 0 /news/foleysnapsupformeririshyouthinternationaloshea 1 14244 0 0 /news/mentallyifeltineededachangeandnowwastherighttimeforthatchangesaysleeworgan 1 15385 0 0 /news/milesdemandsmoreconsistency-exclusiveinterview 1 14220 0 0 /news/facarlsbergvasethirdrounddraw-1 1 11120 0 0 /news/ryman/bromley/20thoct04A.html 1 0 0 0 /news/folkestoneinvictafc.co.uk 1 0 0 0 /news/551a9c0eb3bdb 4 34166 0 0 /news/scoringgoalscomesnaturaltomeadmitsfree-kickspecialist 1 14321 0 0 /news/wellbethesurprisepackagethisseasonsayslovell-exclusive 1 16531 0 0 /news/favershamtown030823 1 12648 0 0 /news/doverathletic300619 1 12404 0 0 /news/551a931ebac55 2 25834 0 0 /news/angelschairmansullivanisalegendsaysproudangelsfan-exclusive 2 18972 0 0 /news/551bc5dcc1cc0 1 17130 0 0 /news/ebbsfleetunitedre-namestandtohonourmanagerliamdaish 1 11878 0 0 /news/hythetown0-1burgesshilltown-wegaveittothemonaplateadmitshythetownbosstimdixon 1 23840 0 0 /news/march2010results 1 75506 0 0 /news/harrowborough2-0tonbridgeangels-weweresecondbestadmitsangelsbosstommywarrilow 1 14426 0 0 /news/ramsgate260205.html 1 0 0 0 /news/othernews/fat3rdround.html 1 0 0 0 /news/bromley150117 2 20024 0 0 /news/ksporcrow020919 1 35148 0 0 /news/phoenixsports091020 2 25627 0 0 /news/kentleague/hernebay/hernebay.html 1 0 0 0 /news/lordswood1-5pagham-lillislookingforaresponseafterfacupexit 1 19290 0 0 /news/dealvslade030404.html 1 0 0 0 /news/orpington130815 2 16778 1 1 /news/kentseniortrophyfinallivecoveragebeckenhamtown0-2thamesmeadtown-howthetrophywaswon 1 21699 0 0 /news/hythe221015 2 31391 0 0 /news/statattackleadinggoalscorersclubbyclub20102013 1 13459 0 0 /news/debutantwestermenleftinthedarkonderesdebut 1 12980 0 0 /news/theleagueisoutofourhandsnowadmitshuntley-exclusiveinterviews 1 16738 0 0 /news/ihavesetatargetofatoptenfinishsayskentfootballunitedbosssammacneil 1 13982 0 0 /news/ianpulmandepartureleavesahugevoidformetotrytofillsaysramsgatebosstimdixon 1 11584 0 0 /news/551bc99dbe7a4/kentleague/hernebay/kentleague/lordswood/23rdjuly03.html 2 15653 0 0 /news/551bc5da0bc8a 4 40948 1 1 /news/CONIFAWorldCup280518 3 31050 0 0 /news/551bc5e764568 1 16146 0 0 /news/whitstabletownbosspeternottadddsmickelboroughandlyalltohissquad 1 14653 0 0 /news/lordswood090123 1 12398 0 0 /news/soccershortswellbepushingforpromotionnextyearsaysramsgateskipperdeanhill 2 30492 0 0 /news/ilford101205.html 1 0 0 0 /news/favershamtown5-1lordswood-luchfordrefusestolistentotitletalk 1 35298 0 0 /news/deressecuretheirparkviewroadfuture 1 14284 0 0 /news/folkestoneinvictafc.com. 1 0 0 0 /news/maidstone220118 2 18595 0 0 /news/whitstable060419 2 28018 0 0 /news/551bc99dbe7a4/kentleague/greenwich/drmartens/premier/welling/7thjuly03.html 2 15653 0 0 /news/wellingunited130322 2 15231 0 0 /news/551a92507f9a0 2 15735 0 0 /news/maidstone280519 2 17660 0 0 /news/ramschairmanlawsonno-onegaveusachancebutweprovedthemwrong-exclusiveinterview 1 20030 0 0 /news/craywanderers0-3brackleytown-wedidntgetwhatwedeservedadmitsproudfrancis 1 20466 0 0 /news/dartford230819 2 17125 0 0 /news/551bc99dbe7a4/drmartens/eastern/folkestone/ryman/bromley/bromvnorthleighfac300803.html 2 15653 0 0 /news/551bc5dd2c9a9 1 13793 0 0 /news/thatwasnotaone-offperformanceconstablewarnsfolkestone 1 17276 0 0 /news/liamdaishsignsnewone-yearcontract 1 11859 0 0 /news/551a9718cf6c2 2 15003 0 0 /news/folkchat031020 5 185495 0 0 /archive-2006-2014/259 1 19480 0 0 /news/brom3gpitch010515 2 18888 0 0 /news/EFLStatement030420 2 15131 0 0 /news/folkestoneinvictabossneilcugleysnapsupjakebeecroftfromwhitstabletown 1 12267 0 0 /news/551bc5e12e4e7 1 15897 0 0 /news/kentleague/sladegreen/2ndjuly03.html 1 0 0 0 /news/551a92507b784 1 4094 0 0 /news/tonbridgeangels2-0walthamabbey-sixteengoalmidfielderleeminshullcanturnpro-warrilow 1 25478 0 0 /news/551a956b643fa 1 4970 0 0 /news/kentleague/greenwich/26thaug03.html 1 0 0 0 /news/greenwich270218 3 25515 0 0 /news/ihadnoambitionswhatsoevertobeamanageradmitsrookietonyrussell 1 17649 0 0 /archive-2006-2014/171 1 19481 0 0 /news/551a925111821 2 29381 0 0 /news/imjustgladwereprovingquiteafewpeoplewrongsayswarrilow 1 16121 0 0 /news/hoursofhardgraftontrainingpitchpaysdividendsfordarts-exclusive 1 18721 0 0 /news/mygreatestachievementofmymanagerialcareersofarsaysmartinhayes 1 18492 0 0 /news/551a979a44303 1 5146 0 0 /news/balham170920 1 15293 0 0 /news/551bc99b712b2 2 16696 0 0 /news/wevehadagoodstartbutwerenotgettingcarriedawaysaysphoenixsportsbosssteveoboyle 1 16092 0 0 /archive-2006-2014/261 1 19081 0 0 /news/favershamtown1-2folkestoneinvicta-folkestonestartcampaignwithawin 1 17843 0 0 /news/bromley080220 2 15999 0 0 /news/bromley3-4dartford-wehadagreatopportunitytodayandweblewitadmitsmarkgoldberg 2 44319 0 0 /news/craywanderers1-2woking-jenkinspleasedwithpre-seasonpreparation 1 29536 0 0 /news/index.php 1 0 0 0 /news/551a9250d54af 3 45991 0 0 /news/tonbridgeladies060715 1 17016 0 0 /news/551a9cf555803 3 35566 0 0 /news/thirdpartyinterestwithstonesstadium 1 11552 0 0 /news/ebbsfleet180321 5 57016 0 0 /news/ifweapplyourselvesrightthenwellbeamatchforwroxhamsaysdoverbossnickyforster 1 17556 0 0 /news/ashfordtown1-2thamesmeadtown-mcmahonpraisesheroickessell 1 18201 0 0 /news/myjobistogetplayersupformust-winderbydualwithcraysaysnott 1 15724 0 0 /news/wewishrichardlangleywellathorshamsaysramsgatebossjimward 1 16535 0 0 /news/shephern251123 8 238755 3 0 /news/robbinsheapspressureontable-toppingrivals 1 13521 0 0 /news/thamesmeadtown1-1pottersbartown-lastminutegoalsdrawlittlecomfortformcmahon 1 19741 0 0 /news/itwasntevenapenaltyfumesmiller 1 12786 0 0 /news/551a96db7e0c6 1 5196 0 0 /news/kentleague/sladegreen/7thjuly03.html 1 0 0 0 /news/ashfordgivehomelandsaface-lift 1 13196 0 0 /news/animmediatereturntoconferencesouthwouldbegreatsaystonbriddgeangelsbossstevemckimm 2 20670 0 0 /news/wardgivestrialistsachancetoshine 1 12092 0 0 /news/angelsputpoorepsomewellsideintheshade 1 13026 0 0 /news/sittingbourneswitchmidweekdatestoenticefanstobournepark-exclusive 1 16367 0 0 /news/folkestone120618 2 25720 0 0 /news/drmartens/eastern/dartford/1Jan2004.html 1 0 0 0 /news/551a931e1fc0f 1 13172 0 0 /news/itsanopportunitytomakeagooddayintoagreatdaysaysgiant-killermartinlarkin 1 20195 0 0 /news/imexpectingarealbattleatstaineswarnstonbridgeangelsbosstommywarrilow 1 14932 0 0 /news/551bc5df7ef78 1 14263 0 0 /news/wewontbefazedbytheoccasionsaysfoley 1 19109 0 0 /news/soccershortsebbsfleetagreeeurostarsponsorshipextenstion 1 35239 0 0 /news/drmartens/eastern/ashford/Hernebay231004.html 1 0 0 0 /news/paulfoley 1 11083 0 0 /news/saturdaysoccer28thjanuary2006 1 11912 0 0 /news/livecoveragetootingmitchamunited1-0chathamtown 1 17324 0 0 /news/wemustbattletoavoidthedropsayswhitstablestar 1 12691 0 0 /news/wellingtown310517 1 14734 0 0 /news/warrilowsettobringstrikeronloantonight-exclusive 1 10228 0 0 /news/margateunveilplansforhartsdownpark 2 14521 0 0 /news/rymanreports-1 1 36566 0 0 /news/wellkeepoutfeetonthegroundsaystable-toppinghessenthaler 1 12670 0 0 /news/folkestoneinvicta190922 2 25397 0 0 /news/corinthian060418 1 12647 0 0 /news/ibelievewewillgetoutofthebottomfoursaysthamesmeadtownbosskeithmcmahon 1 15454 0 0 /news/vcd050305.html 1 0 0 0 /news/nobodyexpectsustowinthekentleaguetitlenowsayserithtownbossjamescollins 1 16413 0 0 /news/hernebay300423 2 30081 0 0 /news/cugleyrockingaboutpipertransfer-exclusive 1 14838 0 0 /news/corinthian1-1erithtown-wedontexpecttobetopforlongadmitstonysitford 1 32913 0 0 /news/premierleaguerefereeisstarnameatfavershamtownsdinner 1 11784 0 0 /news/551a99e4796d4 1 12443 0 0 /news/551a979ae3616 1 5504 0 0 /news/sevenoakstown130222 2 27483 0 0 /news/doverreceiveplanningpermissionfornewclubhouse 1 10921 0 0 /bromley-2003-2006 16 195812 2 1 /news/kentcountyleaguestatement050420 1 11754 0 0 /news/imconvincedwewillbechallengingforhonoursnestseasoninsistsnewmeadboss 1 13048 0 0 /news/itcouldnthavegoneanybettersaystwo-goalskipperrichmondkissi 1 20595 0 0 /news/chatholl090219 2 49146 0 0 /news/551a9799e8ba5 1 5800 0 0 /news/wehavetogotothurrockthinkingwecanwinitsaysvickersbossrickybennett 1 14370 0 0 /news/551bc5e84be9e 1 12824 0 0 /news/27apr04A.html 1 0 0 0 /news/fisher0-1sevenoakstown-werebynomeansthefinishedarticle-little 1 29203 0 0 /news/551bc5e0d3c5f 1 14894 0 0 /news/gillingham0-1norwichcity-iwanteddartfordacemcdonaldrevealsstimson 1 19316 0 0 /news/about.php7 1 0 0 0 /news/551bc99dbe7a4/drmartens/eastern/ashford/drmartens/premier/dover/22nddec03.html 2 15653 0 0 /news/wereontherighttrackssaysramsgatebossjimward 1 16197 0 0 /news/iwouldforeverregretnottakingtheopportunityihavenowadmitsianpulman 1 13684 0 0 /news/michealeveritthasbeenatremendousservanttothisclubsaysfolkestoneinvictabossneilcugley 1 12979 0 0 /archive-2006-2014/19 2 26150 0 0 /news/holmesdale020421 1 12027 0 0 /news/hythetown190821 2 33561 0 0 /news/croydonathletic1-2maidstoneunited-werejusttryingtobuildalittlebrickinthewall-ford 1 30625 0 0 /news/rymanleagueplay-offheartbreakpromotionisamustnextyearsaysjenkins 1 12873 0 0 /news/westviewcupthirdrounddraw 1 10972 0 0 /news/erithbelvedere1hernebay2 1 12516 0 0 /news/daishpraisesmckimmforbattlingagainstcareerthreateninginjury 2 16091 0 0 /news/iwillonlyplayinemergencies-obrien 1 15973 0 0 /news/kfu110817 1 12507 0 0 /news/1stjune05.html 1 0 0 0 /news/fleetplanforhattersvisit-1 1 12288 0 0 /news/27thjune05.html 1 0 0 0 /news/drmartens/eastern/erith&belvedere/arlesey201104.html 2 0 0 0 /news/atrophywillcapagreatseasonsaysfleetleisurebossleerichmond 2 22396 0 0 /news/highly-ratedstrikerbarronmakesthanetswitch 2 24395 1 1 /news/551bc99e38d6d 2 24251 0 0 /news/kspmer070116 1 37223 0 0 /news/weneedtostartpickingupresultssayschathamtownassistantpeterhawkins 1 13743 0 0 /news/dartford200718 2 14254 0 0 /news/supportfromfreegamewillgivetheteamaliftsayswhitstablechairman 1 14866 0 0 /news/folkestoneinvicta1-0thamesmeadtown-welackedsharpnessadmitscugley 1 32424 0 0 /news/boroughenjoyagooddayoutonthecoast-exclusiveinterview 1 16618 0 0 /news/tunwells050216 1 13280 0 0 /news/cllrkiteweveshownlongtermfaithindartford 1 14541 0 0 /news/551bc99b37df9 1 3381 0 0 /news/idgivesittingbourneoddsof10-1ofprogressinginthefacupsaysbossjimward 1 15602 0 0 /news/dog-fightwineasedthepressureadmitsmiles-exclusiveinterview 1 12957 0 0 /news/millwallstatement141220 1 10966 0 0 /drmartens 15 133796 2 2 /news/erithsev210317 1 35643 0 0 /news/glebebrom200716 2 41397 0 0 /news/551a99e423692 1 11913 0 0 /news/dulwich090217 2 28053 0 0 /news/ramsgate160417 2 29639 0 0 /news/rusthallleftinthedark 1 18709 0 0 /news/wecantbegoodoneweekandbadthenext-hume 1 14679 0 0 /news/eastbourne221019 1 15960 0 0 /news/ashfordunited280320 3 26111 0 0 /news/wenowwanttopushontogettothefinalsayscorinthianbosstonysitford 1 21350 0 0 /news/suttonreplay201004.html 1 0 0 0 /news/dartford1-1wellingunited-werehopingthatwemaygetsomegoodembargonewssoon-day 1 22154 0 0 /news/sammywantsmooregoals 1 13280 0 0 /archive-2006-2014/281 2 23592 0 0 /news/551bc5e4d4dcf 1 13146 0 0 /news/tonbridgeangels260620 1 10873 0 0 /news/drmartens/eastern/folkestone/folkvstev100104.html 1 0 0 0 /news/hessenthalerintalkstobringsouthalltodoverathletic 1 19108 0 0 /news/vcdathletic270119 2 25741 0 0 /news/beckenham100119 1 15900 0 0 /news/ihopewehavethehonourofbeatingburgesshilltwicesaysdartfordbosstonyburman 2 36570 0 0 /national-league/8 5 53731 1 0 /news/bromley061219 2 15978 0 0 /news/weshouldvegotsomethingoutofthegameadmitslovell 1 17641 0 0 /drmartens/eastern/sittingbourne/sittvchar170704.html 2 5408 2 2 /news/sykochallengedetails 1 13293 0 0 /news/othernews/10thaug04.html 1 0 0 0 /news/ebbsfleetunited1-1millwalllionessesaet-millwall3-1pensimsoproudsaysfleetboss 1 21281 0 0 /news/551bc99dbe7a4/drmartens/eastern/dartford/drmartens/eastern/dartford/26thjune03.html 2 15653 0 0 /news/dartfordsnewstadiumhaslinkwithrealmadrid 2 14769 0 0 /news/theweekahead-12 1 16853 0 0 /news/26thdec04.html 1 0 0 0 /news/newleaguewillbridgethegapsaysfa 1 14490 0 0 /news/chatham041019 2 17644 0 0 /news/soccershorts110716 2 34064 0 0 /news/hollandsblair041215 1 12507 0 0 /news/royguivercomesintoturnhythetownsyoungstersfortunesaround 1 12782 0 0 /news/sevenacresidcup3-0lewishamborough-thereisroomforimprovementsayslouiewalker 1 27589 0 0 /news/bromley060318 1 21971 0 0 /news/551bc5e9086fb 1 17572 0 0 /news/fcelmstead300819 1 13726 0 0 /news/551a97b05e359 2 24914 0 0 /news/ashfordtownpressconference 1 10526 0 0 /news/551a956c7aca0 1 3471 0 0 /news/ebbsfleetunited1-2altrincham-daishontransferactivityinearlygotoneinyesterday 1 21525 0 0 /news/tonightsteam-news 1 16190 0 0 /news/iwouldliketogobackintomanagementsaysdouble-winnermickycollins 1 17936 0 0 /news/ramsgate3doverathletic2theramsaregoingup 1 17898 0 0 /news/erithbel300715 1 15810 0 0 /news/551bc99dbe7a4/nationwide/gillingham/kentleague/cray/crayvgree061203.html 2 15653 0 0 /news/sladegreenunveilfordastheirnewboss 1 16196 0 0 /news/cumberbatchwecannotaffordtolose-exclusiveinterview 1 13489 0 0 /news/551a956ca8ac9 3 39915 0 0 /news/towewell090920 2 49945 0 0 /news/margateunveilsigningofmidfielderlukeianson 1 13341 0 0 /news/torquayunited101220 1 11543 0 0 /news/551a9250f260d 2 31281 0 0 /news/551bc99dbe7a4/drmartens/eastern/folkestone/kentleague/cray/crayvtham291003.html 2 15653 0 0 /news/elmswell260417 2 49788 0 0 /news/551bc99dbe7a4/othernews/kentyouth/22ndjune03.html 2 15653 0 0 /news/551bc5e4e0286 2 15675 0 0 /news/tonbridgeangels300420 2 15035 0 0 /news/stansfeld100919 1 11457 0 0 /news/uxbridge300405.html 1 0 0 0 /news/craywands091118 3 36133 0 0 /news/itwasgoodtogetbacktowinningwayssaysdulwichhamletbossgavinrose 1 13676 0 0 /news/fordmyexperiencedsidewillnotfreeze 1 14463 0 0 /news/wewanthomecomfortsduringplay-offssaysmcclements 1 30997 0 0 /news/wenowlookforwardtoamassivechallengesaysfavershamsnewmanagerrayturner 1 18088 0 0 /news/wewontgiveuponthetitleracesaysjenkins 1 13990 0 0 /tier-football/3 2 22057 1 0 /news/ineedtwostrikerstostandanddeliversaysbeckenhamtownbossjasonhuntley 1 15763 0 0 /news/folkestoneinvicta0-0horsham-itsimportantwelookabitmoredangerousupfront-cugley 1 27538 0 0 /news/vcdathletic3-2hythetown-youcantjudgeaseasonontheopening90minutessaysporter 1 25591 0 0 /isthmian-league/29 3 46742 0 0 /drmartens/eastern/erith&belvedere/whitstable151005.html 1 9955 0 0 /news/sheppeyunited150521 1 11880 0 0 /news/whitstable151005.html 1 0 0 0 /news/ashbyfuriousoverpenaltydecisionthatendedtrophycampaign 1 14903 0 0 /news/cray261205.html 1 0 0 0 /news/redbridge220105.html 1 0 0 0 /news/wealdstone0-1craywanderers-magnificentlaurenthamiciwillbecomeabetterplayersaysfrancis 1 26703 0 0 /news/fisherannounceprofitsdespitesufferinglossesonthefield 1 16406 0 0 /news/whitstabletown200522 1 12512 0 0 /news/cosgroveplaysdownhissidestitlehopes 1 14389 0 0 /news/greenlew250317 2 61923 0 0 /news/551a96dbd27ab 3 25251 0 0 /news/lovellinjuryblowfornutsbolts 1 12431 0 0 /news/30thaug03.html 1 0 0 0 /news/wardrelishesmoroccanfriendly-exclusiveinterview 1 14646 0 0 /news/551a9c9170f6d 2 15023 0 0 /news/kentleague/beckenham/27thaug04.html 1 0 0 0 /archive-2006-2014/120 1 19993 0 0 /news/foleybringsnugenttooakwood 1 15407 0 0 /news/daishunveilsbarrettsigning 1 11033 0 0 /isthmian-league/9 5 83727 0 0 /news/letsgetitrightonandoffthepitchsaysfarnie-exclusive 1 17009 0 0 /news/romafave250922 6 169277 0 0 /news/16thfeb04.html 1 0 0 0 /national-league/38 3 28143 1 1 /news/drmartens/eastern/dartford/7thjuly03.html 1 0 0 0 /news/wellingunited3-1folkestoneinvicta 1 15151 0 0 /news/wingsextendlinkswithpremiershipneighbours 2 16327 0 0 /news/dartford1-2kidderminsterharriers-weshouldntbethrowinginthetowelsaystonyburman 3 62771 0 0 /news/551bc5dceb1e2 1 10875 0 0 /news/vickersbossfoleyunveilsnewsonashisnewnumbertwo 1 15484 0 0 /news/wp-admin/css/colors/blue/ioxi1.php 1 0 0 0 /news/drmartens/eastern/erith&belvedere/13thsept04.html 1 0 0 0 /news/qotshear120221 4 85338 0 0 /news/551a9c0f13fad 2 22209 0 0 /news/facupfirstrounddrawebbsfleetonroadagainiftheyseeoffwoking 1 13903 0 0 /news/ramsgate0-1dartford-impleasedwiththedirectionwereheadingsaysburman 1 16698 0 0 /news/css/colors/blue/ioxi-rex.php 1 0 0 0 /news/warrilowimnotgivinguponfinishinginplay-offplaces 1 25073 0 0 /news/welling081015 1 12408 0 0 /news/afccroydon031117 1 11953 0 0 /news/551bc5dcd4db0 1 18772 0 0 /news/erithandbelvedere170920 1 13723 0 0 /news/551bc5db1a1d8 4 44986 0 0 /news/551a96785e3c2 2 22773 0 0 /news/sevenorp181115 3 53123 1 1 /news/551bc99dbe7a4/kentleague/maidstone/kentleague/maidstone/maidvslade251003.html 2 15653 0 0 /news/englandinternationalsettleshisfuturehereinkent 1 11916 0 0 /news/tonbridge021217 1 13972 0 0 /news/erith070205.html 1 0 0 0 /news/11thapr04.html 1 0 0 0 /news/chatbeck140419 2 51064 0 0 /news/resultsnovember2014 2 85656 0 0 /news/551a956b69570 1 5370 0 0 /news/fishertoplaypre-seasongamesbackinrotherhithe 1 18447 0 0 /news/kentleague/sladegreen/25thjuly03.html 1 0 0 0 /news/ashford140517 3 28834 0 0 /news/stangleb041122 4 168038 0 0 /news/crockenhill150616 2 14713 0 0 /news/sevenoaks080916 1 14775 0 0 /news/551a99e4102d9 1 11278 0 0 /news/hythetownunveiltrevorkennettastheirnewchairman 1 12405 0 0 /news/7thsept05.html 1 0 0 0 /news/soccershorts190619 2 27562 0 0 /news/wp-admin/maint/wp-login.php 1 0 0 0 /news/551bc99dbe7a4/drmartens/eastern/sittingbourne/drmartens/eastern/dartford/12thoct03.html 2 15653 0 0 /news/bromnott210919 4 56923 2 2 /news/551bc99dbe7a4/drmartens/eastern/tonbridge/kentyouth/02-03honours.html 2 15653 0 0 /news/tonbridge250416 2 30431 0 0 /news/kentleague/thamesmead/23rdaug03.html 1 0 0 0 /national-league/30 2 23883 0 0 /news/wereallpushingintherightdirectionsaysmaidstoneunitedacademymanagerjackparkinson 1 15284 0 0 /news/backingboroughtowembleywemustconcentrateonthejobinhandsaysmalin-exclusive 1 18815 0 0 /news/folkestoneinvictabossneilcugleygoesintothenewseasonfearingtheworse 1 18914 0 0 /news/551bc99b01e16 2 46118 0 0 /news/kentfootballunited221021 1 13694 0 0 /news/hernebay2-3erithtown-whenwepasstheballijustknowwereahandfulsaystonyrussell 1 29812 0 0 /news/FAStatement011220 3 37156 0 0 /news/wearelookingforagooddayoutatdealsaysashfordunitedbosspaulchambers 1 15944 0 0 /news/dartford221015 2 16875 0 0 /news/thefacupfirstrounddrawtherewillbeamassivecrowdagainstdartfordsaysrobswaine 1 17082 0 0 /news/resultsjan2016 2 128937 0 0 /news/mysquadarebuildingaterrficdesiretosucceedsayslyddtownbossdavesmith 1 14086 0 0 /news/551a956b84519 1 3403 0 0 /news/17thoct05.html 1 0 0 0 /news/551bc99dbe7a4/drmartens/eastern/sittingbourne/drmartens/eastern/ashford/30thDec2003.html 2 15653 0 0 /news/551bc5e11baf7 1 10598 0 0 /news/gillingham140222 1 12555 0 0 /news/kentleague/hythe/15thjuly04.html 1 0 0 0 /news/weareofferingafreealternativetochristmasshoppingsayswoodstockchairmanmauricedunk 1 11905 0 0 /news/551bc99ba98f1 1 2927 0 0 /news/doverathletictickledpinktosupportcancercharity 1 13490 0 0 /news/551bc5e505bad 1 15752 0 0 /news/idsayweredarkhorsesforthekentleaguetitlssayserithtownbosstonyrussell 1 17259 0 0 /news/romfordvbromfr120803.html 1 0 0 0 /news/551a956bc33ac 1 4218 0 0 /news/4thnov03.html 1 0 0 0 /news/tunbridgewells200723 1 11015 0 0 /news/craybrig240215 2 52845 0 0 /news/angelsfavouritestotakecupawayfromtheirneighbours 1 14933 0 0 /news/abbottscommentsinspiredmysidetoknockoutsittingbourneadmitsproudgorman 1 15102 0 0 /news/11thmar04.html 1 0 0 0 /news/beckcori060115 1 29701 0 0 /news/cankinnearmakeitfouroutoffour 2 26882 0 0 /news/kinchsidelinedforatleasteightweeks-exclusiveinterview 1 12905 0 0 /news/crayashf110322 3 94203 0 0 /news/kingpledgeshisfuturewithchampions-electwhitstable 1 13151 0 0 /news/horsvbrom091203.html 1 0 0 0 /news/favershamtown171022 2 23243 0 0 /news/parkinsonweshouldhavealittlebitinourlockertoprogress 1 19553 0 0 /news/langtonwedidnthaveaclue 1 17944 0 0 /news/551a9b482d704 4 29934 0 1 /news/4thjuly04.html 1 0 0 0 /news/eritbeck300418 1 31444 0 0 /news/551bc99dbe7a4/drmartens/eastern/ashford/drmartens/premier/welling/17thdec03.html 2 15653 0 0 /news/holmphoe190423 4 149090 0 0 /news/drmartens/eastern/fisher/28thaug03.html 1 0 0 0 /news/croyholl020316 1 10839 0 0 /news/dartford220518 2 17731 0 0 /news/7thjuly03.html 1 0 0 0 /news/31stmay05.html 1 0 0 0 /news/favershamwillshockafewteamswarnswalker 1 15027 0 0 /news/westhamunited2-5tottenhamhotspur 1 18098 0 0 /news/551bc99d5a310 2 23169 0 0 /news/margate290620 5 34670 0 1 /news/dealtown170120 1 13895 0 0 /news/anythinglessthanthetopfiveisabackwardsstepsaysfirkins 1 16228 0 0 /news/hernebay0-1whitstabletownlillisrueshisluckaswhitstablereclaimtopspot-exclusives 1 17073 0 0 /news/margateunveildreammanagementteam 1 10598 0 0 /news/margate210518 2 25159 0 0 /news/favershamtownyouthgetgoingafterlengthypreparation 1 13236 0 0 /news/whitstablechairmanapplaudsteameffort 1 15549 0 0 /news/dartford1-2bromley-mastermindgarethwilliamswasthedifferencebetweenus-markgoldberg 1 26251 0 0 /news/resultsseptember2018 2 116551 0 0 /news/bromley121115 2 20486 0 0 /news/beckfish240216 1 30689 0 0 /news/551bc5e62ed1b 1 13164 0 0 /news/551bc99dbe7a4/drmartens/eastern/erith&belvedere/kentleague/whitstable/9thjuly03.html 2 15653 0 0 /news/youhavetoperformtokeepyourshirtsaysfoley 1 14258 0 0 /news/deal010718 1 12339 0 0 /news/istillthinkfifthspotisavailableforabouttenclubssaysramsgatebossjimward 1 15458 0 0 /news/soccershortschathambossbinksretainselevenplayersfornewcampaign 1 11933 0 0 /news/trotttheleagueistougherthisyear-exclusiveinterview 1 11841 0 0 /news/551a9799d8bc2 1 5316 0 0 /news/551bc5daa8fb4 3 33715 0 0 /news/crowmaid200717 1 12043 0 0 /news/elmscray090719 2 63547 0 0 /news/ashford240704.html 1 0 0 0 /news/saturdaysoccer4thfebruary2006 1 11895 0 0 /news/551bc5e67ec09 1 13139 0 0 /news/hythehaveblownthetitle-hughes 1 14613 0 0 /news/lyddholm110817 1 15072 0 0 /news/551a96db9dab8 3 33845 0 0 /news/letbattlecommence 1 19430 0 0 /news/championsdoverathletic6-0suttonunited-hessexpressrompstoleaguetitleinstyle 1 17917 0 0 /news/welling140917 1 13452 0 0 /news/wejustthoughtweneededtochangeitupslightlysayssittingbournejoint-bossnickdavis 1 14983 0 0 /archive-2006-2014/216 1 19561 0 0 /news/drmartens/eastern/folkestone/folkvbanb310104.html 1 0 0 0 /news/vcdcantaffordtoslipupsayserithbelvederebossmickycollins 1 15715 0 0 /news/ihavethebackingtoturnthingsaroundsaysunderfirelovell 1 14557 0 0 /news/551bc5dd747d8 2 15780 0 0 /news/551a9799661c8 1 5245 0 0 /news/goalkeeperjackdelosetforhernebayreturn 1 12121 0 0 /news/Greevlord130104.html 1 0 0 0 /news/551a96db93f89 2 25631 0 0 /national-league/3 4 44741 0 1 /archive-2006-2014 16 222220 3 4 /news/kentfacampaign121019 2 26276 0 0 /news/lydd290517 1 12496 0 0 /news/drmartens/eastern/dartford/4thdec04.html 1 0 0 0 /news/phoedart240716 2 61349 0 0 /news/drmartens/premier/dover/13thjuly04.html 1 0 0 0 /news/walkersuffersfreakinjurywhilstontrainingcourse 1 11472 0 0 /news/wereonarollercoasterrideadmitscugley 1 14292 0 0 /news/erithtown020715 1 17212 0 0 /news/8thnov03.html 1 0 0 0 /news/kentcountyleagueformerashfordstarboormannetsbraceforborough 1 12979 0 0 /news/28thjune04.html 1 0 0 0 /news/resultsseptember2016 2 117145 0 0 /news/fisher3-0nortonsports-everyonelovestohateusbutwedontcaresaysnortonsbentaylor 1 46034 0 0 /news/fifth-placeisnotabadreturnsaysashfordunitedbosspaulchambers 1 13143 0 0 /news/tonbridgeangels1-1bromley-imsurewellcrawlourwayoutoftroublesaysmarkgoldberg 1 24984 0 0 /news/transferwindowwillstopalltheseseven-dayapproachessayscroydonchairmandicksongill 1 16915 0 0 /news/551bc99a88d4a 2 14537 0 0 /news/551bc99dbe7a4/othernews/ryman/bromley/28thoct03.html 2 15653 0 0 /news/551bc99dbe7a4/kentleague/thamesmead/ryman/bromley/bromvwalton060903.html 2 15653 0 0 /news/londonersreleasedbyramsgate 1 11198 0 0 /news/kentleague/greenwich/ramsgate231104A.html 1 0 0 0 /news/lordswoodbossmetcalftargetstopsix 1 18160 0 0 /news/harwoodruledoutforrestoftheyear 1 16641 0 0 /news/lordswood030619 1 13970 0 0 /news/ryman/bromley/sutton161004.html 1 0 0 0 /news/bromstev161117 1 28865 0 0 /news/iwouldntswapanyofmyplayerswiththeirssaysabbott 1 18089 0 0 /news/beckenham281217 1 13394 0 0 /news/sevehyth071020 3 88718 0 0 /news/mickycollinswantstodeliverknock-outpunchinfacuptieatcorinthian-casuals 1 16022 0 0 /news/othernews/16thnov04.html 1 0 0 0 /news/nottbeginssearchforfirstteamcoach 1 14742 0 0 /news/lewisct200818 1 34334 0 0 /news/cugleyholdscrisismeetingtoimproveinvictasfortunes 1 16057 0 0 /news/soccershortsfanstocontributetowardsfolkestoneinvictasmonthlycva 1 34880 0 0 /news/tunwells191115 1 14933 0 0 /news/551bc99dbe7a4/drmartens/eastern/dartford/kentleague/ramsgate/11thnov03.html 2 15653 0 0 /archive-2006-2014/75 1 20835 0 0 /news/barking160805.html 1 0 0 0 /news/winningmeanssomuchfortonbridge-exclusiveinterviews 1 20248 0 0 /news/14jan04.html 1 0 0 0 /drmartens/eastern/erith&belvedere/9thjune04A.html 2 5217 1 1 /news/551bc5da40d4b 4 38132 1 1 /news/bromley101116 2 20890 0 0 /news/wereamatchforanyonewarnsmetcalf 1 13142 0 0 /news/sevencray291218 2 67065 0 0 /news/bengal140804.html 1 0 0 0 /news/wp-content/plugins/dzs-zoomsounds/a57bze8931.php 1 0 0 0 /news/craywhyt100320 3 69305 0 0 /news/beckenham310719 1 14222 0 0 /news/crawleytown1-2ebbsfleetunited-fleetlovehighly-ratedstrikerakinde 1 20171 0 0 /news/bentaylorwastheheartandsouloftheclubforsixyearssayswoodstocksportschairronwelling 1 15170 0 0 /news/fisherappointpowellascoach 1 14696 0 0 /news/dagenham291219 2 15726 0 0 /news/sittingbourne0-3chipstead-myplayersshouldgohomeembarrassedafterthatfumesgaryabbott 1 25410 0 0 /archive-2006-2014/156 1 19320 0 0 /news/folkestoneinvicta1-1leatherhead1-3p-theoff-the-fieldsituationhasgottoimprove-cugley 1 33678 0 0 /news/elmskspo171117 1 27715 0 0 /news/maidstone180320 3 28274 0 0 /news/daywantstostartpre-seasontrainingwithatleast12players 1 11725 0 0 /news/kentleague/maidstone/17thnov03.html 1 0 0 0 /news/greenwich040217 2 27873 0 0 /news/maidstoneunited3-1burytown-wemustcutoutdefensivemistakessayshume 1 14465 0 0 /news/oursuccessstorywouldmakeagreatfilmsaysjackson 1 20248 0 0 /news/551bc5e053ab8 2 23249 0 0 /news/dontshutthegateappealletspulltogethertohelponeofourown 1 16515 0 0 /news/youvejustgottopinchyourselfsometimestoseewherewearesaysdartfordbosstonyburman 1 17212 0 0 /news/england290816 2 24855 0 0 /news/rochester040920 1 11402 0 0 /news/thefleetatwembleykentsredarmydescendonwembley 1 13045 0 0 /news/551bc5e814877 1 16284 0 0 /news/cugleytellsfansthanksforstickingbyus 1 19558 0 0 /news/kentleague/sladegreen/bowey190804.html 1 0 0 0 /news/fisher0-1erithtown-everygameisahardgameinthekentleaguesaysraypowell 1 23430 0 0 /news/pittawaywewanttotakesevenoakstownuptoabetterlevel 1 13328 0 0 /news/glebe300817 1 12127 0 0 /news/nowisthetimetostanddownsayshythetownchairmanpaulmarkland 1 12478 0 0 /news/lewisham140816 1 15080 0 0 /news/551a967869765 2 14871 0 0 /news/sittingbourneunveilgoalscoringlegendastheirnewboss 1 11037 0 0 /southern-counties-east-football-league/30 1 19920 0 0 /news/hernebay1-0hythetown-morgansdefenceleavesporterspeechless 1 21768 0 0 /archive-2006-2014/285 2 22768 0 0 /news/thehythegamesareusuallygoodspicygamessaysfolkestoneinvictabossneilcugley 1 17011 0 0 /news/551bc5e145adc 1 13602 0 0 /news/551bc99dbe7a4/drmartens/eastern/dartford/kentleague/lordswood/lordvramsfav181003.html 2 15653 0 0 /news/551a956be1361 1 3818 0 0 /news/resultsfeb2017 2 130020 0 0 /news/drmartens/premier/dover/5thsept04.html 1 0 0 0 /news/folkestone240417 2 28466 0 0 /news/itwouldbegreattotakesittingbournetothefacupfirstroundsaysjoint-managerjimward 1 12710 0 0 /news/ryman/bromley/16thjuly03.html 1 0 0 0 /news/chatham200217 3 29062 0 0 /news/hollshep190220 1 35791 0 0 /news/welling251006 1 13257 0 0 /news/wehavetomakesureweturnupanddoourselvesjusticeagainstlutontownsaysjamieday 1 16238 0 0 /news/ryman/bromley/18thsept03.html 2 0 0 0 /news/maidstone100518 2 14521 1 1 /news/orpington060815 1 12579 0 0 /news/551bc99dbe7a4/kentleague/sladegreen/drmartens/eastern/dartford/9thoct03.html 2 15653 0 0 /news/leppardchangeshisspots 1 13593 0 0 /news/ashfordunveilformerjamaicaninternationalstriker 1 12484 0 0 /news/551a9c924ed8b 3 50930 0 0 /news/551bc99b86af3 1 6619 0 0 /news/phoevcd301218 2 64444 0 0 /news/551bc5e280ff8 1 11501 0 0 /news/corinthian0-2beckenhamtown-ineedanewchallengesaysmattlonghurst 7 200856 2 1 /news/suttonunited3gpitchdebate050218 1 14778 0 0 /news/551bc99dbe7a4/ryman/kentleague/whitstable/whitstablevdeal250803.html 2 15653 0 0 /news/sevenoaks100905.html 1 0 0 0 /news/tunbridgewells160122 1 18108 0 0 /news/holmesdale040419 1 11494 0 0 /news/itsabiggameincontexttowherewebothareintheleaguesaysdulwichhamletbossgavinrose 1 14472 0 0 /news/kentyouthleaguestatement181020 2 27215 0 0 /news/wellingunitedauctiongiveswinningbidaplaceintheteam 1 13015 0 0 /news/maidstoneunited1-1hythetown-maybethiscankick-startourseasonsaysscottporter 1 21704 0 0 /news/merksp080117 1 15181 0 0 /news/lewisham020518 1 12619 0 0 /news/craywanderers250322 3 40330 0 0 /news/kentfainsurancestatement190320 2 24649 0 0 /news/wehadtowinforourwalkingfanssayshume-exclusiveinterviews 1 18344 0 0 /news/finishingmid-tableisnotgoodenoughsaysderesbossradbourne 1 12557 0 0 /news/wellseehowfarwevecomesayswhitstablebossseager 1 11751 0 0 /news/greenbeltlandisprecioustousinsistbromleycouncil 1 13667 0 0 /news/ramsgate131219 2 24540 0 0 /national-league/18 2 24764 0 0 /news/holmesdale1-2hernebay-wewontgiveupontitleuntilitsmathematicalinsistshalsey 1 35661 0 0 /news/punjab300417 2 15873 1 1 /news/everyplayerhasbeenexcellentforusthisyearsaysburman 1 17691 0 0 /news/ramsgatepartcompanywithtimdixonafterbeatingtootingmitcham 1 13310 0 0 /news/551a9250cb340 1 3691 0 0 /news/werelookingtoplayinvictaleaguefootballnextyearsaysmetrogasmanagerroydavies 1 15160 0 0 /news/phoenix021115 2 26857 0 0 /news/ourfinancialsituationremainscriticalwarnsfolkestoneinvictachairman 1 16156 0 0 /news/hernebay1-2erithbelvedere-hopefullywevedoneourselvesjusticesayscollins 1 38752 0 0 /news/aveley3-0thamesmeadtown-problemsmountformead 1 14057 0 0 /archive-2006-2014/7 3 44957 0 0 /news/lyddtown291119 1 11590 0 0 /kent-county-league/8 3 41446 0 0 /news/ebbsfleet140717 1 11817 0 0 /news/larkinunveilsfournewsignings-huntleyrueslossofgormanbrothers 1 15083 0 0 /news/luchfordseeksimprovementaheadofwhitethawkopener 1 17339 0 0 /news/fisher010615 2 18185 0 0 /news/21stjuly04A.html 1 0 0 0 /news/551a97b1be795 1 15144 0 0 /news/drmartens/eastern/ashford/1stmar04.html 1 0 0 0 /news/551a97b1cd639 1 14931 0 0 /news/551bc5e2d9176 1 11448 0 0 /news/performancescanbebetteradmitspennock-exclusiveinterview 1 19719 0 0 /news/551bc5df6bea6 1 15995 0 0 /news/551bc5e161f6e 1 11694 0 0 /news/551bc99ce6b68 2 18703 0 0 /news/551bc99e1fa27 2 30023 0 0 /news/sittingbournefc.co.uk 2 0 0 0 /news/551a9c91a321a 2 15762 0 0 /news/evertoncharlton120415 1 15644 0 0 /news/tonbridgeangels220321 1 12443 0 0 /news/everyeffortwillbeputintoreachplay-offssaysward 1 18396 0 0 /news/iwilldropplayersiftheydontimprovewarnshalsey 1 15523 0 0 /news/551a99e530841 1 20328 0 0 /news/londkent310116 3 77143 0 0 /news/551a979818094 1 3298 0 0 /news/phoenix120419 1 13510 0 0 /news/whitstable280815 3 26582 0 0 /news/beckharr110215 1 29486 0 0 /news/walkerraidschathamfortwohighly-ratedyoungsters 1 11146 0 0 /news/charlton220318 3 29285 0 0 /news/kentleague/ramsgate/15thjuly03.html 2 0 0 0 /news/sladevbeck011103.html 1 0 0 0 /news/551bc99dbe7a4/nationwide/gillingham/drmartens/eastern/folkestone/sailsburyvfolkestone200903.html 2 15653 0 0 /news/bearsted080917 1 12348 0 0 /news/css/xmrlpc.php 1 0 0 0 /news/ramsgate111218 2 23838 0 0 /news/6thdec04.html 1 0 0 0 /news/stonesshockitsnotthebeginningoftheendinsistsbowden-brown 1 13525 0 0 /news/conference/margate/12thsept03.html 1 0 0 0 /news/promotionisourobjectiveinsistshernebaychairman-exclusiveinterview 1 15244 0 0 /news/othernews/FavershamTown190904C.html 1 0 0 0 /news/myhardworkingplayershavethebelieftogetintotheplay-offssaysgaryabbott 1 17757 0 0 /news/thesykochallengeisonsunday 2 14966 0 0 /news/crowborough270420 1 11278 0 0 /news/snodlandtown300420 1 12213 0 0 /news/551a931e7c5ad 2 35392 0 0 /news/foreelms290521 4 130494 0 0 /news/mcmahonlookingtocreatetrophyhistoryformead 1 15527 0 0 /national-league/10 4 45552 0 0 /news/sevenoakstown3-1lordswoodmoorewarnshissidenottocrashandburn-exclusiveinterview 1 16474 0 0 /news/551bc5d9c2cd5 4 38800 0 0 /news/doverathleticunveilthesigningofformermillwallstrikerbenmay 1 13830 0 0 /news/erithtown160705.html 1 0 0 0 /news/itsridiculousthatwehavetoplaytwicein72hoursbemoanscrayassistantjoefrancis 1 23886 0 0 /news/551bc5df3cff1 1 18908 0 0 /news/dartford2-3leytonorient-itsamassivebigtestforussaysdartfordbosstonyburman 2 33778 0 0 /news/wevegottoperformagainstourpromotionrivalssaysianjenkins 1 15449 0 0 /news/15thdec05.html 2 0 0 0 /news/othernews/pitches25thjuly03.html 1 0 0 0 /news/kentleague/maidstone/3rdmar04.html 1 0 0 0 /news/rusttunb261222 4 142602 0 0 /news/dolbymakesdoublesigning-exclusive 2 18447 0 0 /news/soccershortsworkingfootballerstabbedduringg20protests 1 21263 0 0 /news/theplayersarenotrobotsandthefixtureback-loghasbeenruthlesssayssamdenly 1 16422 0 0 /drmartens/eastern/ashford/4thjuly04.html 1 9955 0 0 /folkestone-2003-2006/7 2 16877 0 0 /news/folkestoneinvicta0-0heybridgeswifts 1 15048 0 0 /news/kentleague/thamesmead/26thjune03.html 1 0 0 0 /news/whitstablerelishseasideshowdownwithmargate-exclusiveinterview 1 14554 0 0 /news/pre-seasonfriendlies-2 1 20180 0 0 /news/punjab290617 1 11785 0 0 /news/tonbridgeangels130523 3 31438 1 1 /news/fleetappointnewchairman 1 14920 0 0 /news/punjabunited090123 1 13423 0 0 /bromley-2003-2006/7 2 17972 0 0 /news/551bc5e3be546 1 14395 0 0 /news/fisher170716 1 13108 0 0 /news/wearesuresittingbournewillbehappyintheirnewhomesayswoodstockchairmanmauricedunk 1 13583 0 0 /news/ambitiousashfordsettounveilstadiumplans 1 14053 0 0 /news/25thfeb05.html 1 0 0 0 /news/drmartens/eastern/ashford/4thaug03.html 1 0 0 0 /news/wp-admin/js/widgets/xmrlpc.php 1 0 0 0 /news/facupdrawwearemassiveunderdogsatstainessayssittingbournebossnickdavis 1 14631 0 0 /news/drmartens/eastern/sittingbourne/sittveastthurrockfac270903.html 1 0 0 0 /news/tonbridgeangels1-0havantwaterlooville-everyonesputinashifttonightsaystommywarrilow 1 25742 0 0 /news/hernebht140315 2 49937 0 0 /news/tunwellscroyath010116 1 13536 0 0 /news/gorepensnewdoverdeal 1 12364 0 0 /news/craywanderers1-2maidstoneunited-probablyoneofmyworstdefeatsivesufferedadmitsjenkins 1 26450 0 0 /news/weletourselvesdowninthefacupadmitserithbelvederebossmartinford 1 15221 0 0 /news/chatham200620 3 17109 0 0 /news/ryman/bromley/bromvcor130304.html 1 0 0 0 /news/551a95b383db6 3 36161 0 0 /news/premiershiprefereeattendsthanetmeeting 1 14629 0 0 /news/ashfordunited030523 2 30493 0 0 /news/iexpectustotakeourtopformintonextseasonsaysramsgatebossjimward 1 14644 0 0 /news/tonbridgeangels3-3folkestoneinvicta 1 17247 0 0 /news/whitstablevlordswood130903.html 1 0 0 0 /news/rebornsupportersclubissuerallyingcryletshelpashfordtowninapositivemanner 1 16216 0 0 /news/crockenhill240916 2 19640 0 0 /news/wereoncoursetobeatthedropinsistswhitstablechairman-exclusive 1 15103 0 0 /news/soccershortsbrickiesearlychristmaspresenttofans 1 50126 0 0 /news/kentleague/deal/FAV3rewview121204.html 2 0 0 0 /news/kentleague/hernebay/hernvlords111003.html 1 0 0 0 /news/crayvalley220219 1 16283 0 0 /news/551bc99b60da4 1 2908 0 0 /news/wellingunited090120 2 20097 0 0 /news/551a9718a2588 2 16293 0 0 /news/ebbsfleetconsiderrevertingtopart-timestatus 1 11941 0 0 /news/tunbridgewells0-1greenwichborough-exclusiveinterviews 1 19704 0 0 /news/551a956cbab07 1 4789 0 0 /news/tonbridge190318 2 23464 0 0 /news/5thapr05.html 2 0 0 0 /news/tonbbrom190319 3 61002 0 0 /news/drmartens/eastern/sittingbourne/sittvbash061203.html 1 0 0 0 /news/folkestoneinvicta3-2afcwimbledon-skipperwatsonendsdonskentdominance 1 16708 0 0 /news/551a97b1aa816 1 14695 0 0 /news/itstimetostartrepayingthechairmanonthepitchsayswhitstabletownbossjustinluchford 1 16655 0 0 /news/werebuildingourteamaroundpiscinasaysmoore-exclusive 1 13407 0 0 /news/beckchat161019 1 39180 0 0 /archive-2006-2014/223 1 19716 0 0 /news/folkestoneinvictacancelallhomewarm-upgames 1 13785 0 0 /news/551a99e3dea22 1 13752 0 0 /news/soccershorts090721 2 40149 0 0 /news/hastingsjobisultimatelymylastchancetobeinvolvedinfootballmanagementsaysjohnmaggs 1 14067 0 0 /news/billericaytown3-0tonbridgeangelsariswemustturnthecorner-exclusiveinterviews 1 18987 0 0 /news/dartford240804.html 1 0 0 0 /news/ashfordunitedacceptkentleaguepromotion 1 11483 0 0 /news/bertreturnsfromhisverybriefretirement 1 14341 0 0 /news/timesarehardbutwellcopewithitsaysfolkestoneinvictabossneilcugley 1 15190 0 0 /news/punjab040518 2 18751 0 0 /news/folkvash261203.html 1 0 0 0 /news/drmartens/eastern/dartford/12thsept03.html 1 0 0 0 /news/westkentpairpaytributetofootballlegend 1 12139 0 0 /news/beckenhamtown2-5sportingbengal-myworstresultinfootballadmitsshell-shockedjasonhuntley 1 38569 0 0 /news/binksreshufflewasmysuggestion-exclusiveinterview 1 14476 0 0 /news/soccershorts230619 2 28975 0 0 /news/551bc5e466ed5 1 14155 0 0 /news/deresfanssponsorshipdealisjusttheticket 1 15041 0 0 /news/phoenix130219 2 27165 0 0 /news/551bc99dd3b53 2 81006 0 0 /news/kingstonian1-2ramsgatewardno-oneatramsgatecanscoregoalslikemoexclusive 1 18453 0 0 /news/favershamunveilsoutansigning 1 12905 0 0 /news/humegivesyoungstersachancetoprovetheirworth 1 16799 0 0 /news/phoenix010115 2 27125 0 0 /news/greenwich090817 2 25828 0 0 /news/greenwichborough0-1craywanderers-wejustkeptknockingonthedoorsaysjoefrancis 1 21853 0 0 /news/ticketssellingoutasfansflocktoprincesparkforheroesreturn-exclusive 1 15993 0 0 /news/bromley0-2wellingunited-wedidntgivethefanstheperformancetheydeserved-markgoldberg 1 26546 0 0 /news/hollandsblair2-1beckenhamtown-weshouldbeakentleaguesidesayspaulpiggott 1 23203 0 0 /news/bromley3-0tonbridgeangels-wecangofarinthefatrophywiththissquadsaysmarkgoldberg 1 9261 0 0 /news/favershamtownunveilstadiumsponsorshipdealwithlocalbrewery 1 20469 0 0 /news/wemustapproachtop-of-the-tableclashwiththesamementalityastheothergamessayswatson 1 13611 0 0 /news/tunbridgewells0-1nortonsports-iwantclubstostayawayfromjoesandssaysbentaylor 1 37215 0 0 /news/theboardhavemulledoverthevariouspermutationsthatcouldhaveseenusmovesaysjefftalbot 1 13522 0 0 /news/551a9c926781d 3 44577 0 0 /news/551a97b08cf97 1 12720 0 0 /news/551a97b1988fa 1 15205 0 0 /news/ibelievewewillbeatthedrop-nott 1 15614 0 0 /news/croydon1-1erithtowncroydonwon3-1onpenalties-weshouldvewonbymore-beckingham 1 30207 0 0 /news/ihopewecangetthejobdoneassoonaspossiblesaysfavershamtownbossrayturner 1 15472 0 0 /news/wearereallypleasedwiththeteamwehavesaysmargateassistantstuartcash 1 13402 0 0 /news/soccershortsramsgatestargregorygetsonhisbikeforthanetschoolkids 1 21287 0 0 /news/appiahmakesinstantimpactforfleet 1 12457 0 0 /news/drmartens/eastern/tonbridge/17thaug04.html 1 0 0 0 /news/bromdove171017 2 40097 0 0 /news/551a96db53002 3 31682 0 0 /news/crayburg010423 5 154650 0 0 /news/fixtureswc13thfebruary2006 1 13855 0 0 /news/tunbridgewellssignsixteen-year-oldwonderkid 1 17302 0 0 /news/thereisstillhopethatwecanmaketheplay-offssaysmaidstoneunitedbossjaysaunders 1 17294 0 0 /news/fatrophytriptoilfordgivesusabreakfromthehumdrumoftheleaguesaysmarklane 1 13299 0 0 /news/551a9797c1c8b 2 22224 0 0 /news/margate040416 2 18768 0 0 /news/dartford040919 3 18570 1 1 /news/fordsearchesforbigtargetman 1 15067 0 0 /news/bromley191119 2 22206 0 0 /news/december2009fixtures1-12december2009 1 38965 0 0 /news/kentcounty/15thdec03.html 2 0 0 0 /news/sittvroth030104a.html 1 0 0 0 /news/551a9c928902b 3 48467 0 0 /news/beckenham070918 1 13367 0 0 /news/551bc5df1d866 1 14809 0 0 /news/sevenlydd290116 2 17437 0 0 /news/drmartens/eastern/folkestone/hitchinvfolkefac270903.html 1 0 0 0 /news/lovellplaysthewaitinggame-exclusive 1 13765 0 0 /news/ilikeitbecauseitsgotaringtoanicefacuptiesaystonbridgeangelsbosstommywarrilow 2 21098 0 0 /news/garlandkeepsfaithwithhistwomainstrikers-exclusiveinterview 2 19639 0 0 /news/erithandbelvedere111220 1 16034 0 0 /news/drmartens/eastern/dartford/2nddec04.html 1 0 0 0 /news/wehavetoguardagainstcomplacencysaysnickysouthall 1 15441 0 0 /news/sevenoakstownfightoffcompetitiontosignprolificstrikerrichmondkissi 1 11145 0 0 /news/wellingunited0bromley7exclusiveinterviews 1 19497 0 0 /news/erithbelvedere1-2bromley-consolidationisthewordatthisclubatthemomentsayscollins 1 34139 0 0 /news/bromgills210715 2 34971 0 0 /news/binkspleasedwithgoalscoringform 1 14312 0 0 /southern-counties-east-football-league/28 1 20700 0 0 /news/551a925092c09 2 18509 0 0 /news/canterbury211218 1 12814 0 0 /news/drmartens/premier/welling/17thsept03.html 1 0 0 0 /news/chatham010120 1 16024 0 0 /news/farniebeginsrebuildingfornextseason-exclusiveinterview 1 15019 0 0 /news/humeissuesrallyingcrytomissingfans 1 15089 0 0 /news/nationwide/gillingham/3rdjuly03.html 1 0 0 0 /news/welling210917 1 14303 0 0 /news/battleofthegiantsdartsdidntseetherealuslasttimeinsistsnott 1 23374 0 0 /news/doverreleasefourafterfailingtowinpromotion 2 13831 0 0 /news/erithashf050217 1 37071 0 0 /news/chipnewr140519 2 34866 0 0 /news/whoevercomesfifthwillhavethelowestamountofpointspredictssittingbournesjimward 1 16180 0 0 /news/tobehitwitheliminationsoclosetoacupfinalwasashocktoeveryonesaysandyconstable 1 18172 0 0 /news/551a924fe8a30 2 14440 0 0 /news/whitstabletownfaceraceagainsttimetogetthebelmontreadyintimeforhawksflyingvisit 1 19954 0 0 /news/551a9cf4d4a57 2 14501 0 0 /news/stansmetrogas090515 2 70894 1 0 /news/FAStatement040121 3 29233 0 0 /news/dulwichhamlet050221 1 12639 0 0 /news/sevenoakstown0-6tunbridgewells-wewerethemastersofourowndownfalladmitssimonjones 1 39302 0 0 /news/melkcrow060117 1 30214 0 0 /news/maidstoneunited240119 1 26166 0 0 /southern-counties-east-football-league/35 1 20664 0 0 /news/humepleasedwithstonesleveloffitness 1 12974 0 0 /news/551bc5dc24a9c 2 14111 0 0 /news/gillbemoansaboutlackoftrams-exclusiveinterview 1 13591 0 0 /news/551a9798757ad 1 3892 0 0 /news/551a9250f260d/2ndnov05G.html 2 6643 0 0 /news/dartfordleftinthedark 1 16301 0 0 /news/corinthian130120 1 13616 0 0 /news/iwanttobethebosssayshugolangton 1 19768 0 0 /news/ournexttwohomegamesareveryimportantsaysburman 2 15942 0 0 /archive-2006-2014/119 1 20350 0 0 /news/threerit020922 4 108070 0 0 /news/brickiesreleasecdtocelebrate120yearsoffootball 2 14028 0 0 /news/19thapr05.html 1 0 0 0 /news/sporkent051020 1 35241 0 0 /news/wewanttotargetfifth-placesaysdoverathleticbossnickyforster 1 13308 0 0 /news/matchreportsvickersmakeitthroughtolast32 1 25632 0 0 /national-league/31 2 24110 0 0 /news/fatrophyquarter-finalsletsmakethisweekendsomethingspecialforkentfootball 1 18683 0 0 /news/charltonwomen070618 4 47072 0 0 /news/beckdage151022 3 75492 0 0 /news/drmartens/premier/dover/fgrvdove030204.html 1 0 0 0 /news/ashfordtown2-2waltoncasuals-yourluckrunsoutwhenyouredownthebottomrueslovell 1 16295 0 0 /news/fisher161116 1 16194 0 0 /news/isthmianleague121118 2 23885 0 0 /news/crockenhill070916 3 24057 1 1 /news/551bc5dfb0d97 1 13909 0 0 /news/sittingbourne3-1croydonathletic 1 14918 0 0 /news/ashford271115 1 12038 0 0 /news/hernwhit010120 2 75191 0 0 /news/ifeelitsabitofacouptoattractsuchayoungtalentsayswhitstablebossjustinluchford 1 12772 0 0 /news/thamesmeadtown2-0tunbridgewellsmcmahonwereoneofthreetowinleaguetitle-exclusive 1 17761 0 0 /news/soccershorts080723 4 52171 0 0 /news/sladegreenunveilgroundimprovements 1 10658 0 0 /news/cugleybringsinaustin 1 12663 0 0 /news/fastatement90118 2 30691 0 0 /news/fleetdown140717 1 14371 0 0 /news/soccershortsjohnbealespensnewcontracttostayatmargate 1 17963 0 0 /news/weneedeverybodysigningfromthesamehymnsheetsayswarrilow 1 22977 0 0 /news/canterburycityfc.net 1 0 0 0 /news/staines291005.html 1 0 0 0 /news/isthmianLeague170320 2 24711 0 0 /news/aldershottown1-1ebbsfleetunited-queseraseraweregoingtowembleykent 1 18641 0 0 /news/fisher310818 1 11759 0 0 /news/gillingham290615 1 12241 0 0 /news/wereluckyenoughthatwevegottwochancesofmedalssaystunbridgewellsbossmartinlarkin 1 16541 0 0 /news/551bc99dbe7a4/conference/margate/kentleague/whitstable/18thsept03.html 2 15653 0 0 /news/margate140518 2 28271 0 0 /news/thamesmeadtown1-2maldontiptree-wejustdidntperformadmitskeithmcmahon 1 22434 0 0 /news/theresnoreasonwhywecantgetpromotedsayshogg-exclusive 1 16746 0 0 /news/28thsept05.html 1 0 0 0 /news/551a9c9214377 2 21039 0 0 /news/2ndsept04.html 2 0 0 0 /news/11thaug03.html 1 0 0 0 /news/drmartens/premier/welling/26thoct04.html 2 0 0 0 /news/braithwaitewilladdpositiveimpression 1 11522 0 0 /news/ithinkwerebetterthanamid-tablesidesayswoodstocksportsassistantscottappleton 1 13060 0 0 /isthmian-league/59 3 42518 0 0 /news/greenwich181016 2 24056 0 0 /news/wemustgetbacktowinningwaysathomesaysmiles-exclusive 1 13587 0 0 /news/bournewilltightenupourdefencesaysabbott 1 14150 0 0 /news/crockenhill010715 2 19109 0 0 /news/wefeelwevenotplayedconsistenltywellfor90minutessaysneilcugley 1 14442 0 0 /news/551a9c92bf445 2 20875 0 0 /news/folkestoneinvicta0gillingham2cugleysdelightedwithfirstouting 1 15511 0 0 /news/hopefullypeoplearestartingtohearofussaysbridonropesmanagerbenkotey 1 19471 0 0 /news/tonightsfixtures27thfebruary2006 1 14816 0 0 /news/551bc5e41fd98 1 15726 0 0 /news/wealdstone0-1margate-thecommitmentwasjustfantastictonightsaysproudbossiainoconnell 1 25428 0 0 /news/margate270323 2 26059 0 0 /news/daishsplashesthecashongash 1 12455 0 0 /news/thisisanewchapterforhythetownfootballclubsaysmanagerscottporter 1 17135 0 0 /news/fisherit270922 4 149686 0 0 /news/whit250515 2 32259 0 0 /news/dartford2-2molesey-sampsonssideopenprincesparkexclusiveinterviews 1 20524 0 0 /news/ramsgate140319 2 24293 0 0 /news/weregoingforthatfinalspotsaysburton-exclusive 1 12710 0 0 /news/suttlark020422 4 131402 0 0 /news/551a9c9154f73 3 28162 0 0 /news/551a99e34fb29 1 11959 0 0 /news/hernebayreceive5000granttodeveloptheircommunityaspirations 1 15166 0 0 /news/kentleague/lordswood/30thsept03.html 1 0 0 0 /news/ramsgate0-3bishopsstortford-alliaskisforconsistency-ward 1 24770 0 0 /news/seageraddsmorequalitytohissquad 1 16305 0 0 /news/551bc99d39af9 2 19626 0 0 /news/551bc99dbe7a4/drmartens/eastern/tonbridge/ryman/bromley/10thnov03.html 2 15653 0 0 /news/ashford170905.html 1 0 0 0 /news/551bc99dbe7a4/drmartens/eastern/ashford/conference/gravesend/2ndjuly03.html 2 15653 0 0 /news/cugleylookstoremovestaines 1 15080 0 0 /news/bowey310105.html 1 0 0 0 /news/kentleague/ramsgate/3rddec04.html 1 0 0 0 /news/erithwhyt230817 1 32371 0 0 /news/keepingussafefromrelegationisthemainaimthisyearsaysfisherbossdeanharrison 2 27398 0 0 /news/erithtown110517 1 12015 0 0 /news/25thmay05.html 1 0 0 0 /news/whitstable140318 1 12789 0 0 /news/crayvalleycouldbeadarkhorsesaysvickersbossrickybennett 1 15113 0 0 /news/kentleague/sevenoaks/18thaug04.html 1 0 0 0 /news/folkestoneinvictapairwinningtheirbattlestogetfit 1 14740 0 0 /news/tonbridgeangels2-1hendon-wereimprovingwitheverygamesayswarrilow 1 19160 0 0 /news/ksports090218 1 12516 0 0 /news/doverlegenddixonreturnstocrabble 1 13545 0 0 /news/maidstoneunited4-1dartford 1 18492 0 0 /news/tonyrussellisnotgoingintotherymanpremiertobeanalso-ransaysvickerschairmangaryrump 1 21421 0 0 /news/folkestoneinvicta3-2billericaytown-saundersisalegendsayscugley-exclusive 1 21336 0 0 /news/551bc5e575781 1 14447 0 0 /news/johnullmankentseniorcupsemi-finaldraw 1 10893 0 0 /home/wp-content/themes/seotheme/ 1 13870 0 1 /news/thekentwomenscupisthemaintrophywesetoursightsonsaysgillinghambossjamesmarrs 1 18084 0 0 /news/drmartens/eastern/ashford/27thsept04.html 1 0 0 0 /news/tonbridgeangelsvice-chairmanquitsduetohealthscare 1 12764 0 0 /news/nuneatontownunveilliamdaishastheirnewboss 1 16592 0 0 /news/whyteleafe0-4erithbelvedere-ialwaysknewitwouldgodowntothewiresaysmickycollins 1 28099 0 0 /news/551a931e133a2 2 27110 0 0 /news/dawsonstartsknockingonmcmahonsdoor 1 13811 0 0 /news/sladegreenmakedoubleswoopasfansflocktoseelittlesreturn 1 13728 0 0 /news/drmartens/eastern/sittingbourne/9thsept04A.html 1 0 0 0 /news/maidstoneunited0-3histon-wedidntdeservetoloselikethatsaysproudhume 1 17790 0 0 /news/thechairmansambitiousandwantstomovebearstedforwardsaysbosstonycornwell 1 15243 0 0 /news/backingthefleettowembleyglorygettingtowembleyagainwillbeagreatachivement-lovell 1 13662 0 0 /news/sctmer120916 2 44095 0 0 /news/fisherfarn300716 1 34427 0 0 /news/551bc5e810bd1 2 18922 0 0 /news/craywandererslaunchacademyset-up 1 12731 0 0 /news/wemusttreatstrugglingsideswithrespectsaysburman 1 30920 0 0 /news/maidstone270618 1 12536 0 0 /news/iwillcontinueasfirstteammanagersayslewishamboroughchairmanraysimpson 1 14804 0 0 /news/transfernewstalksaregoingwellwithmyhigherleaguetargetssaysburman 1 17479 0 0 /news/tonbridgeangels2-2maidstoneunited-fansbehaviourmarspulsatingderby 1 20538 0 0 /news/lewbri020316 1 36307 0 0 /news/margatesearchforanothernewmanagerasbutlerresignsafter12leaguegames 1 12505 0 0 /news/championshessenthalersalutesheroesondoverathleticsspecialday 1 13113 0 0 /news/dover170816 1 12324 0 0 /news/drmartens/eastern/erith&belvedere/wingatefinchley301004.html 1 0 0 0 /news/bromley071218 2 15578 0 0 /news/weretryingtomakeoxfordroadourhomesayssevenacresidcupbossleehill 1 16026 0 0 /news/burmandemandspositiveresponseafterwarewake-upcall-exclusive 1 14058 0 0 /news/551bc99dbe7a4/drmartens/premier/dover/drmartens/eastern/fisher/28thaug03.html 2 15653 0 0 /news/551bc5e06cf86 3 39772 0 1 /news/551bc5ddf096b 1 12081 0 0 /news/551bc5db226f6 4 44998 0 0 /news/craydart051016 3 75185 0 0 /news/551bc99dbe7a4/drmartens/eastern/ashford/ryman/bromley/bromvmarl171203.html 2 15653 0 0 /news/dembeleinaustralia250619 3 38648 0 0 /news/burmanwemustcutoutthemistakesandshowconsistency 1 13814 0 0 /news/backingtheboystofavaseglory 1 10642 0 0 /news/eastthurrock280305.html 1 0 0 0 /news/kennington130919 1 12937 0 0 /news/beckenhamtown6-2miltonathletic 2 15844 0 0 /news/551bc5e864f4c 1 12334 0 0 /news/othernews/3rdmar04.html 1 0 0 0 /news/551bc5e08ee57 1 19272 0 0 /news/ihonestlybelievewewilloutgrowalotofteamsinacoupleofyearstimesayssteveoboyle 1 16465 0 0 /kent-county-league/6 3 40665 0 0 /news/resultsaugustseptember2020 3 101596 0 0 /news/kentleaguelatestseagercollectshissecondaward 1 16838 0 0 /news/chathamtown220523 3 38665 0 0 /news/Stainfolk120418 3 74261 0 0 /kent-invicta-league/www.heineken.co.uk/www.heineken.co.uk/ 1 4529 0 0 /news/phoenixsports1-2suttonathletic-ithinkthatstheperfectseasonsaysjamescollins 1 31186 0 0 /news/erithbelvedere5-1frimleygreen-wewanttostayinthevaseforaslongaswecan-collins 1 27161 0 0 /archive-2006-2014/95 1 20285 0 0 /news/fisher3-2dagenhamredbridge-wewoulddearlyliketokeepdanyoungheresayslisney 1 26686 0 0 /news/holmesdale290718 2 16270 0 0 /news/551bc99dbe7a4/ryman/bromley/othernews/27thjune03.html 2 15653 0 0 /news/whitstabletown3-2corinthian-casuals-wemustcomeoutontopinourmini-leaguesaysseager 1 18015 0 0 /news/thetabledoesntlie-wehaventequippedourselveswellattimesadmitsderesbossmickycollins 1 17684 0 0 /news/wemustmaintaintherightattitudetoavoidgiantkilling-hessenthaler 1 13749 0 0 /news/doverathleticunveilhessenthalerastheirnewmanager 1 13370 0 0 /news/mattletissiergivesnon-leaguedaythethumbsup 1 15145 0 0 /news/controversyattractstheattention 2 14270 0 0 /news/angelssignsecondwingertoenhancepromotionbid-exclusive 1 15265 0 0 /news/dartford041116 2 17759 0 0 /news/551a9c91822cc 3 84973 0 0 /news/sctelms160819 1 32479 0 0 /news/wellingunited140121 1 12476 0 0 /news/551bc5d937248 4 31012 0 1 /news/551bc99c627d0 2 26046 0 0 /news/551bc5e5e0ea0 1 12685 0 0 /news/drmartens/premier/welling/10thoct04.html 1 0 0 0 /news/sevechic281023 4 103367 0 0 /news/drmartens/eastern/folkestone/northwood161004.html 1 0 0 0 /news/wembleywinnersweregettingbacktonormalitynowsaysfleetsecretary 1 12362 0 0 /news/drmartens/premier/welling/24thoct03.html 1 0 0 0 /news/beckenham090120 1 12811 0 0 /news/551bc99c7aa6e 2 26040 0 0 /news/phoenixsports3-0holmesdale-clubshardworkhasbeenpaidoffsayssteveoboyle 1 32629 0 0 /news/NationalLeagueStatement060421 2 17560 0 0 /news/snodlandtown231010 1 11556 0 0 /news/bromley150718 2 17186 0 0 /news/wellbefightingfitfortheseasonaheadinsistsjenkins 1 19277 0 0 /news/kentleague/sladegreen/vcd110904.html 1 0 0 0 /news/551a9798b2c12 1 4908 0 0 /news/bromley0-2maidenheadunited-werelivingoffthestartoftheseasonalittlebitadmitsbird 1 23094 0 0 /news/iwanttojumpstraightbackintothestrainsofmanagementsaysaxedkevinharris 1 13269 0 0 /news/maidstoneunited1-2dartford-burmanwevestartedtobelieveinourselvesagain 1 16307 0 0 /news/551a925107b43 2 24114 0 0 /news/hytheheroestakethebullbythehornsandbecomefacuplegends 1 26075 0 0 /news/wedonthaveacrisisatthamesmeadinsistsmcmahon-exclusiveinterview 1 14542 0 0 /news/vice-chairmanstepsdownasclubgoesfromonecrisistoanother-exclusive 1 16486 0 0 /news/wellhavearightgoatcraywanderersandhopetheyhaveanoffdaysayserithtownbossrussell 1 18066 0 0 /news/erithandbelvedere300819 1 12646 0 0 /news/therefereewasrighttocallitoffsaysmargatebossiainoconnell 1 15553 0 0 /news/erithtown1-1corinthian-idlovetoplayfinalonebbsfleetscarpetsaysmattlonghurst 1 26492 0 0 /news/everybodyattheclubhasbeenfantastichailsdealtownbossderekhares 1 16031 0 0 /news/15thnov05.html 1 0 0 0 /news/hornfolk010919 2 51090 0 0 /news/ebbsfleetunited3-1farsleyceltic-letsfinishoffthejobsaysdaish 1 19472 0 0 /news/gotanynews 1 10095 0 0 /news/bravewalkertargetsdaggersvisitforhisreturn 1 12466 0 0 /news/551a979824bfd 2 18961 0 0 /isthmian-league/17 3 45932 0 0 /news/3rdmar04.html 1 0 0 0 /news/551a9c0f37001 2 26571 0 0 /news/ryman/bromley/bromvdartfordfac.html 1 0 0 0 /news/favershamtown1-4whitstabletown-itsdefinatelyoneofthehighlightsoftheseason-southall 1 33081 0 0 /news/551a97b25c05e 1 16301 0 0 /news/gillinghamreleaseformerdoverathleticstrikeradambirchall 1 13658 0 0 /news/hollandsblair4-4ramsgate3-4pens-theygavemeeverythingsaysproudpaulpiggott 1 35802 0 0 /news/craywanderers1-1sittingbourne-idbeguttedifwedontmakeplay-offs-abbott 1 20768 0 0 /news/crayvalley090218 2 17378 0 0 /news/suttonathletic060422 1 13236 0 0 /news/sittingbournesfinancesarenowstretchedtoalmostbreakingpoint 1 18321 0 0 /news/551bc99e45bdd 2 18164 0 0 /news/imhappywithmyreducedbudgetsaysward 1 17404 0 0 /news/551a97b0ddf6f 2 28538 0 0 /news/ibeleivewewillgettowembleysayshernebaystrikerbyronwalker 1 18351 0 0 /news/tonbridgeangels1-2doverathletic-warrilowblastsrefashissidelosecontroversialbattle 1 23243 0 0 /news/lordswood220218 1 13062 0 0 /news/ashfordtownunveilgillmancapture 1 12495 0 0 /news/whitstabletown1-0redhill-seagerkeenonsecuringmunday 1 19727 0 0 /news/wp-content/plugins/project/css.php 2 0 0 0 /archive-2006-2014/9 3 45000 0 0 /news/551a97190dfa2 3 32186 0 0 /news/iwantthissidetobethebesterithtownsidesaysmanagertonyrussell 1 18919 0 0 /archive-2006-2014/175 1 18948 0 0 /news/resultsjanuary2015 1 75621 0 0 /news/9thsept04A.html 1 0 0 0 /news/warrilowtellsrivalmanagersberespectfulwithyourteamselections-exclusive 1 17265 0 0 /news/wehavetomakesurewefocusontheleaguenowsaysbeckenhamtownbossjasonhuntley 1 14458 0 0 /news/fisher0-5tunbridgewells-wewerentattheracestonightfumesfisherbossgarylisney 1 25658 0 0 /news/551bc5ddafd7c 1 13139 0 0 /news/margatelookingtobounceback 1 16447 0 0 /news/craywands180817 3 32391 0 0 /news/wemustputpressureonthesidesaboveusinsistslangton 1 12524 0 0 /archive-2006-2014/265 2 23451 0 0 /news/maidstoneunited1-0bognorregistown-thestonesarestayingup 1 22077 0 0 /news/hugolangtoninvitesyoungsterstojoinhisfootballapprenticeshipscheme 1 14078 0 0 /news/ithinkwellholdourownandouraimistofinishashighaswecansaysdealbossderekhares 1 14142 0 0 /news/splitloyaltiesforsuttonsvisittoangels 1 14489 0 0 /news/iveseentheclubgrowoverthelastcoupleofyearssayscrayvalleybossstevechapman 1 17216 0 0 /news/othernews/29thjune03.html 1 0 0 0 /news/dulfav100117 2 69937 0 0 /news/soccershortswellenjoytop-spotbecauseitwontlastadmitslangton 1 31278 0 0 /news/30thapr04.html 1 0 0 0 /news/seagerfearsthedropasmistakesprovecostly-exclusive 1 22808 0 0 /news/551a9bafdc65a 3 27878 0 0 /news/fixtures6-11march2006 2 26648 0 0 /news/eastgrinsteadtown070222 2 23447 0 0 /news/ryman/24thjune03.html 1 0 0 0 /news/weresteppingintotheunknownsaysdartfordcoachjohnmacrae 1 16440 0 0 /news/551a97b103cf5 2 27946 0 0 /news/ticketssellingfastforcharltonsvisittodarts 1 13048 0 0 /news/flanaganaimingformidtable 1 19170 0 0 /news/551bc99dbe7a4/kentleague/sladegreen/kentleague/sevenoaks/16thaug03.html 2 15653 0 0 /news/kentleague/whitstable/4thjuly04.html 2 0 0 0 /news/soccershorts080719 2 25528 0 0 /news/tunwells300617 1 12657 0 0 /news/glebe130919 1 11481 0 0 /archive-2006-2014/154 1 19288 0 0 /news/canterbury080917 1 12530 0 0 /news/hernebay0-3hayesyeadingunited-wemissedourchanceonsaturdayadmitsproudlillis 1 18588 0 0 /news/vineswillsettlehisfuturebymonday-exclusive 1 13605 0 0 /news/soccershortsashfordunitedsnapupprolificstrikerstuartzanone 1 25795 0 0 /news/burtonsfuturehangsinthebalance 2 21815 0 0 /news/551bc5e207db2 1 15299 0 0 /news/551a9c0e51e3e 2 14089 0 0 /news/ithinkthepressurewillbeonphoenixtowinratherthanussayssevenacrebosschristuley 1 14110 0 0 /news/wehavetobetakenabitmoreseriouslysayscorinthianbossjamescollins 1 13503 0 0 /news/greenwichborough1-2southpark-thugstarnishsouthparksfacupupsetoverboro 1 51660 0 0 /news/cugleytoldtomaintainfolkestonesrymanleaguestatus 1 15054 0 0 /news/ireallydothinkwecanbeatthemsaysdoverathleticbosschriskinnear 1 19079 0 0 /news/rymanonesouthchampionshumepraisesallofhiselevencaptains-exclusiveinterview 1 15153 0 0 /news/sctelms40817 2 36267 0 1 /slade-green-2003-2006 14 186700 1 2 /news/parmenteriwilltakemytimetogettherightman 1 12969 0 0 /news/anyonewhocomesinmustbetherightfitfortheclubsayslewishamboroughchairmanraysimpson 2 18629 0 0 /news/workbeginsonmaidstoneunitedsnewstadium 1 13182 0 0 /news/kentcounty/21stsept03.html 1 0 0 0 /news/maidstone260719 1 11115 0 0 /news/werelookingtoimproveandtowinthingssaysmargateplayer-assistantjohnkeister 1 17237 0 0 /news/551bc5e35f167 1 14175 0 0 /news/greenwich221215 2 18500 1 1 /news/sladegreenunveiltheirnewmanager 1 12437 0 0 /news/ryman/bromley/bromvworth140204.html 1 0 0 0 /news/551a979a9cd34 1 5118 0 0 /news/ashfordtown2-1eastbournetown-wegotluckyadmitslovell 1 17278 0 0 /archive-2006-2014/233 1 19525 0 0 /news/wearestartingtoplaysomeattractivefootballsayserithtownbossenniogonnella 2 17331 0 0 /news/croyath040317 1 12490 0 0 /news/ihavedonealotintermsofkeepingtheclubafloatsaysbromleybossmarkgoldberg 1 13377 0 0 /news/551bc99dbe7a4/drmartens/eastern/sittingbourne/kentleague/greenwich/20thjuly03.html 2 15653 0 0 /news/sctlew130317 1 37047 0 0 /news/bromley090815 3 26987 1 1 /news/beckenham131104.html 1 0 0 0 /news/areyoulookingformorepublicity 2 14080 0 0 /news/holmesdaleskentleagueaspirationsareinmemberclubshands-exclusive 1 12217 0 0 /news/551bc99b9da23 2 14646 0 0 /news/warrilowhits-backatmindlessforumjibes-exclusive 1 17350 0 0 /news/margate220518 2 23257 0 0 /news/dontpanicwerestilloncoursetowintitlewith100pointssayshessenthaler 1 17555 0 0 /news/daishmembersshouldvotetosellstarstrikergash 1 12772 0 0 /news/charltonathletic071020 3 30613 0 0 /news/kentishrivalsrelishingthetieoftheround 1 18914 0 0 /news/wardfeelsaprehensiveaheadofkscupclash-exclusive 1 15147 0 0 /news/beckenham250118 1 12969 0 0 /news/cantnewp060119 1 33309 0 0 /news/hollands010516 1 17012 0 0 /news/kentleague/sevenoaks/hernebay201104.html 1 0 0 0 /kent-invicta-league/9 3 42745 0 0 /news/crayvcda280120 3 80996 0 0 /news/ebs.php7 1 0 0 0 /news/14thfeb04.html 1 0 0 0 /news/ashfordfacetoughtestinfrontofthetelevisioncameras 1 13180 0 0 /news/551bc5e15eff1 1 13261 0 0 /news/daishdowntobarebonesformorecambetrip-exclusive 2 15360 0 0 /news/dartfordsignstrikerlewissmithfromafchornchurch 1 11963 0 0 /news/phoenix160917 2 22758 0 0 /news/tonbridgeangels0-2bromley-warrilowruesfinanciallossfollowingfacupexit 1 27685 0 0 /news/20thdec05.html 1 0 0 0 /news/stanerit031222 4 136442 0 0 /news/551bc99dbe7a4/ryman/bromley/kentleague/maidstone/maidvlord271203.html 2 15653 0 0 /news/elthamstansfeld2880816 1 15090 0 0 /news/551bc5e1abf56 1 14039 0 0 /news/whitstabletown1-2margateseagerthanksforshowingusrespect 1 20337 0 0 /news/glebe040920 1 14519 0 0 /news/farleypleasedwithhiscomeback-exclusive 1 14263 0 0 /news/551bc99d4816e 2 28324 0 0 /news/canterbury050715 1 12490 0 0 /news/bromley220715 2 20937 0 0 /news/tenyearsofwembleymemoriesiwillfightmywaybackintofootballvowssampson 1 28488 0 0 /news/daishurgesallkentfanstowatchhisside-exclusiveinterview 1 16180 0 0 /news/551bc5e478069 1 10334 0 0 /news/folkestoneinvicta220722 2 29263 0 0 /news/kentfootballunited170920 1 16640 0 0 /news/Faversham130615 3 31415 0 0 /news/10thfeb05.html 1 0 0 0 /news/alfa-rex.php 1 0 0 0 /news/hessenthalerexpectsfireworksagainstarch-rivals 1 14916 0 0 /news/whitstabletown1-0merstham-threepointstodaywereoffgreatrewardadmitspeternott 1 24256 0 0 /news/whitstablecharitycupfallsvictimtotheweather 1 11332 0 0 /news/24thdec04.html 1 0 0 0 /news/dulwichhamlet1-1ashfordtown-wewouldntswapanyofourplayerssayslangton 1 17720 0 0 /news/margate041217 1 15026 0 0 /news/551a97b28f663 1 14367 0 0 /news/ramsgate011123 7 105116 1 1 /news/myplayerswanttheirnamesinthepaperssaysdartfordbosstonyburman 1 15325 0 0 /news/margateexpectedtobewithoutmckimmagainstlocalrivals 1 12188 0 0 /news/tonvsitt060304.html 1 0 0 0 /news/charlton080805.html 1 0 0 0 /news/avevcd310317 3 70517 0 0 /news/stowgleb110120 1 34020 0 0 /news/huggingsleavesvcdtosignformargate 1 15819 0 0 /news/angelsinheavenwemustlivewithinourmeansinconferencesouth-tommywarrilow 1 16776 0 0 /news/maybewellhaveourdaymaybeourdayisthisyearbutletsgetpastsuttonfirst-neilsmith 1 16075 0 0 /news/wewillcomebackstrongerinsistsupbeatschulz 1 14182 0 0 /news/werekeepingourheadsabovewatersaysmargatedirector 1 17418 0 0 /chatham-2003-2006 14 173176 0 0 /news/vcdeast050116 2 58798 0 0 /news/rochesterunited140122 1 11558 0 0 /news/crowborough270117A 1 14210 0 0 /news/551bc5e32e879 1 14359 0 0 /news/weneedexperiencetowinthekentleaguetitlesaysporter 1 17503 0 0 /news/551bc5e37d15f 1 12758 0 0 /news/chessington240704A.html 1 0 0 0 /news/folkestonewanttoshineinfrontoftelevisioncameras 1 16332 0 0 /news/resultsjanuary2020 2 98244 0 0 /news/tonbridgebossestalktothefans 1 14753 0 0 /news/itstimefordovertogettowembleysayshessenthaler 1 17874 0 0 /news/ramssitt190119 3 82364 0 0 /news/551bc99dbe7a4/drmartens/eastern/ashford/drmartens/eastern/dartford/1Jan2004.html 2 15653 0 0 /news/corinthian040818 1 13910 0 0 /news/ramsgate1-2afchornchurch-ourbigplayersdidntturnupadmitsward 1 18139 0 0 /news/wevesetastandardandwevegottokeepitsaysjustinluchford 1 14231 0 0 /news/wewontbreakthebankinsistsdartsbossburman 1 11547 0 0 /news/whyteleafegivengo-aheadtolay3gpitchatchurchroad 1 15505 0 0 /news/facupshowdownathytheisofftheradarinsistsproudluchford 1 18546 0 0 /news/arsenalcelebscometosittingbourne 2 13749 0 0 /news/wecanputaspannerintheworksforotherteamssaysramsgatebossjimward 1 14732 0 0 /news/551a9250906a5 2 18941 0 0 /news/tonbridgeangels2-2hastingsunited-refereeshouldbeofficiatingapubside-fumeswarrilow 1 39527 0 0 /news/greenwich100616 3 31851 0 0 /archive-2006-2014/111 1 20528 0 0 /news/wecangetoutoftherelegationmireinsistsdanstubbs 1 19789 0 0 /news/rymankingsclinchtitleivelearntalotintwoyearssaysburman 1 21391 0 0 /news/551bc5de9c412 1 12905 0 0 /news/551bc99dbe7a4/drmartens/eastern/dartford/kentleague/VCD/29thjune03.html 2 15653 0 0 /news/stonesreleasetwotocutbacktheirbigsquad 1 11746 0 0 /news/yougettheoddgeminsundayfootballandthisistheirchancetojoinramsgatesaystimdixon 1 12764 0 0 /news/tunbridgewells1-3erithbelvedere-farniesheawillbesnappedupbyaproclub-exclusives 1 22350 0 0 /news/551bc5e88c573 1 15702 0 0 /news/erithandbelvedere010320 1 13526 0 0 /news/doverathleticfreezethecostofseasontickets 1 13041 0 0 /news/maidstoneunited0-1afcwimbledon-wegaveitourallsaysaproudhume 1 19662 0 0 /news/thamesmead260405.html 1 0 0 0 /news/ebbsmcmahon280415 3 20321 2 2 /news/resultsnovember2018 2 96087 0 0 /news/sevedart060719 3 61518 1 1 /news/tommywarrilowsnapsuplong-termtargetcurtisujah 1 18825 0 0 /news/tunbridgewells1-2corinthian-wayneburnetthasbeenabitofamentortomesaysmattlonghurst 1 31358 0 0 /news/itsatwo-yearplantobechallengingorthetitlesayscanterburycitybosssimonaustin 1 15073 0 0 /news/cobbsservessuspensionfortriptoleagueleaders 1 12162 0 0 /news/551a979a2516e 1 5019 0 0 /news/conference/margate/31staug04.html 1 0 0 0 /news/weneedinvestmenttotakeustothenextlevelsaysmcmahon 1 21185 0 0 /news/lackofraininhernebaycausespostponement-exclusiveinterview 1 14512 0 0 /news/551bc99dbe7a4/drmartens/eastern/sittingbourne/drmartens/eastern/folkestone/10thjuly03.html 2 15653 0 0 /news/dartford4-5aveley-burmanourdefendingwasappalling 1 18114 0 0 /news/wejustneedtokeepprogressingsaysthamesmeadbosskeithmcmahon 1 17998 0 0 /news/margate280621 2 23599 0 0 /news/551a931dd2b85 1 14750 0 0 /news/sittingbourne2-2crowboroughathletic-abbottwemuststopgivingsillygoalsaway 1 20040 0 0 /news/551a9678ce029 3 42948 0 0 /news/sloughtown0-2folkestoneinvicta 1 14655 0 0 /news/crayhast120322 6 154930 0 0 /news/tunbridgewells140122 1 13261 0 0 /news/551bc5e0afe98 1 21211 0 0 /news/vcdathletic1-0eastbournetownweveknockedoutaverygoodsideadmitsfordexclusive 1 16521 0 0 /news/fisher310517 1 15058 0 0 /news/punjab310820 1 12639 0 0 /news/stoneschairmancallsforsupportwithnewstadium 1 14215 0 0 /news/curtisrobinsonscoopsdoubleawardatmargate 1 13391 0 0 /news/soccershorts300516 2 31562 0 0 /news/theashfordsupportersdeservefootballathomelandssayspaulbowden-brown 1 18415 0 0 /news/lewesvbrom160304.html 1 0 0 0 /news/kentinvictaleaguewillstrengthenthestructureofkentfootballsaysbearstedsecretary 1 13578 0 0 /news/551bc99dbe7a4/nationwide/gillingham/othernews/6thoct03.html 2 15653 0 0 /news/dartford1-0ebbsfleetunited-dartfordcandowellinthiscompetitionsayscoachjasonlong 2 38958 0 0 /news/seagersaysksgiantkillingishesbestaswhitstablemanager 1 17315 0 0 /news/chatham050516 3 30098 0 0 /news/ashfordunited080621 3 33324 0 0 /news/maldon020405.html 1 0 0 0 /news/pennockruesmissedchances 1 12877 0 0 /news/facupspecialwemustembraceourchancetoreachthefirstroundinsistsdolby 1 23903 0 0 /news/whitstablevdeal250803.html 2 0 0 0 /news/FairGame090921 2 19716 0 0 /news/551a931e756f7 2 40672 0 0 /news/ourmaintargetisatopfourfinishsayskentfootballunitedbosssammacneil 1 14723 0 0 /news/551bc5dee4f4d 1 14119 0 0 /news/551a95b3dbf43 3 35923 0 0 /news/15thaug03.html 1 0 0 0 /news/faversham120720 3 28902 0 0 /news/wellingunited110520 1 10958 0 0 /news/wehavesurprisedafewpeoplethisyearsaystonbridgeangelsbosstommywarrilow 1 16450 0 0 /news/551bc99e61a50 2 22184 0 0 /news/drmartens/eastern/fisher/16thnov04.html 1 0 0 0 /news/hythetown3-2ramsgate-itwaspleasingtobouncebackafterthefolkestonegame-scottporter 1 23231 0 0 /news/ramsgate1-3hamptonrichmondboroughwardbemoanesnear-postfrailities 1 15602 0 0 /news/cupisnotourprioritysaystable-toppinghume-exclusiveinterview 1 16992 0 0 /news/dartfordwerejusttoogoodforusadmitsseager 1 11874 0 0 /news/maldon301004.html 1 0 0 0 /news/wellgotoeastbournewithoureyeswideopensayscorinthianbossmattlonghurst 1 17688 0 0 /news/hernchic241020 5 141730 0 0 /news/kieronmccann100121 2 25817 0 0 /news/ashfordtown2-1metropolitanpolice 1 19308 0 0 /news/folkestone020618 2 27754 0 0 /news/crowborough120618 1 12694 0 0 /archive-2006-2014/186 1 19393 0 0 /news/lyddpunj010918 1 41723 0 0 /news/wevehadturmoilattheclubwithalossofasponsorsaysthamesmeadtownbosskeithmcmahon 1 15344 0 0 /news/drmartens/eastern/chatham/17thoct03.html 1 0 0 0 /news/fleetchairmanissuesrallyingcryforcountywidesupport-exclusive 1 18501 0 0 /news/551a96dbd03c8 3 27403 0 0 /news/ihavenoideawhatthefutureholdsforgreenwichboroughsaysholmesdalechairmanmarkharris 1 13586 0 0 /news/erithandbelvedere090422 1 13950 0 0 /news/redhill300122 5 74080 0 0 /news/whytefowler270415 2 32778 0 0 /drmartens/premier/welling/2ndjuly05.html 1 9955 0 0 /news/551a9250b0b91 1 4132 0 0 /news/myplansfortunbridgewellsweretotallyhonourablesaysex-englandstar 1 12095 0 0 /news/wp-content/uploads/typehub/custom/a57bze8931/.__a57bze8931.php 1 0 0 0 /news/hernebay0-2ramsgate-itsprobablyoneofourworstperformancesof2013admitstimdixon 1 26088 0 0 /archive-2006-2014/78 1 20623 0 0 /news/deresbidforcountycupdouble 1 14047 0 0 /news/drmartens/eastern/sittingbourne/sittvking240104.html 1 0 0 0 /news/551a95b4747b8 2 19127 0 0 /news/551a956b86fc7 2 23605 0 0 /news/numbercruncherabbottdreamsoffolkestonecupclash 1 19004 0 0 /news/551a96db8926e 1 4923 0 0 /news/brombore101115 2 31653 0 0 /news/ebbsfleetunited2-1burtonalbion-fleetarethelifeandsoleoftheparty 1 20984 0 0 /news/bromley2billericaytown2 2 18240 0 0 /news/wewouldlovetogiveourloyalfanssomethingtoreallyrememberthisseasonsaysjohnovard 1 14251 0 0 /news/statement010320 1 13688 0 0 /news/playingwilliamsisnotaproblemsaysabbott 1 15028 0 0 /news/whitstablepaytributetobeatenbears-exclusiveinterviews 1 15036 0 0 /archive-2006-2014/255 1 19100 0 0 /news/thamesmead021015 2 30978 0 0 /news/vcdrussell080415 2 28005 0 0 /news/tunwcroy290815 2 64925 0 0 /news/fatrophywinnerneilbarrettreturnstothefleet 1 12192 0 0 /news/ifyouwanttoachievesomethingandyouworkhardenoughyoulldoitsaysmargateboss 1 19279 0 0 /news/wevegotagoodchanceoffinishingquitehighsayswellsbossmartinlarkin 1 15609 0 0 /news/preseason270718 2 80934 0 0 /news/ryman/bromley/bromvstai041103.html 2 0 0 0 /news/551bc5e44abc3 1 12912 0 0 /news/bromley200619 2 16423 0 0 /news/ifwegettheperformancesrighttheresultswillpickupsayswhitstablebossjustinluchford 1 12977 0 0 /news/551bc5e7046df 1 21069 0 0 /news/wewanttomakehistoryforthegillssaysskipperjayblackie 1 22279 0 0 /news/27thnov03.html 1 0 0 0 /news/551a9718c2fb8 2 15655 0 0 /news/chelmsfordcity1margate0 2 17276 0 0 /news/thecenturyclub 1 11677 0 0 /news/wearemilesoffconcordsbudgetrevealsfoley 1 13996 0 0 /news/551bc5dfc08f0 1 14994 0 0 /news/hollands220219 1 13391 0 0 /news/margate010223 2 26185 0 0 /news/oneofthesedayswellgetahatfulofgoalswarnsbromleybossmarkgoldberg 1 12772 0 0 /news/sittingbournesnapupomogbehin-aplogogytosittingbournefc 1 16081 0 0 /news/551a9718b3759 3 25332 0 0 /news/erithbelvedere3-2greenwichborough-imnotpleasedwiththeperformancesaysmickycollins 2 33563 0 1 /news/kentleague/hythe/26thjuly04.html 1 0 0 0 /news/daishappealstokeepstarsatclub 1 16924 0 0 /archive-2006-2014/164 1 18794 0 0 /news/lyddtownfc.co.uk 1 0 0 0 /news/sittingbourne1enfield0 1 14620 0 0 /news/lordswood041217 1 13311 0 0 /news/551a95b423fd1 3 45006 0 0 /news/ryman/bromley/7thnov03.html 2 0 0 0 /news/binkshailsthereturnofdenness 1 13617 0 0 /archive-2006-2014/274 2 22836 0 0 /news/dartford0-2doverathletic-moorestrikesqualityintokentishpride 1 22860 0 0 /news/stansfeld060617 1 16844 0 0 /news/coachingyoungstersisthemostrewardingpartoffootballsayssevenoakscoachmickyhazard 1 18968 0 0 /news/greenwichboroughconfirmthree-yeargroundsharedealatholmesdale 1 20397 0 0 /news/wardhopes2007willbeanothersuccessfulyearforrams-exclusiveinterview 1 13377 0 0 /news/551bc5e1f010b 2 19626 0 0 /news/thisisaclubontheupsaysfavershamtownbossrayturner 1 13282 0 0 /news/getwellsoontommysampson 1 12201 0 0 /news/tonbridgeangels1-3suttonunited-shamefuldoswellsanticsmarsfinewin 1 17001 0 0 /news/glebe131219 1 11959 0 0 /news/551a979a0c59f 1 5133 0 0 /news/crawley301205.html 1 0 0 0 /news/soccershortsdartsagreecompensationtoallowdaytofinallyjoinwings 1 50458 0 0 /news/afccroydonathletic280219 1 12009 0 0 /news/doverathletic2-0wellingunited-dovermarchontowardsholygrail 1 17867 0 0 /news/greenwich221216 2 25690 0 0 /news/afcchern030919 3 75871 0 0 /news/theaimistogetintotheplay-offsnowsaysbromleybossmarkgoldberg 1 16795 0 0 /news/deresforcedtoswitchmidweekmatch 1 10354 0 0 /news/12thsept05.html 1 0 0 0 /news/shorts230615 2 45921 0 0 /news/iwillnotbeforcedintopanicbuyingsayswarrilow 1 16590 0 0 /news/afcfisherbeginsearchforanunpaidmanager 1 14458 0 0 /news/atophalffinishwouldbeacceptablesaysnewrusthallbosspaulmcdonagh 1 14903 0 0 /news/tonmckimm090515 2 29235 0 0 /news/carsgreen231017 3 65784 0 0 /kent-county-league/5 3 43950 0 0 /news/wallishasafutureatvcdinsistsford-exclusiveinterviews 1 16450 0 0 /archive-2006-2014/96 1 20237 0 0 /news/ashfordtown1-1chipstead-lovellwhycanttherymanleagueextendtheirseason 1 17631 0 0 /news/crayvalley190519 1 16187 0 0 /news/lordswood140815 1 14923 0 0 /news/551bc99dbe7a4/ryman/drmartens/eastern/folkestone/folkevhemelfat011103.html 2 15653 0 0 /news/otford081217 1 11507 0 0 /news/whithyth190322 5 160410 0 0 /news/afccroydonath050216 3 20198 2 2 /news/teenagersgivemcmahonmoreoptions-exclusive 1 15092 0 0 /news/darrenanslowresignsaftereightgamesinchargeofdealtown 2 16166 0 0 /news/iwanttowinthekentleaguesaysgreenwichboroughbossstevefirkins 1 15981 0 0 /news/551bc5e54d506 2 24556 0 0 /news/kentleague/lordswood/sportingbengal041204.html 1 0 0 0 /news/welldowelleventhoughwehaventgotabudgetinsistsfisk-exclusiveinterview 1 14705 0 0 /news/barking160405.html 1 0 0 0 /news/551a9cf594e9b 2 18487 0 0 /news/eastbournetown0-1chathamtown-itsimportanttostayinchasingpack-obrien 1 23732 0 0 /news/magicwandstaketotheroadtocelebratesuccess 1 15226 0 0 /news/drmartens/eastern/sittingbourne/6thfeb04.html 1 0 0 0 /isthmian-league/46 3 43774 0 0 /news/holmstan091019 2 44474 0 0 /news/thestonesarecominghomewevewaited23yearsforthissaysbillwilliams 1 31852 0 0 /news/fatrophyspecialashbyrelishinghisfirsttrophytie 1 12859 0 0 /news/wp-content/index.php 1 0 0 0 /news/wecangetsuccessiftheteamstaystogetherinsistsoconnell 1 16895 0 0 /news/hessenthalerunveilssigningofenglandgoalkeeper 1 13555 0 0 /news/maidstoneunited1-3favershamtown-thisresultwasntreallyasurprisetomesaysrayturner 1 18473 0 0 /news/ebbsfleet050520 2 30166 1 0 /news/dartford1-4millwall-wewerechasingshadowsadmitsupbeatburman 1 29200 0 0 /news/resultsfebruary2022 3 143533 0 0 /news/bromley140618 2 16345 0 0 /news/tommysampsonmessagesofsupport 1 16521 0 0 /news/wehaveworkedsohardforthis-thetreblewouldbetheicingonthecakesaysjayblackie 1 15372 0 0 /news/canterburycity190122 1 13401 0 0 /news/fishhavethatsinkingfeeling 1 13639 0 0 /news/551bc99dbe7a4/kentleague/thamesmead/kentleague/maidstone/17thnov03.html 2 15653 0 0 /news/sheppey270817 1 13380 0 0 /news/ivegotsomethinginthepipelinerevealswarrilow 1 19569 0 0 /news/dartford0-0stainestown-wellsinkswansinplay-offswarnsburman 1 17244 0 0 /news/canttunb291021 5 154926 0 0 /news/shepchat280821 4 114526 0 0 /news/2ndnov05G.html 1 0 0 0 /news/551bc5e399360 1 14194 0 0 /news/551a96782fc3d 3 28061 0 0 /news/ebbsfleetunitedtarget1200fansforearlykick-off 1 13634 0 0 /news/flanaganwereallyneedtobeatbillericay 1 13709 0 0 /news/beckthre090923 2 67669 0 0 /news/phoenixsports0-3vcdathletic-ouryoungstersaregoodenoughtocompetesaystonyrussell 1 32366 0 0 /news/551bc5e313487 1 20128 0 0 /news/folkestoneclosetounveilingnewboardmembers 1 23625 0 0 /news/soccershortsspackmansuffersfreakinjuryatwork 1 51982 0 0 /news/minshullwantsgoodformtotakeintotheplay-offs 1 12335 0 0 /news/11thnov05.html 1 0 0 0 /news/favershamtownsearchfortheirlifemembers 1 12695 0 0 /news/bromley270717 1 20208 0 0 /news/othernews/KYLFIX160204.html 1 0 0 0 /news/erithbel300815 1 13676 0 0 /news/itsimportantthatwekeepconcentratingsaysmaidstoneunitedbossjaysaunders 1 12098 0 0 /news/551a9c0f050b4 3 33034 0 0 /news/551bc99de29cd 2 20429 0 0 /news/551a9250a81ad 1 3982 0 0 /news/dulwichhamlet110922 2 17237 0 0 /news/551bc99dbe7a4/kentleague/sevenoaks/kentleague/sladegreen/sladevwhitstable111003.html 2 15653 0 0 /news/hythetown190523 2 30831 0 0 /news/brickiesawardedabandonedcuptie 2 14208 0 0 /news/24thnov04.html 1 0 0 0 /news/weareplay-offcontenderssaysthamesmeadtownbosskeithmcmahon 1 16052 0 0 /news/larkfield140221 3 44420 0 0 /news/551bc99c1f14a 2 17450 0 0 /news/sittingbourne0aveley4 1 13840 0 0 /news/dolbytellsfanstobemorepositive 2 21028 0 0 /news/kentleague/beckenham/2ndsept04.html 1 0 0 0 /news/drmartens/eastern/ashford/19thmar04.html 1 0 0 0 /news/charltonathletic0-3gillingham-weshouldwinmorethanweshouldlosesaysjamesmarrs 2 46026 0 0 /news/barrow2-1stevenageboroughaet-walkerdeniesstevenagethedouble 1 23646 0 0 /news/wp-admin/user/wp-login.php 1 0 0 0 /drmartens/eastern/folkestone/bromley020106.html 1 9955 0 0 /news/punjab060418 1 12152 0 0 /news/margatebosschriskinnearunveilsdeanpooleyashisfirstsummersigning 1 11975 0 0 /news/551bc99dbe7a4/kentleague/lordswood/othernews/25thjuly03.html 2 15653 0 0 /news/gillsold110516 2 21574 0 0 /news/ashfordunited190618 3 28561 0 0 /news/551bc99aa1f6d 1 6552 0 0 /news/soccershorts030720 1 14426 0 0 /news/551a956b7163f 1 3344 0 0 /national-league/7 5 51030 0 0 /news/akindeearnstransfertobristolcity 1 12474 0 0 /news/sportchat040319 2 47079 0 0 /news/hollandsblair140116 1 14060 0 0 /news/resultsmarch2019 2 95704 0 0 /news/551a96776660e 2 18714 0 0 /news/kentleague/whitstable/19thnov04.html 1 0 0 0 /news/drmartens/eastern/sittingbourne/sittvcorb070204.html 1 0 0 0 /news/fishsutt070323 4 109722 0 0 /archive-2006-2014/98 1 20749 0 0 /news/551bc5e31db52 1 11859 0 0 /news/longmyenglandexperienceswillhelpthefleet 1 17368 0 0 /news/kentleague/sladegreen/sladevlord170104.html 1 0 0 0 /news/vcdathletic3-0greenwichborough-wejustdidntturnupadmitsbillywalton 1 38686 0 0 /news/mattsollyreturnstochathamtown 1 13486 0 0 /news/chathamtown0-2charltonathletic-weevntuallygaveagoodaccountofourselves-kevinwatson 1 15439 0 0 /news/551a9250099f2 3 33365 0 0 /news/punjab070220 1 11992 0 0 /news/credittotheboystheyweresuperbsayshythetownbossscottporter 1 13929 0 0 //sitemap.xml 1 13856 1 0 /news/kenttitlechasershavealltoplayfor 1 12917 0 0 /news/vcdathleticfc.uk 1 0 0 0 /news/bearsted150616 1 11844 0 0 /news/erithbelvedere2-2dealtown 1 15346 0 0 /news/gillingham040117 1 14468 0 0 /news/warrilowagoodqualitygametoplaytobounceback 1 19735 0 0 /news/beckgleb210120 1 11343 0 0 /news/warrilowplaysthewaitinggameintransfermarket 1 16927 0 0 /news/tunsev020117 1 36289 0 0 /news/bromley250321A 5 62393 0 0 /news/lessonshavebeenlearntsaysbeckenhamchairman 1 14292 0 0 /kent-invicta-league/20 2 25455 0 0 /news/ithinktheplayerswillbehurtingandtheyllwanttoputitrightagainstwhyteleafesaysclews 1 15781 0 0 /news/551a956c42f18 1 4043 0 0 /news/fisherunveilsimonhalseyastheirnewjoint-manager 1 13548 0 0 /news/wp-admin/css/colors/xmrlpc.php 1 0 0 0 /news/551a9c92635f6 3 37773 0 0 /margate-2003-2006/2 2 29140 0 0 /news/20thnov05.html 1 0 0 0 /news/551a99e42a013 2 28030 0 0 /news/erithshep111216 1 32885 0 0 /news/crowborough020719 1 18232 0 0 /news/ramsgatehasalwaysbeenknownasaclubofwinnerssayschairmanlawson 1 14845 0 0 /news/weknowwhatwehavetodosaystonbridgeangelsdefendersonnymiles 1 18396 0 0 /news/tunbridgewells0-4erithbelvedere 1 12858 0 0 /news/wellingunited3-1bromley-wedidntplayparticularlygreattonightadmitsjamieday 1 28314 0 0 /news/themannerwelosttofolkestonewasnotacceptablesayshernebaybosssimonhalsey 1 12337 0 0 /news/551a96dca98ad 2 18734 0 0 /news/fishphoe100123 4 129278 0 0 /news/erithbelvedere3-1erithtown-weneedtowinfiveoutoffivesaysmickycollins 1 29703 0 0 /news/vcdathletic2-0tunbridgewellsfordaskshowcanwellsbeinthebottomthree-exclusives 1 19916 0 0 /news/icanseelightattheendofthetunnelsaysdealtownbossderekhares 1 16065 0 0 /news/551bc99caabcc 2 32149 0 0 /news/soccershortsformerebbsfleetchairmanmoulesappointedvice-chairmanofkentcountyleague 1 27222 0 0 /archive-2006-2014/184 1 19307 0 0 /news/iwillbehappyifwecankeepwithinthepackaroundchristmassayslordswoodbossjasonlillis 1 13715 0 0 /news/ourvisionistheplay-offsnextseasonsayswhitstabletownbossjustinluchford 1 12141 0 0 /news/23rdoct05.html 1 0 0 0 /news/wemeanbusinessthisyearinsistscugley 1 19558 0 0 /news/551bc5e250c8c 1 11087 0 0 /news/thelureofvcdendedupbeingtoomuchformetoturndownsaystonyrussell 1 17129 0 0 /news/ifwedontwinfingerswillbepointingatmesayssittingbournejoint-bossjimward 1 16949 0 0 /news/hareasksforfanspatienceduringearlywarm-upgames 1 14364 0 0 /news/kentfootballunited070719 1 12298 0 0 /news/folkestoneinvicta1margate1 1 15696 0 0 /news/551bc5dd5138b 2 17285 0 0 /news/itwouldbenicetohaveagoodruninthefatrophysaysianjenkins 1 15805 0 0 /news/kentleaguecupfinaltompkinsplayingcareerendsonahigh-note-exclusive 1 16789 0 0 /news/beckmill260718 1 24979 0 0 /news/angelsoneofthefavouritesnextseasonsayschairman-exclusive 1 18633 0 0 /news/kentleague/cray/aveley101004.html 1 0 0 0 /news/hampton061205.html 1 0 0 0 /news/vcdathletic260720 2 24073 0 0 /news/holmesdaleelectedintothekentleague-exclusive 1 11699 0 0 /news/corinthian201022 3 34188 0 0 /news/bromley2-3charltonathletic-itsabouttimewegotwhatwedeservesaysmarkgoldberg 1 23151 0 0 /news/551bc99dbe7a4/othernews/drmartens/premier/welling/6thoct03.html 2 15653 0 0 /news/dartford2-1lowestofttown-idontwantdannyharrisblownoutbychristmassaystonyburman 1 21927 0 0 /news/sevenoaks190615 1 23028 0 0 /news/youhavetoworkhardtokeeptheramsgateshirtsaysdannyward-exclusiveinterivew 1 14381 0 0 /news/craywands221118 3 36194 0 0 /news/FACupDraw211019 3 28389 0 0 /news/sceflstatement110321 1 12017 0 0 /news/tonbridgeangels250720 1 11259 0 0 /news/551a9718f03ea 3 34565 0 0 /news/fisher241005.html 1 0 0 0 /news/gillingham120721 1 12106 0 0 /news/corinthian031216 1 13088 0 0 /news/strikeradeolorundahassomeunfinishedbusinessheresaystonbridgeangelsbosstommywarrilow 1 19259 0 0 /news/kentleague/lordswood/dealvlord230304.html 1 0 0 0 /news/fisher091118 1 11870 0 0 /news/erithbel030317 1 15031 0 0 /news/kentleague/cray/1stnov03.html 1 0 0 0 /news/551bc5e16f03d 1 14775 0 0 /archive-2006-2014/76 1 20459 0 0 /news/6thjuly03.html 1 0 0 0 /news/551bc99dbe7a4/kentleague/hernebay/kentleague/beckenham/27thoct03.html 2 15653 0 0 /news/551bc99b73419 2 14125 0 0 /news/drmartens/premier/dover/7thjuly04.html 1 0 0 0 /archive-2006-2014/166 1 19579 0 0 /news/areturnforcanterburycity 2 18220 0 0 /news/phoenixsports300819 2 25999 0 0 /news/chelmsfordcity3-0folkestoneinvicta 1 15222 0 0 /news/princesparkspecialastadiumwherefamiliescanwatchthedarts-exclusiveinterview 1 13486 0 0 /news/thefleetatwembleywebackthefleettodeliverourbiggestprize 1 14084 0 0 /news/fisher240417 1 20182 0 0 /news/13thoct05.html 1 0 0 0 /news/dartfordbosstonyburmanunveilsthesigningofpetersweeney 2 15144 0 0 /news/crayvalleyatwembley160519A 1 13716 0 0 /news/noonehasthedivinerightforsuccesssaysdoverathleticchairmanjimparmenter 1 13788 0 0 /news/broadstairs040517 2 14705 0 0 /news/folkestoneinvicta3-2hernebay-bulgarianmakesgoodearlyimpression 1 14260 0 0 /news/reachingfacupfirstroundisarealistictargetforussaysdoverathleticbossmartinhayes 1 21077 0 0 /news/othernews/drmartens1staug04.html 1 0 0 0 /news/wewillnotslipupinsistswalker-exclusiveinterview 1 19435 0 0 /news/doverexpectover500fanstoattendtitledecider 1 13012 0 0 /archive-2006-2014/276 2 23550 0 0 /news/dulwich231018 1 13764 0 0 /news/guernseyisalovelyplacetogotothistimeofyearsayswhitstabletownbossnickysouthall 1 12438 0 0 /news/worcester081005.html 1 0 0 0 /news/wellgetbetterastheseasongoesonsaysvcdathleticbosstonyrussell 1 14986 0 0 /news/ashfordtown6-1mileoak-colemanhasgivenmeastrikeforcedilemmaadmitslovell 1 29980 0 0 /news/tenmorepointswillkeepusuppredictschatsboss-exclusive 1 13289 0 0 /news/tonbridgeangels1-0hastingsunited-mainhasnotreachedhispeakwarnsdolby-exclusive 1 21511 0 0 /news/551a9799b657d 1 4684 0 0 /news/westcant111117 1 27904 0 0 /news/afccsutt060823 3 50723 1 1 /news/hythewillcontinuetobuildforthefutureduringthisperiodoftransitionsayspaulmarkland 1 14975 0 0 /news/thomasnotgoinganywhereinsistsmcmahon-exclusiveinterviews 1 14640 0 0 /news/soccershorts240516 2 39421 0 0 /news/wellingtown050620 1 12555 0 0 /news/fisherith071215 1 32461 0 0 /herne-bay-2003-2006/2 3 24123 0 0 /news/kentleague/erithtown/10thsept04.html 1 0 0 0 /news/margatelaunchshareissuetohelppaytaxmandebt 1 13215 0 0 /news/invicta120615 1 21936 0 0 /news/iwantmyteamtoentertainsaysjenkins 1 17304 0 0 /news/dartsgills161115 2 37704 0 0 /news/dulwichhamlet240820 1 11705 0 0 /news/CoronavirusStatements130320 3 49389 0 0 /news/dulwichhamlet241019 1 12970 0 0 /news/bromley0-1chelmsfordcity-wehadourchanceanddidnttakeitadmitsbromleysmarkgoldberg 2 31602 0 0 /news/othernews/24thjan04.html 1 0 0 0 /news/chatham201116 3 28122 0 0 /news/stay-awayfansarekillingashfordtownwarnsthorogood 1 14867 0 0 /news/wewanttogetoutofthisdivisionsayskentfootballunitedbosssammacneil 1 15687 0 0 /news/idontseelyddasateamatthebottomofthetablesaysdavesmith-crockenhillsettopullout 1 15302 0 0 /news/chatbeck121019 1 35293 0 0 /news/thebigfreezewhitstablehopefulforbigcrowdiffanscanhelpgetramsgategameon 1 19728 0 0 /news/wardimreapingtherewardsoflocaltalentexclusive 1 13366 0 0 /news/in-formmargatecangoallthewayaccordingtochairman 1 12153 0 0 /news/551bc99dbe7a4/kentleague/erithtown/kentcounty/21stoct03.html 2 15653 0 0 /news/551a9678427aa 3 27015 0 0 /news/championshessenthalerlaysthefoundationsfornextseason 1 15362 0 0 /news/thechallengefortheplayersnowistobemoreconsistantsaysfavershambossrayturner 1 13157 0 0 /news/brownquitsunderperformingderes 1 10868 0 0 /news/wp-content/plugins/wp-file-manager/lib/files/a57bze8931.php 1 0 0 0 /news/551a931d95055 1 12844 0 0 /news/margate230218 2 24754 0 0 /news/551bc5e2dbd92 1 12246 0 0 /news/wehavethequalitytogetthejobfinishedsayscloke 1 13383 0 0 /news/sevemers240822 5 140280 0 0 /news/newstadiumhasconvincedplayerstodropdowntoplayforussaysstonesbossjaysaunders 1 11659 0 0 /news/waltvbrom030404.html 1 0 0 0 /news/play-offfinalspecialcraychairmancallsforcountywidesupport 1 16385 0 0 /news/551bc99dbe7a4/othernews/ryman/bromley/bromvtoot230903.html 2 15653 0 0 /news/9thnov03.html 1 0 0 0 /news/drmartens/eastern/erith&belvedere/harlow271104.html 1 0 0 0 /news/fleetseekfurtherinvestmenttobecomeselfsufficent 1 12896 0 0 /news/23thjan04.html 1 0 0 0 /news/drmartens/premier/welling/10thdec04.html 1 0 0 0 /news/wembleyisadreamforanyoneinvolvedinfootballsaysashfordunitedcoachjohnovard 1 16758 0 0 /gravesend-2003-2006/2 4 35294 0 0 /southern-counties-east-football-league/44 1 19584 0 0 /news/FootballSuspensionStatements160320 3 41836 0 0 /news/tonbridge291217 2 26996 0 0 /news/refereenumbersincreasehereinkent 1 11262 0 0 /news/wembleywinnerswhitstablepraiseforkingakinde-exclusive 1 14425 0 0 /news/551a956c0f456 1 5510 0 0 /news/ryman/bromley/bromvtonb270104.html 1 0 0 0 /news/itwouldbeniceifjohanterhorstcangooutonahighsaysneilcugley 1 16578 0 0 /news/ihaventgotaget-out-of-jailcardadmitscraywandererschairmangaryhillman 1 12989 0 0 /news/cumberbatchwemustfinishoffthejob-exclusiveinterview 1 14090 0 0 /news/lordswood011217 1 12623 0 0 /news/dartfordsquadstartingtotakeshape 1 13033 0 0 /news/551bc5e0195ee 2 17188 0 0 /news/551a96786c071 2 15029 0 0 /news/tunbridgewells221222 1 14410 0 0 /news/CombinedCountiesLeagueStatement200121 1 16140 0 0 /news/crayvchesfav221103.html 1 0 0 0 /news/551bc99dbe7a4/kentleague/maidstone/kentleague/greenwich/26thaug03.html 2 15653 0 0 /news/551bc5e760e05 1 15193 0 0 /news/551bc99a79c58 1 3643 0 0 /news/blyspartans0-0phoenixsports-wewerethebettersideanddeservedtowinsaysphoenixboss 2 22372 1 1 /news/hendon3-0dartford-controversialredcardupsetsburman 1 16952 0 0 /news/whitstabletown270722 1 13918 0 0 /news/ithinkforaclubthesizeofwhatweareweshouldbechallengingforthingssaysandyconstable 1 16386 0 0 /news/551a967849335 2 17735 0 0 /news/ramswelcomelordstosouthwood 1 11911 0 0 /news/ebelcars300815 1 28421 0 0 /news/meadbosskeithmcmahonunveilsthesigningofstrikerstuartking 1 17298 0 0 /news/551a95b3df1f9 3 50862 0 0 /news/holmesdaleunveiljohnwilfortastheirnewmanager 2 18186 0 0 /news/maidstoneunited1-1margate-wevegottoturnourownfortunesaroundsayshume 1 20775 0 0 /news/canterbury260118 1 11987 0 0 /news/erithbel230518 1 17919 0 0 /news/drmartens/eastern/dartford/27thnov03.html 1 0 0 0 /news/favershamstrikeforce120620 1 12374 0 0 /news/ifeelweregoingintherightdirectionsaysradbourne 1 22068 0 0 /news/burmanfancieshischancestoenddovers100homerecord 1 15706 0 0 /news/kfu080416 1 13046 0 0 /news/daishmakessignificantsigning 1 11600 0 0 /news/facupdraws2011-2012 1 19103 0 0 /news/sevechic091119 2 65289 0 0 /news/ebbsfleetunited.co.uk 1 0 0 0 /news/kentleague/ramsgate/whitstable041204.html 1 0 0 0 /news/maidstoneunited4-2aveley-iwantustobehardtobeatathome-hume 1 27760 0 0 /news/rooksetshissightshigher 1 14988 0 0 /news/margate241117 1 13637 0 0 /news/craywands010719 3 30256 0 0 /news/itisquiteimportantwefinishsecondsaysdoverathleticassistantjakeleberl 1 12159 0 0 /news/551a96db63e27 1 3732 0 0 /news/yorathrueshissidesbadluck 1 14440 0 0 /news/sometimesyouvegottogobacktobasicsandwinuglysaysbeckenhamtownbossjasonhuntley 1 15533 0 0 /news/udbergappointedbrickiesnumbertwo 1 15136 0 0 /news/kentleague/cray/AFCWimbeldon041204.html 1 0 0 0 /news/ramsgate180320 2 25691 0 0 /news/buryshowinterestinmeadteenagerhopkins 1 15331 0 0 /news/craykspo241018 1 29874 0 0 /news/chatram101016 3 77759 0 0 /news/phoenixsports1-0croydon-hopefullywecanhaveabitofavaserunsayssteveoboyle 1 29454 0 0 /news/favershamtownbossrayturnerplaysthewaitinggametoaddthreenewfacesto37-mansquad 2 16750 0 0 /news/thingshavetochangeforthebetter-insistsashfordtownchairman 1 20951 0 0 /news/snodlydd111017 1 30469 0 0 /news/551a931e162a9 1 11838 0 0 /news/vcdathletic0-1horsham-thebetterteamlosttodayadmitsvickersbossrickybennett 1 25852 0 0 /news/rustsnod170816 1 28544 0 0 /news/551a9c92962aa 2 21748 0 0 /news/youdontgettimeinfootballadmitspromotionchasingangelsbosstommywarrilow 1 19055 0 0 /deal-2003-2006/www.heineken.co.uk/ 1 3117 0 0 /news/bromstoc291019 2 36783 0 0 /news/erithdartfordtown0-4phoenixsports-wewerentgoodenoughtonightadmitsembarrassedabbott 1 23686 0 0 /news/wejusthavetoscoreafewmoregoalssaysramsgatebosstimdixon 1 19068 0 0 /news/craythurr150316 3 70141 0 0 /news/ksports-fc.co.uk 1 0 0 0 /news/theclubcouldnotsupportmyvisionsandabilitytomovethefirstteamforwardsayschristuley 1 12230 0 0 /news/vickersgunningformaximumpointsduringcrazyperiodoffixtures 1 12837 0 0 /news/thebigkickoffinvictasigndaggerskeeper-exclusive 1 14542 0 0 /news/soccershortssladegreenunveilsimpsonastheirnewkeepercoach 1 15641 0 0 /news/dartford2-1eastbourneborough-thereseemstobeanegativefeelingaroundtheplace-burman 1 18447 0 0 /news/elmstead081217 1 12792 0 0 /news/whyteleafe140919 2 24145 0 0 /news/whitstabletown0-4dagenhamredbridge-ithoughtweputfantasticeffortinsaysnickysouthall 1 26114 0 0 /news/ashfhern300422 6 201891 0 0 /news/12thjune04.html 1 0 0 0 /news/13thjuly04.html 1 0 0 0 /news/551a92505401c 2 16480 0 0 /news/foleyrevealsaplayingbudgetcutof55 1 18887 0 0 /news/facupspecialpennockweneedyoursupporttosendusthrough 1 15411 0 0 /news/9thjuly04.html 1 0 0 0 /news/drmartens/eastern/erith&belvedere/26thjune03.html 2 0 0 0 /news/welling081115 1 14089 0 0 /news/gillingham231222 2 17545 0 0 /news/adamsquitscrockenhill 1 17295 0 0 /news/wellingtown111019 1 13413 0 0 /news/bromley1-0dartford-wehadtoremoveacertainelementfromtheclubsaysmarkgoldberg 1 30551 0 0 /news/551a979b1349f 1 5280 0 0 /news/dartsworkinghardtobringbackthecrowds 1 15490 0 0 /news/charltonathletic291119 3 34237 0 0 /news/greenwichborough3-0crowboroughathletic-imhereforthedurationsaysianjenkins 1 29887 0 0 /news/wp-content/plugins/fix/css.php 1 0 0 0 /news/bromleyjackholland130518 1 16495 0 0 /news/cugleysetsninepointtargetfromnextthreegames 1 16049 0 0 /news/kfu290617 2 17552 0 0 /news/tonbneed040317 2 67929 0 0 /news/phoenix021015 2 25037 0 0 /news/bromtran230116 2 33911 0 0 /news/faversham091119 2 27590 0 0 /news/trottsaysasmargatemanagerbutwithaslightlyreducedbudget 1 11795 0 0 /news/matchreportssladegreenpickupsevenyellowsandtworedsinlocalderby 1 27471 0 0 /news/managerissuesrallyingcrytoashfordpeople-exclusiveinterview 2 21166 0 0 /news/551bc99c05cd6 2 22151 0 0 /news/ryman/bromley/9thfeb04.html 1 0 0 0 /news/daishhandedextrafundsthrough80000joint-transferdeal 1 12398 0 0 /news/551a92504c460 2 15436 0 0 /news/jasonlillisreturnstomanagelordswoodandbringsfamilarfacesbackwithhim 1 15660 0 0 /news/parnhampromotedtonumbertwo 1 10643 0 0 /news/ashfordtownwelcomeyouthteamtrialists 2 14346 0 0 /news/nationalleague200516 1 15972 0 0 /news/551a96778e771 2 17615 0 0 /news/folkestoneinvicta110521 2 27393 0 0 /news/bearsted201023 2 25636 0 0 /news/ramsgate280423 2 27625 0 0 /news/wellingtown230922 1 13425 0 0 /news/beckenhamtown3tunbridgewells0exclusiveinterviews 2 28965 0 0 /news/bhtvsitt140204.html 1 0 0 0 /news/weregeareduptoplayconferencepremierfootballsaysdartfordbosstonyburman 1 14318 0 0 /news/kentleague/tunbridgewells/9thnov03.html 1 0 0 0 /news/bromley210618 2 16147 0 0 /news/sladegreensignfrenchmanonloanfrombromley 1 11583 0 0 /news/everyoneknowsthatthefacupdoesnttakeanyprisonerswarnsstonesplayer-bossjaysaunders 1 13933 0 0 /news/margatesettounveiltheirnewmanagerlaterthisweek-exclusive 1 11402 0 0 /news/23rdsept03.html 1 0 0 0 /news/bromley070218 1 15795 0 0 /news/drmartens/premier/welling/grays091004.html 1 0 0 0 /news/wingerhughespenstwo-yeardoverdeal 1 13711 0 0 /news/wellcertainlyhaveateamoutwhowillcertainlydousproudsaysramsgatebosstimdixon 1 15293 0 0 /news/brownsofftorusthall-exclusive 1 12194 0 0 /news/ifweconductourselvesproperlyweshouldhavetoomuchforlittlehamptonsaysjackparkinson 2 20342 0 0 /news/monarchsvowtobringkentleaguefootballtostaplehurst 1 15727 0 0 /news/isthmianleaguestatement181120 2 23159 0 0 /news/drmartens/premier/welling/17thdec03.html 1 0 0 0 /news/thedooropensforsomeonetostepinandtakeittothenextlevelsaysmickycollins 1 19613 0 0 /news/lovellscoopsmanagerialaward 1 12057 0 0 /news/wehaveamassivechanceofknockingouthistonsayshume 1 16382 0 0 /news/drmartens/eastern/dartford/4thnov04.html 1 0 0 0 /news/humefindsawaytokeephisstrikeforcehappy 1 14897 0 0 /news/rochesterunited250222 1 13558 0 0 /news/warrilowhitsbackatrivalsbudgetaryclaims 1 18086 0 0 /news/gillingham080121 1 11664 0 0 /news/weneedsolidfoundationssaysconcerneddaish 1 13245 0 0 /news/whitstable240516 2 29714 0 0 /news/fishwell200922 5 149167 0 0 /news/551a956bb1709 3 22365 0 0 /news/rushdenapproachgravesendsdiamondmanager 1 11483 0 0 /news/551a96777fd63 3 46115 0 0 /news/551bc5de97fbd 1 12071 0 0 /news/phoedeal121122 1 40709 0 0 /news/551bc5e81da42 2 21138 0 1 /news/551a97b21f51b 1 14918 0 0 /news/havefaithinmeandiwilldeliverinsistsdolby 1 11420 0 0 /news/551bc5dfe5737 1 13248 0 0 /news/whitstableunveilmundayastheirnewmanager 1 13160 0 0 /news/vickersoakwoodgroundreadyinfourweeksexclusiveinterview 1 15891 0 0 /news/craywanderers1-0worthing-thejobsonlyhalfdoneadmitsdelightedjenkins 1 28575 0 0 /news/ineedtosettledownandplanforlifeafterfootballsaysshanehuke 1 12782 0 0 /news/wevegoteverythingtoloseatchessingtonhookwarnshythetownbossscottporter 1 17623 0 0 /news/ebbsfleetunited0-1histon-daishrantatten-cardtrickreferee 1 19560 0 0 /news/wellbequitehappywithatop-halffinishsayscorinthianbosstonysitford 1 13511 0 0 /news/everythinghereisreadyforbluesquarefootballsaysdoverchairman 1 15819 0 0 /news/therewontbeasideinthekentleaguethatwilltouchusinsistsmcmahon-exclusiveinterview 2 25573 0 0 /news/fishphoe230118 1 34239 0 0 /news/managerkeithlevettpartscompanywithsevenoakstown 1 12606 0 0 /news/letskeepourwinningrungoingsayslovell-exclusive 1 14061 0 0 /news/simonjonesreturnstomanagesevenoakstown 1 12152 0 0 /news/fleetgirlsscoopawards 1 11807 0 0 /news/kentleague/deal/Sampson13.html 2 0 0 0 /drmartens/eastern/erith&belvedere/thamesmead020106.html 1 9955 0 0 /news/sevenglebe170216 2 48753 0 0 /news/crayvalley050516 1 12867 0 0 /news/punjstan071022 4 137778 0 0 /news/weneedtogenerateabitmoremoneytostayup-jenkins 1 27680 0 0 /news/apartofmyheartwillalwaysbelongathartsdownpark-oconnell 1 17080 0 0 /news/ifwehaveagoodnovemberwhoknowswhatwecanachievesaysfolkestonebossneilcugley 1 15040 0 0 /news/551a95b40d36d 3 44908 0 0 /news/kentleague/maidstone/maidvwhit170204.html 1 0 0 0 /news/takeoverwillheraldanewchapterfortheclubsaysbillwilliams 1 11456 0 0 /news/FAStatement191120 3 27639 0 0 /news/bridgleb010317 2 41760 0 0 /news/glebe081223/ 1 4789 0 0 /news/kentleague/thamesmead/24thnov04.html 1 0 0 0 /news/itscometoapointwhereicannotgivetherolethetimeandeffortitneedssayssimonaustin 1 17321 0 0 /news/dolbywantstogivefanssomethingtoshoutabout 1 12830 0 0 /news/eritrayn090822 4 126726 0 0 /news/crayvtunw310304.html 1 0 0 0 /news/fixturessaturday14thjanuary2006 1 15214 0 0 /news/woking2-0doverathletic-wegavewokingafootballinglessonsaysupbeathessenthaler 1 32491 0 0 /news/gravesendnorthfleet1-3weymouth 1 17856 0 0 /news/hampvbrom210204.html 1 0 0 0 /news/ebbsfleet180520 1 12558 0 0 /news/551a9c922a512 3 36096 0 0 /news/551a931dafa21 1 11599 0 0 /news/gravesendreleaseelevenplayersasclubenduredifficulttimes 2 15367 0 0 /news/dartford230916 2 16917 0 0 /news/551a9bafdfec3 3 27359 0 0 /news/551a9677ad5be 2 36066 0 0 /news/tonbbogn230216 2 55919 0 0 /news/greeniesfridaypreview-2 1 14911 0 0 /news/sunderlandfanraisesfundsforthefamiliesofnewcastlefanskilledinukraineplanetragedy 1 13772 0 0 /news/ramsgate040422 3 28648 0 0 /news/dartford310522 5 50165 0 0 /news/soccershortshythetownunveiltimdixonastheirnewboss 1 32614 0 0 /news/erithbelvedere4-4crayvalley-agreatadvertforkentleaguefootballsaysmickycollins 1 31063 0 0 /news/erithtown1-2greenwichborough-ogoorepaysfirkinsfaith 1 19716 0 0 /news/wellsmeettodiscussfutureplans 2 14894 0 0 /news/551bc5e0078f9 2 20851 0 0 /news/551bc5dc104b7 3 42233 0 0 /news/tunbridgewells071204.html 1 0 0 0 /news/wewanttotakedoverathleticasascalpsayshythetownbossscottporter 1 17277 0 0 /news/wehavetoraisethebaralittlebitagainsayswellingunitedbossjamieday 1 15833 0 0 /news/atop-sixfinishisstillwithinreachsaysdealtownbossderekhares 1 17791 0 0 /news/thamesmead050205.html 1 0 0 0 /news/dulwichhamlet1-2leiston-itwasntgoingtobeourdayadmitstitle-chasinggavinrose 2 52455 0 0 /news/maidbrom260819 2 40525 0 0 /news/551bc5e740fd7 1 19068 0 0 /news/crayvalley260715 1 12540 0 0 /news/craywanderers1-2maidstoneunited 1 29058 0 0 /news/drmartens/eastern/dartford/horshamymca050904.html 1 0 0 0 /news/ihopewecancreatesomerealexcitementbybeinginthedrawforthenextroundsaysrayturner 1 15140 0 0 /archive-2006-2014/289 2 22110 0 0 /news/wedesperatelyneedasmallinjectionoffundswarnsbromleyownerjerrydolke 1 17865 0 0 /news/idontthinkwegetenoughcreditsayswellingunitedbossjamieday 1 14454 0 0 /news/wp-content/plugins/apikey/abruzi.php 1 0 0 0 /news/collinsunveilsformerspursstopperashisfirstsigning 1 14437 0 0 /news/chathamtown280820 1 11190 0 0 /news/greenwichstadium140615 1 25799 0 0 /news/wevegottoprovehowgoodwearesayscraywanderersjoint-bossgaryabbott 1 13723 0 0 /news/martinfordstatement130320 1 10946 0 0 /news/ashford141216 5 38904 3 3 /news/resultsinfriendliesdomattersayscraywanderersbossianjenkins 1 15004 0 0 /news/551a967803ab9 2 25356 0 0 /news/crow111215 1 14148 0 0 /news/hamptonrichmondborough2-0wellingunited-fordruescostlyerrors 1 17525 0 0 /news/hallsathletic290720 4 24603 3 3 /news/fleetbeatthegills5-2 1 17529 0 0 /news/orpington200720 1 12022 0 0 /news/conference/margate/margatevaldershot120803.html 1 0 0 0 /news/humewehadtheedgeovertonbridge 1 18032 0 0 /news/551a9799af641 1 4880 0 0 /news/fcelmstead200119 1 11650 0 0 /news/iwantplayerstograbtheheadlinessaysfleetbossliamdaish 1 20314 0 0 /news/hernebaysearchforexperiencedgroundsman 1 12524 0 0 /news/readingreplay310804.html 1 0 0 0 /news/barking200905.html 1 0 0 0 /news/3rdmay04A.html 1 0 0 0 /news/551bc5e23cf59 1 12342 0 0 /news/carshaltonathletic3-2tonbridgeangels-alexobrienthreatenstowieldtheaxe 1 37255 0 0 /news/strikepairingiskeytoourcupsuccesssaysabbott 1 12990 0 0 /news/19thnov04.html 1 0 0 0 /news/27thaug03a.html 1 0 0 0 /news/551a95b42f4b1 2 27033 0 0 /news/beckvslad070204.html 1 0 0 0 /news/weretryingtogetintothekentleagueassoonaspossiblesaysblyspartansbossmatthume 1 16170 0 0 /news/wemusttakeourcupformintotheleaguesaysseager 1 12738 0 0 /news/ihaveeverythingittakestomakeasuccessofitsayssimonaustin 1 13751 0 0 /news/tonbridgefansthreatenboycottoversuttonsegregationmeasures 1 21975 0 0 /news/551bc99dbe7a4/ryman/drmartens/eastern/tonbridge/tonbvfolk131203.html 2 15653 0 0 /news/kentleaguescenewhosebeenmakingthenewsthisweek 1 16310 0 0 /folkestone-2003-2006/5 2 18163 0 0 /news/glebe280119 2 23897 0 0 /news/rustgleb220317 1 35142 0 0 /news/18thaug04.html 1 0 0 0 /news/lovellwemustkillteamsoff-exclusiveinterview 1 13957 0 0 /news/meridian050619 1 14771 0 0 /news/wp-content/plugins/superstorefinder-wp/ssf-wp-admin/pages/SSF_WP_UPLOADS_PATH/csv/import/a57bze8931.php 1 0 0 0 /news/ferdinand300515 1 12616 0 0 /news/margate121017 2 29904 0 0 /news/jonesplotsfacupgiantkilling 1 18259 0 0 /news/wewillgetbacktowinningwayssayswalker 1 12625 0 0 /news/dartford030619 3 18868 1 1 /news/hythetown2-0stainestown-youdreamaboutdayslikethissaysproudscottporter 1 31932 0 0 /news/folkestoneinvictarelaunchwebsite 1 18586 0 0 /news/15thmar04.html 1 0 0 0 /news/kentleague/thamesmead/cray070804.html 1 0 0 0 /archive-2006-2014/208 1 19847 0 0 /news/kentleague/maidstone/5thnov04.html 2 0 0 0 /news/drmartens/eastern/dartford/29thaug04.html 1 0 0 0 /news/topscorersindenquitsvickers 1 13411 0 0 /news/lovellrelishingtastyfestivefixtures-exclusive 1 16275 0 0 /news/ksports250719 1 13168 0 0 /news/crayvhythekstfinal170404.html 1 0 0 0 /news/551bc5e1493c1 2 25279 0 0 /news/iamexpectingamarkedimprovementwithkevinharrisinchargesaysraysimpson 1 12159 0 0 /news/greeseve190315 1 33361 0 0 /news/eastbourne030805.html 1 0 0 0 /news/wecanonlygetbettersayscharltonathleticskipperjennynewman 1 17986 0 0 /news/sporfore261020 1 37575 0 0 /news/wevegottobeattheteamsaroundussayslovell 1 15598 0 0 /news/snodroch020322 6 154131 0 0 /news/thefacarlsbergvasefourthrounddraw-1 1 10251 0 0 /news/fisher1-2holmesdale-wewanttofinishtheseasononahighsaysrossmitchell 1 24566 0 0 /news/kentleague/lordswood/lordswoodvvcd160803.html 1 0 0 0 /news/hopefullywecanbeinfavershamspositionnextyearsaysbeckenhamchairman 1 16120 0 0 /news/festivematchreportshastingsunitedbeginsearchfornewboss 1 53758 0 0 /news/idontputpressureonmyplayerssayspennock 1 13184 0 0 /news/toaskforconsistencyeveryweektakestimeorexperiencesayssittingbournebossnickdavis 1 12955 0 0 /news/dulhar181016 2 53367 0 0 /news/burmanthrashesoutdealforkadi 1 12035 0 0 /news/werelookingtogetintotheplay-offsorwinleaguesaysthamesmeadtownbosskeithmcmahon 1 17813 0 0 /news/soccershorts220522 2 25943 0 0 /news/13thjune05G.html 1 0 0 0 /news/crayvalley270217 1 13357 0 0 /news/551bc5e736946 1 16591 0 0 /news/.well-known/acme-challenge/index.php 1 0 0 0 /news/dartford201104.html 1 0 0 0 /news/faversham120517 2 26890 0 0 /news/weneedtodoalittlebitmorebeforewecanbeconsideredseriouscontenderssaysstevechapman 1 13213 0 0 /news/551a95b45ea6d 2 20233 0 0 /news/thamesmead050216 2 25224 0 0 /news/wealdstone2-1tonbridgeangels-theseasonsoveradmitsangrywarrilow 1 37179 0 0 /news/thisisalearningcurveforusinsomanywayssaysglebebossrockymcmillan 1 16694 0 0 /news/keytrioreturnfortop-of-the-tableshowdown 1 15970 0 0 /news/551bc5e6e80bd 1 22009 0 0 /news/fridaynightsfixtureleadinggoalscorers 1 29618 0 0 /news/551bc5dc78262 3 34824 0 0 /news/warrilowwillbeahugesuccessattonbridgesayshornetsboss 1 12217 0 0 /news/gowerstepsdown 1 11664 0 0 /news/table-toppingchathamtownbosskevinwatsonwantstogetsomepointsatilford 1 15546 0 0 /news/oboyleconfidentgoingintovasetriptowick 1 11849 0 0 /news/braintree010105.html 1 0 0 0 /news/craywanderers2-0hastingsunited-maybewecangettheautomaticpromotionspot-ianjenkins 1 35212 0 0 /news/30thnov05.html 1 0 0 0 /news/551bc5e0bde26 1 16929 0 0 /news/ourdaysarenumberedatsittingbourneadmitsbossgaryabbott 1 19341 0 0 /news/551bc5e480ad9 1 15191 0 0 /news/551bc99dbe7a4/nationwide/gillingham/othernews/21stsept03.html 2 15653 0 0 /news/fisherfarn300716/ 2 11201 0 0 /news/wehavetotreatourguernseytripasprofessionallyaswecansaysramsgatebosstimdixon 1 13782 0 0 /news/551a979b17d5a 1 5024 0 0 /news/glebling080519 1 26524 0 0 /news/foleystepsdownasvcdathleticboss 1 15223 0 0 /news/551bc5e338493 1 15726 0 0 /news/charltonathletic020120 3 30090 0 0 /news/arsenalcelebsspreadtheirwings 2 14389 0 0 /news/whyteleafe4-1beckenhamtown-everythingsgoingtoplansayswhyteleafebossjohnfowler 1 29761 0 0 /news/playersenjoyplayingfootballratherthanthemoneynowsayscugley 1 21250 0 0 /news/barton261105.html 2 0 0 0 /news/lordswood080917 1 11869 0 0 /news/erithtown2-1beckenhamtown-thedesiretowinwasntquitetheresaystonyrussell 1 27525 0 0 /news/idontwantacloudhangingovermyheadsaysradbourne 1 19518 0 0 /news/sctbear271117 1 30217 0 0 /archive-2006-2014/242 1 19199 0 0 /news/551a96db561a4 1 3888 0 0 /news/wevebeenledupthegardenpathfumesmeadbosskeithmcmahon 1 18461 0 0 /news/551bc99dbe7a4/othernews/conference/gravesend/28thaug03.html 2 15653 0 0 /drmartens/eastern/ashford/25thaug05.html 1 9955 0 0 /news/dulwich280417 2 31675 0 0 /news/beckenhamtown0hythetown0 2 18672 0 0 /news/seagerslamspoordefending 1 12475 0 0 /news/tunberit170423 4 143598 0 0 /news/lastchancetopurchaseprincesparktickets-davemartintrainswithleagueclub 1 16060 0 0 /isthmian-league/www.heineken.co.uk/www.heineken.co.uk/ 1 5110 0 0 /news/kentyouth/03-04teams.html 1 0 0 0 /news/faversham110620 3 27036 0 0 /news/551bc5da16796 3 41559 0 0 /news/wejustneedtoprogressyearonyearsayscorinthianbossmattlonghurst 1 15961 0 0 /news/drmartens/premier/dover/16thnov04.html 1 0 0 0 /news/551bc5db832bf 5 50203 0 1 /news/kentleague/cray/2nddec04.html 1 0 0 0 /news/fansraisefundsforbringthestoneshomecampaign 1 14252 0 0 /news/budgetcutsforcewalkertoquitstones 1 14588 0 0 /news/hollands290718 1 15466 0 0 /news/eritchat250220 1 37465 0 0 /news/bromleyontheorientifwebeatleytonorientwellbeindreamworldsayscoachneilsmith 1 20699 0 0 /news/551bc5e3a7cc8 1 12520 0 0 /news/martinfordquitsfishertotakechargeoferithbelvederewithchriscosgrove 1 11743 0 0 /news/ashford061117 3 26365 0 0 /news/551bc5db5d3c7 3 31549 0 0 /news/551bc99dbe7a4/conference/gravesend/drmartens/premier/welling/30thjune03.html 2 15653 0 0 /news/ireallybelievefavershamwillmaketheplay-offsthisseasonsaysfolkestonebossneilcugley 1 13861 0 0 /news/lordswood040816 1 12040 0 0 /news/dulwichhamlet1-0chathamtown 1 12724 0 0 /news/burmanunveilsdoublesigning 1 11943 0 0 /national-league/23 2 24259 0 0 /news/weneedtobringinoneortwothebalanceofthesquadisjustnotrightsaystonyrussell 1 18005 0 0 /news/versatilehamiltonwantstosettleinoneplace 1 12450 0 0 /news/fisherencouragedbypositiveresponseovercommunityhubplans 1 20994 0 0 /news/wallisoptstostaywithdoverathletic 1 13192 0 0 /news/551bc99dbe7a4/othernews/ryman/bromley/epsovbrom061203.html 2 15653 0 0 /news/fishstan070223 3 71592 0 0 /news/iwillwalkawayifwedontmakeplay-offsnextseasonannouncesward 1 22447 0 0 /news/doverathletic1-2newportcounty-wehaventbecomeabadsideovernightsayshessenthaler 1 25106 0 0 /news/beingunderdogsthepressurewillbewithbromleytowinsaystonbrigeangelsbossstevemckimm 2 19646 0 1 /news/sevenoaks260416 1 13570 0 0 /news/kentleaguesearchfornewsponsors 1 11817 0 0 /news/fleetladiesarrangefriendlyatstonebridgeroad 1 15128 0 0 /news/harrbrom050319 1 30215 0 0 /news/conference/gravesend/gravesend.html 1 0 0 0 /news/wellingunited1-1dartford-theresnoblameonleeclarkesayswingsbossjamieday 1 20237 0 0 /news/ramsgate020618 2 24334 0 0 /news/othernews/20thoct03.html 1 0 0 0 /news/burmanbuildingpromotionwinningsquad 1 17027 0 0 /news/551a9677c63ca 2 15945 0 0 /news/kentleague/ramsgate/29thsept04.html 2 0 0 0 /news/lovellkeepsfaithwithtrabelsi-exclusiveinterview 1 12957 0 0 /news/peoplewanttocomeandplayforlordswoodnowsaysguest 1 19217 0 0 /news/hollandsblair180915 1 12154 0 0 /news/paulfoleybeatsthedeadlinetobringrobdennessbacktochathamtown 1 19039 0 0 /news/wforest021004.html 1 0 0 0 /news/horncray260423/ 3 77396 1 1 /news/551bc99dbe7a4/ryman/bromley/kentleague/tunbridgewells/23rdjuly03.html 2 15653 0 0 /news/corishep010221 3 81042 0 0 /news/apmacl130216 2 51006 0 0 /news/551a9bafe534b 3 66556 0 0 /news/chipstead231023 4 42462 1 1 /news/stanelmsA220222 6 181907 0 0 /news/halseywemustprovetooursupportersthatwereagoodside 1 11677 0 0 /news/551bc5e15be78 1 13702 0 0 /news/england110718 3 38252 0 0 /news/erithbelvedere0-4hernebay-wecouldntbewherewearewithout20playerssayssimonhalsey 1 21283 0 0 /news/551bc5db3fefd 3 27605 0 0 /news/craywanderers0-1wellingunited-impleasedtogetthroughtothenextroundsaysjamieday 1 25398 0 0 /news/holmesdalegettogripswithlifeinthekentleague-exclusive 1 12601 0 0 /news/kentleague/hythe/7thjuly03.html 1 0 0 0 /news/551bc99dbe7a4/kentleague/lordswood/kentleague/maidstone/15thaug03.html 2 15653 0 0 /news/resultsaprmay2019 2 101636 0 0 /news/craythames290915 3 72232 0 0 /news/cock-uphandscockfosterstie 1 11675 0 0 /news/tunbuxbr050823 1 32418 0 0 /news/myplayerswouldbenefitfromfull-timetrainingsaysambitiousdolby-exclusive 1 16300 0 0 /news/crayvalleywatson210817 1 17121 0 0 /news/someonesgoingtogetagoodhidingwarnswarrilow 1 16382 0 0 /news/551bc5df90e10 1 13056 0 0 /news/551bc99a972de 3 19933 1 1 /news/551a9798be265 1 5588 0 0 /news/551a99e3a0626 2 40844 0 0 /news/soccershorts210618 2 30585 0 0 /news/phoenixsports1-0hollandsblair-weshouldthankthecommiteefortitlewinsaysbeckingham 1 25005 0 0 /news/foresthillpark161118 1 12631 0 0 /news/tonbridgeangels1-0maidstoneunited-wegottheresultforthefanssaysstevemckimm 3 77931 0 1 /news/piggotttellhislordswoodplayersyoureplayingforyourfutures-exclusiveinterview 1 19877 0 0 /news/weretryingtofinishthejobwesetouttodosayshernebaybosssimonhalsey 1 17024 0 0 /news/551a96db358f9 2 15833 0 0 /news/thingshavebeenveryfrustratingforusintermsofthenewdevelopmentadmitskeithmcmahon 1 14397 0 0 /news/nothingswonorlostonsaturdaysaysphoenixsportsjoint-bosstonybeckingham 1 15418 0 0 /news/vcdathletic260721 2 23217 0 0 /news/burmangivennobleboostforseasonopener 1 17277 0 0 /news/lordswood100818 1 12691 0 0 /news/werelookingtogetbacktowinningwayssayshernebaybosssamdenly 1 12287 0 0 /news/gormangivesreservesthechancetoimpresshim-exclusiveinterview 1 15381 0 0 /news/stankspo230418 1 28341 0 0 /news/551bc99dbe7a4/nationwide/gillingham/kentleague/lordswood/1stjuly03.html 2 15653 0 0 /news/hollands100319 1 12739 0 0 /news/551a967739234 2 13186 0 0 /news/wehavetofollowinhythetownsfootstepssayshernebaybosssimonhalsey 1 16323 0 0 /news/ebbmaibro310517 1 15198 0 0 /news/afchornchurch1-1wellingunited 1 16574 0 0 /news/tonbgill110715 3 66254 0 0 /news/favershamtownunveilambitious25mredevelopmentplanstotransformsalterslane 1 13621 0 0 /news/lyddtown080416 1 15092 0 0 /news/hythetown1-1sittingbourne-icantputmyfingeronwhatsgonewrongathomesaysscottporter 1 21962 0 0 /news/ashford250918 2 14820 0 0 /news/lukerooney030421 1 12215 0 0 /news/tunwells180817 1 12371 0 0 /news/metpolice190405.html 1 0 0 0 /news/whenyoureplayingwellyouhavetoscoresaysgillinghamladiesbosssimonratcliffe 1 18750 0 0 /news/551a9cf560742 3 35818 0 0 /news/bromley020819 2 18360 0 0 /news/sittvnewp270304.html 1 0 0 0 /news/551a9678ef740 3 46025 0 0 /news/danishfootballfansbecomejointownersofcroydonathletic 1 16804 0 0 /news/consdeal080220 5 77376 1 1 /news/theseareexcitingtimesforthamesmeadinsistsmcmahon 1 17006 0 0 /news/leweseve111219 2 55770 0 0 /news/dartssendcarteroutonloan 1 12847 0 0 /news/dimmockreturnstohisspiritualhome-exclusiveinterview 2 15915 0 0 /news/cugleypleasedwithpre-seasonfitness 1 16491 0 0 /news/kentleague/thamesmead/10thoct03.html 1 0 0 0 /news/drmartens/eastern/sittingbourne/sittvroth030104a.html 1 0 0 0 /news/wfinchley090405.html 1 0 0 0 /news/phoenixsportsclub.co.uk 1 0 0 0 /news/thamesmead290416 3 29098 0 0 /news/afccroybeck280916 1 32994 0 0 /news/iwillbegettingmyselffitanddoingapre-seasonaswelackcharacters-obrien 1 18420 0 0 /news/ryman/bromley/bromvkingsfr290803.html 1 0 0 0 /archive-2006-2014/202 1 19223 0 0 /news/leighton120205.html 1 0 0 0 /news/ramsgate011119 2 25288 0 0 /news/551a9c930f09a 3 41092 0 0 /news/bromley100116 2 18382 0 0 /news/hytheissuerallyingcrytosupportpromotionpush 1 12231 0 0 /news/whitstabletown1-2ebbsfleetunited-wehadtodigdeeptoavoidagiant-killingsaysstevebrown 1 30116 0 0 /news/promotionisalwaysgoingtobethetargetofthisclubinthisleaguesaysdoverbossmartinhayes 1 17603 0 0 /news/soccershortsmoreclubswillsufferfinanciallywarnsjenner 1 31213 0 0 /news/playingyouthisourpolicysaysnewmargatebossashby 1 16537 0 0 /news/SuttonUnited120705.html 1 0 0 0 /news/551a9678235b0 2 20361 0 0 /news/soccershortscounciltocovercostofdealtownsnewclubhouse 1 14713 0 0 /news/beckenhamtown1-1holmesdale-weknewwewouldbeinforabattlesaysjasonhuntley 3 51421 0 1 /news/donsvisitwillattractourrecordcrowdof2000predictsangelschairman-exclusive 1 16935 0 0 /archive-2006-2014/115 1 20516 0 0 /news/dockerwemusttakeourchancesorwellgetpunished 1 16534 0 0 /news/matchreportschathampulloffanothershockresult 1 34718 0 0 /news/beckschairmantheresnothingtobefrightenedoff 1 15761 0 0 /news/rochesterunited121120 1 11221 0 0 /news/FAStatement180520 2 18691 0 0 /news/fisher301020 1 12459 0 0 /news/551bc5e75cf4a 2 16120 0 0 /news/beckenham200821 1 15294 0 0 /news/huntleysetforhealyshowdowntalks 1 16474 0 0 /news/551bc99cc460c 2 19917 0 0 /news/551bc5dd1ea23 1 13875 0 0 /news/weareverydisappointedthatthingsdidntworkoutforpeternottsayswhitstablevice-chairman 1 14873 0 0 /news/dartford071116 2 18968 0 0 /news/homelandssagatakesanothertwist-landlordsandtennantsissuestatementandcounterstatement 1 13832 0 0 /news/beckenham240818 1 12753 0 0 /news/eastkentcollegelaunchkentcountyleagueteam 1 12486 0 0 /news/551a9c0e92562 2 15805 0 0 /news/bromley040420 2 24361 0 0 /southern-counties-east-football-league/25 1 20444 0 0 /news/greenwich270418 2 28492 0 0 /news/facuprunwillstandusingoodsteadingettinganewgroundsaysgreenwichboroughspaulblade 1 16800 0 0 /news/551a9cf581413 3 32437 0 0 /kent-invicta-league/21 2 23973 0 0 /news/doverathletic0margate0 1 10612 0 0 /news/afccroydonathletic121018 1 12972 0 0 /news/welling250118 1 13114 0 0 /news/bromley230819 2 14887 0 0 /news/551bc5e48fe89 1 13804 0 0 /news/lukeblewden280517 2 26857 0 0 /news/hythetownskipperdavecookreturnsforclashattunbridgewells 1 14426 0 0 /news/othernews/26thoct03.html 2 0 0 0 /news/everyonesputtingexpectationonmyyoungplayersshoulderssayshernebaybosssimonhalsey 1 17741 0 0 /news/hernebay260620 2 24375 0 0 /news/tonbridgeangelsonline.co.uk 1 0 0 0 /news/greenstan290919 1 40250 0 0 /news/ithinkmostteamswillfearcomingtoourgroundsaysfavershamtownskipperjohnscarborough 1 17007 0 0 /news/itsafantasticfeelingtobeuptherewithwrexhamsaysdartfordbosstonyburman 1 14980 0 0 /news/beckenhamtown250622 3 34944 0 0 /conference-2003-2006 14 126699 2 3 /news/551bc99c9020f 2 20480 0 0 /southern-counties-east-football-league/59 1 19284 0 0 /news/29thfeb04.html 1 0 0 0 /news/creditcrunchfolkestoneinvictafacefinancialmeltdown 1 22109 0 0 /news/kentishfootballaresoproudofthefleetdaishhailshismagnificentheroes 1 14721 0 0 /news/illbereallypleasedifwereachthefavasequarter-finalssayshernebaybosssimonhalsey 1 16201 0 0 /news/controversialcorinthianmovewasapprovedbyfootballassociationinsistskentleaguechairman 1 13020 0 0 /news/551a96dba9847 2 19393 0 0 /news/ithinkthefixturelistisalittlebitcruelsaysebbsfleetunitedbossstevebrown 1 16443 0 0 /news/folkestone271017 2 26452 0 0 /news/creditcrunchkentclubssufferincurrenteconomicclimate 1 33063 0 0 /news/551a979843881 1 3914 0 0 /news/ebbsfleet301215 1 12266 0 0 /news/wellingunited1-3worcestercity-moreworcesterwoeforwings 1 15248 0 0 /news/erithtown1lordswood2 1 11173 0 0 /news/crayhern041221 3 69254 0 0 /drmartens/eastern/dartford/cray131205.html 1 9955 0 0 /news/phoenixsports220219 1 14684 0 0 /news/551a979996bea 1 4858 0 0 /news/fisher030519 1 12592 0 0 /archive-2006-2014/248 1 19362 0 0 /news/theclubisverycloseofgoingoutofexistenceifpeopledonthelpuswarnskeithmcmahon 1 22897 0 0 /news/ashford241118 3 27342 0 0 /news/chathamtown3-2burgesshilltown-ourplayersshowedmaturitybeyondtheiryears-obrien 1 22518 0 0 /news/dulwichhamlet140720 1 12784 0 0 /news/thirdcountycupsuccessmeantalottowakeling-exclusiveinterview 1 4635 0 0 /news/punjab090218 1 13771 0 0 /news/reserveteammanagerrequiredforwarlingham-tostartimmediately 1 10476 0 0 /news/enfieldtown1sittingbourne1 1 14455 0 0 /news/lordswood130619 1 11464 0 0 /news/thereslotstosortoutbeforeweapplyforthekentleaguesaysashfordtownchairman 1 17721 0 0 /news/551a96dbda869 1 4138 0 0 /news/doverathleticunveilmartinhayesastheirnewboss 1 11991 0 0 /news/tonbdul020116 3 84828 0 0 /news/551a96db48256 1 4226 0 0 /news/beckbinf011022 6 177113 0 0 /news/margfolk160923 5 179245 0 0 /news/suspensionscouldcostustheleaguewarnsfrustratedtrott 1 12156 0 0 /news/withaheavyheartihavebeenforcedtoresignsaysnickdavis 1 14529 0 0 /news/punjab091020 1 14768 0 0 /news/creditcrunchsupportthecluborrisklosingacoupleofplayerswarnscraychairman 1 13622 0 0 /isthmian-league/63 5 60778 0 0 /news/glebe110421 4 47022 0 0 /news/551a931da9ef1 1 11245 0 0 /news/bromley051218 2 15973 0 0 /news/wedontfeelanypressuresaystable-toppingmcmahon-exclusive 1 14927 0 0 /news/fatrophyspecialabbottenjoyssittingbournesawaytrips 1 13592 0 0 /news/davesmithtakesoveraslyddtownsnewmanager 1 13040 0 0 /news/551a96db6fb30 2 19082 0 0 /news/kcfarubberstampashfordunitedsaffiliation 1 13254 0 0 /news/oneyearsomeonewhospart-timewillgetintoplay-offssaysdartfordbosstonyburman 1 16586 0 0 /news/doverathleticfacupsecondroundclashmadeall-ticket 1 21518 0 0 /news/551bc5e4e1ec5 1 12209 0 0 /news/idontthinkwererelyingonfacupmoneysayswellingunitedbossjamieday 1 12878 0 0 /news/greenseven010116 1 15175 0 0 /news/dealtown301216 1 11505 0 0 /news/ryman/bromley/13thoct03.html 1 0 0 0 /news/wp-admin/xmrlpc.php 1 0 0 0 /news/bromley070920 2 16391 0 0 /archive-2006-2014/269 2 23961 0 0 /news/whitehawkisatoughtieatthisstageofthefacupsaysfolkestoneinvictabossneilcugley 1 14539 0 0 /news/ramsgate231219 18 95579 13 10 /news/soccershortsbromleyplacestrikerwarrenmcbeanonthetransferlist 1 48550 0 0 /news/wellingunitedunveiltheirnewmanager 1 11281 0 0 /news/ryman/bromley/T&Mvbrom060304.html 1 0 0 0 /archive-2006-2014/179 1 19252 0 0 /news/holmrust150823 6 180086 0 0 /news/4thnov04.html 1 0 0 0 /news/champions-electdoverhaveoneeyeonnextseason 1 22319 0 0 /news/vcd250816 2 27053 0 0 /news/30thdec05.html 1 0 0 0 /news/551bc5e528b45 2 26446 1 1 /news/551bc5dc3dc02 2 20912 0 0 /news/princesparkstadiumselectedasolympictrainingvenue 1 13423 0 0 /news/othernews/allsystemsgo.html 1 0 0 0 /news/holmelms071016 1 32286 0 0 /archive-2006-2014/251 1 19632 0 0 /news/imexcitedaboutbeinganintegralpartofayoungcambridgeunitedsidesaysharrisondunk 1 14223 0 0 /news/joeford010819 1 13336 0 0 /news/merssitt311017 2 55671 0 0 /news/hernebaybosssimonhalseywillbecluedupaheadoffacuptieagainstalresford 1 17026 0 0 /news/26thjune2003.html 1 0 0 0 /news/551bc5e90582c 1 13678 0 0 /news/kentleague/maidstone/16feb04.html 1 0 0 0 /news/luchfordupbeatdespitegillsthrashing 1 21937 0 0 /news/tonbridgeangels4-1whitstabletown-thereslightattheendofthetunnelsaysmunday 1 39546 0 0 /news/craywands310119 3 34701 0 0 /news/kentleague/lordswood/hillingdon231004.html 1 0 0 0 /news/craywands130219 3 37477 0 0 /news/ramsgate140719 2 27095 0 0 /news/vcdathletic2-3bideford-wevemissedagreatchancetoprogressadmitsford-exclusive 1 17309 0 0 /news/crayvalleypm1-1lancing-toscoreinthefacupismagicsayshistorymakerlewiswood 1 25449 0 0 /news/wemustapplyourselvesorwelllosegriponcupwarnsward 1 13887 0 0 /news/readtommysampsonsfirstblogonthekcfawebsite 1 12393 0 0 /news/tootfolk241017 3 67773 0 0 /news/weregoingtoworkhardtogetoutofthisleaguesaystonbridgeangelsbosstommywarrilow 1 15372 0 0 /news/outstandingshot-stopperstaysatbromley 1 11507 0 0 /news/fleetlewis190416 1 27338 0 0 /news/welldonethefleet-weresoproud 1 10818 0 0 /news/harrbrom070320 1 28688 0 0 /news/drmartens/eastern/erith&belvedere/23rdjune03.html 1 0 0 0 /news/bromley070716 2 17198 0 0 /news/wewanttobeinthetophalfplay-offsifwecansaysbromleycoachneilsmith 1 17986 0 0 /news/ivegotajobtodoandrectifywhatsgoingwrongawayfromhomesaystonbridgebossstevemckimm 1 16232 0 0 /news/erithandbelvedere090821 1 13396 0 0 /news/551bc99dbe7a4/kentcounty/kentleague/VCD/4thsept03.html 2 15653 0 0 /news/cantlord210417 1 15007 0 0 /news/drmartens/eastern/sittingbourne/erith&belvedere111204.html 1 0 0 0 /news/NationalLeagueSouth230920 2 17802 0 0 /news/ihavenoaxetogrindsaysex-favershambosscopley 1 13658 0 0 /news/ramsgate301004.html 1 0 0 0 /news/crockenhill250915 2 18453 0 0 /news/sittingbourne301020 2 27721 0 0 /news/551bc5dc9cbc7 3 33162 0 0 /news/lordswood021004.html 1 0 0 0 /news/charltonathletic040121 1 11922 0 0 /news/ramsworth051215 3 62719 0 0 /news/ashffave010122 6 204727 0 0 /news/gillingham310122 1 13409 0 0 /news/soccershortsfolkestoneinvictamustfind800permonthtopayofftaxbill 1 28603 0 0 /news/EFLStatement031220 2 19323 0 0 /news/glebe270722 1 12988 0 0 /news/551bc5de5c1c0 1 11380 0 0 /news/thetophalfofthetablewillbeasuccessforussayscorinthianbosstonysitford 1 14541 0 0 /news/wellgiveitourbestshotaswealwaysdosayssittingbournebossmattwyatt 1 15692 0 0 /news/lovellunveilstriplesignings 1 13001 0 0 /news/1stmar05.html 1 0 0 0 /news/tonbridgeangels1-0maidstoneunited-stonesbossandyfordplotshoudiniescapeact 1 34640 0 0 /news/holmesdale170120 2 18109 0 0 /news/chathamtown1-1kingstonian 1 12914 0 0 /news/crowborough190218 1 13377 0 0 /news/551bc5dbd47e0 4 46210 0 0 /news/abbottwantstokeepgoodmannersatbournepark-exclusive 1 20492 0 0 /news/chesterfieldofferwhitstabletownwingerscottheardatrial 2 15683 0 0 /news/wp-content/plugins/seofile/css.php 1 0 0 0 /drmartens/eastern/tonbridge/3rdfeb04.html 1 9955 0 0 /eastern-2003-2006 13 124951 1 1 /drmartens/eastern/erith&belvedere/1stsept05.html 1 9955 0 0 /news/wevegottoimproveonourtravels-hares 1 19036 0 0 /news/551bc99a7e299 2 19528 0 0 /news/wearereadyforthefightinsistsbirthdayboycugley 1 17009 0 0 /news/drmartens/eastern/ashford/ashfvfolk270104.html 1 0 0 0 /news/wp-includes/Requests/Text/css.php 1 0 0 0 /news/itsadayforhernebayheroessayswembleywinnertommysampson 1 28871 0 0 /news/itsoutofourhandsadmitsburman 1 16312 0 0 /news/bromley270518 2 19291 0 0 /news/wandsgaveusfootballlessonadmitscordice 2 17753 0 0 /news/wevereachedthefinalthehardwayadmitserithtownbosstonyrussell 1 20785 0 0 /news/beckenham020518 1 12560 0 0 /news/fansopenvirtualstadiumtoraisefundsformaidstoneunited 1 17022 0 0 /news/holmesdalecoachrossmitchelllooksforabettersolidcampaign 1 15908 0 0 /news/drmartens/eastern/dartford/12thoct03.html 1 0 0 0 /news/hytheofferincentivetoashfordfans 1 18090 0 0 /news/ramsgate261018 2 31385 0 0 /news/glebeandbromleygreensecuregroundsharedealstoprogress 1 12834 0 0 /news/pughsolvesdoverstrikercrisis 1 12313 0 0 /news/afccroydonathletic100818 1 13383 0 0 /news/drmartens/eastern/sittingbourne/rothwellvsittingbourne20903.html 2 0 0 0 /news/ramsgateskipperbenlasletthailsfamilyteamspirit 1 14643 0 0 /news/fixturelistoctober2013 2 71075 0 0 /news/wp-content/plugins/formcraft/file-upload/server/php/files/xo.php 1 0 0 0 /news/lewiphoe211218 1 33195 0 0 /news/551bc5e02ee7e 3 30986 0 0 /news/eritfish141123 2 22240 0 0 /news/becksev091116 1 29325 0 0 /news/maldontown1folkestoneinvicta0 1 13691 0 0 /news/551a931dacd3e 1 11321 0 0 /news/hollgleb040320 1 20099 0 0 /news/551bc99dbe7a4/kentleague/maidstone/kentleague/thamesmead/27thoct03.html 2 15653 0 0 /news/themovetowoodstockwillbreathenewlifeintotheclubsayssittingbournechairmanandyspice 1 21830 0 0 /news/erithtudor060617 1 11686 0 0 /news/maidenheadunited0-2bromley-ourgreatteamspiritisgettingresultssaysmarkgoldberg 1 23529 0 0 /news/commentistodaythedaythatfootballreallydoescomehome 1 17356 0 0 /news/551bc5dd72363 2 17264 0 0 /news/dealsout070821 1 28720 0 0 /news/lewrams061116 2 59481 0 0 /news/hernebay201104.html 1 0 0 0 /news/vcdathletic200523 1 12439 0 0 /news/hollandsblair0-2ashfordunited-iwantalitltebitmorefrommyplayerssayspaulchambers 1 21048 0 0 /news/othernews/londonseniorcup0405.html 1 0 0 0 /news/craywands221018 3 31016 0 0 /news/tunwells120205.html 1 0 0 0 /news/localhomegrownyouthisthewayforwardsaysashfordchief 1 21705 0 0 /news/551a967905150 3 35419 0 0 /news/soccershorts300721 2 43701 0 0 /news/ryman/bromley/bromvcroy131203.html 1 0 0 0 /news/soccershortsrockymcmillanstandsdownasglebemanager 1 35694 0 0 /news/conference/gravesend/19thfeb04.html 2 0 0 0 /news/551a97190438c 3 47064 0 0 /news/conference/margate/24thjune03.html 1 0 0 0 /news/551bc5e080561 1 17437 0 0 /news/551bc5df2175f 1 13975 0 0 /news/imstrugglingtoputateamoutadmitsfisherbossstevefirkins 1 12915 0 0 /news/pennockwearecapableofgettingintoplay-offs 2 16582 0 0 /news/551a9c0ea79c3 4 48691 0 0 /news/drmartens/eastern/folkestone/folkvhavantfatreplay021203.html 1 0 0 0 /news/wearelookingtobuildafoundationonwhichtoprogresssayssammacneil 1 12569 0 0 /news/dannywardweareatsouthwood-weexpecttowinexclusiveinterview 1 14264 0 0 /news/conference/margate/15thoct04.html 1 0 0 0 /news/ryman/bromley/26thjune03.html 1 0 0 0 /news/lordswood090218 1 12042 0 0 /news/fleettown1-1ramsgate-imnothappywithapoint-ward 1 26391 0 0 /news/erithbelvcroy010116 1 12759 0 0 /news/seagerimpressedwithwestwickhamonscoutingtrip 1 13296 0 0 /news/iamverydisappointedaboutthewayramsgatehaveactedovermydismissalsaysjustinluchford 1 22608 0 0 /news/551bc99e2ff89 2 22806 0 0 /news/greenwichboroughfc.co.uk 4 0 0 0 /news/chancetoseenewstadiumprogress 2 13752 0 0 /news/ashfordunited020220 3 27082 0 0 /news/wembleyheroesdaishasksthe25000fans-whenwillweseeyouagain 1 15846 0 0 /news/beckinghamletsmakeitadaytoremember 1 13923 0 0 /news/sheppey230717 1 13628 0 0 /news/bromsutt151218 2 41946 0 0 /news/4thjune05.html 2 0 0 0 /archive-2006-2014/287 2 22320 0 0 /news/hythe210316 2 28583 0 0 /news/bromley260216 2 19733 0 0 /news/kentleague/sladegreen/4thmar04.html 2 0 0 0 /news/theplayersaremorethandelightedtheclubhasbeensavedsayscugley 1 16990 0 0 /herne-bay-2003-2006 17 204467 3 2 /news/soccershorts270617 2 33743 0 0 /news/stadiumdreambecomesarealityforthamesmeadtown 1 14910 0 0 /news/551a979aa66e8 1 4898 0 0 /news/milesimplayingkidstooearly-exclusiveinterview 1 13143 0 0 /news/daviesquitsderestoseekfreshchallenges 1 13361 0 0 /news/Thamfave061217 2 46107 0 0 /news/itspointsontheboardthatmatter-wehavetowinourgamesinhandsaysalexobrien 1 16831 0 0 /news/beckenhamtown0-3erithtown-westoodupandwerecountedtonightsaysmarktompkins 1 30506 0 0 /news/histvsitt151103.html 1 0 0 0 /news/hollands171116 1 12153 0 0 /news/gov.uk/government/news/small-businesses-boosted-by-bounce-back-loans 1 0 0 0 /news/othernews/charltonladies7thsept03.html 1 0 0 0 /news/theroadtowembleyiwanttoreachthefirstroundfortheveryfirsttimesaysremy-exclusive 1 15582 0 0 /news/hopefullyinthefuturewellbeintherightleaguesayschathamtownbosskevinwatson 1 15627 0 0 /news/551bc5e1cfe9f 2 24122 0 0 /news/wemusttakeadvantageofbeingathomesaysmartinhayes 1 18371 0 0 /news/ebbsfleetunited2-1stalybridgeceltic-fleetkeeponehandonthetrophy 1 16804 0 0 /news/lyddtown281016 1 11719 0 0 /news/farnobg200516 1 12700 0 0 /news/551a9798277b1 1 3372 0 0 /news/whitstabletown0-1sittingbourne-pulmanwillgetusthegoalsinsistsmunday 1 23807 0 0 /news/bromley211016 2 15055 0 0 /news/weveblownhotandcoldthisseasonadmitstonbridgeangelsbosstommywarrilow 1 17047 0 0 /news/fisher020122 4 47750 0 0 /news/ashfordtown0-0dartford 1 13620 0 0 /news/itwillbeallwhiteonthenight 1 11661 0 0 /archive-2006-2014/79 1 20430 0 0 /news/551bc99dbe7a4/kentleague/lordswood/drmartens/cupdraw.html 2 15653 0 0 /news/dartford0-4dorchestertown-burmanimlookingformyplayerstorespondtohorrordefeat 1 25157 0 0 /news/wedoneedtopickupourformadmitssittingbournebossnickdavis 1 16131 0 0 /news/kentleague/VCD/20thjuly03.html 1 0 0 0 /news/551bc5dce6a65 1 11739 0 0 /news/kentleague/deal/Sampson16.html 1 0 0 0 /kent-invicta-league/31 2 23381 0 0 /news/22ndjuly03.html 1 0 0 0 /news/doverathleticbringscottishacesteventhomsontocrabble 1 14079 0 0 /news/wearedowntothebarebonesadmitslordswoodbosspiggott-exclusiveinterview 1 13350 0 0 /news/wevegottoavoidbeinginarelegationfightsaysbromleybossmarkgoldberg 1 13607 0 0 /news/erithbelvedere2-3vcdathletic-wevebeencheated-ragesgorman 1 22841 0 0 /news/facarlsbergvasethirdrounddraw 1 12943 0 0 /news/lyddwillbouncestraightbackinsistshughes 1 13618 0 0 /news/sittvchat261203.html 1 0 0 0 /southern-counties-east-football-league/11 2 39965 0 0 /news/551bc5e1bd340 2 24240 0 0 /news/asadtimeforkentfootball-restinpeaceroyvinter 2 21498 0 0 /archive-2006-2014/196 1 18826 0 0 /news/17thjune05.html 1 0 0 0 /news/551a96dc35eaa 3 41275 0 0 /gravesend-2003-2006 14 173696 0 0 /news/551bc5e58a9df 2 18483 0 0 /news/severithbel260815 1 28247 0 0 /news/holmfarn240719 1 32774 0 0 /news/ashfordsdroughtenjoyssuddendownpourofrain-exclusiveinterviews 1 18692 0 0 /news/ryman/bromley/bromvdulwlsc030204.html 1 0 0 0 /news/crayrams170923 5 184470 0 0 /news/wp-includes/IXR/wp-login.php 1 0 0 0 /news/wearenolongerpushoversinsistswhitstablechairman-exclusiveinterivew 2 22561 0 0 /news/ascottonb040916 3 71528 0 0 /news/itwouldbeanicelittlecatchtowinsomesilverwaresaysbridonropesmanagerdanielfrost 1 16471 0 0 /news/ryman/bromley/8thjuly03.html 1 0 0 0 /news/rusthall070416 2 17769 0 0 /news/abbebrom230419 2 35572 0 0 /news/551a9798573c6 2 17257 0 0 /news/previousplay-offheartbreakspursmeonsayspromotionchasingtrott 1 19950 0 0 /news/dontruleusoutinpromotionracesaysashfordchief 1 15957 0 0 /news/croydonchiefhashighhopesforleworthy 1 15644 0 0 /news/hillingdon291005.html 1 0 0 0 /news/16thdec04.html 1 0 0 0 /news/ksportsbordenvillage291121 2 26314 0 0 /news/faveleat301021 5 159035 0 0 /news/551bc5df51d5f 1 11745 0 0 /news/ourfantasticsupportersdeservetofinishtheseasonathomeonahighsaysbromleycoachsmith 1 18659 0 0 /news/stansfeld221021 4 52306 0 0 /news/thamesmead300805.html 1 0 0 0 /news/wellhaveafighttokeepwhitehouseadmitsfarnie-exclusiveinterview 1 15223 0 0 /news/fishersreturntorotherhithemovesastepcloser 1 18946 0 0 /news/bromley020817 1 11679 0 0 /news/pre-season2017 2 73243 0 0 /news/ryman/bromley/tilbury240704.html 1 0 0 0 /news/8thjune05.html 1 0 0 0 /news/greenwich291216 2 23784 0 0 /news/fisher191117 2 20221 0 0 /news/warrilow070116 2 35322 0 0 /news/wearesittingokintheleaguesayssittingbournebossnickdavis 1 14304 0 0 /news/wemustwinallthreeofthemsaysbromleydefenderliamharwood 1 16285 0 0 /news/weapologiseunreservedlytoeveryoneattheclubsayserithbelvederesecretaryfrankmay 1 15469 0 0 /news/551bc99b53a2b 2 16788 0 0 /news/imtryingtoassembleasquadcapableofgettingpromotednextseasonsaysjaysaunders 1 14698 0 0 /news/bartramdraftedintowingssquad 1 2934 0 0 /news/fiskwellgiveitourbestshotexclusiveinterview 1 13121 0 0 /news/tonbridgeangels2molesey0-angelslooktotheirhomecomforts-exclusiveinterview 1 19286 0 0 /news/551a931ddfdbb 1 11009 0 0 /news/wellingtown200223 1 12007 0 0 /news/folkestone260620 2 23843 0 0 /news/12thaug04.html 1 0 0 0 /news/maidstone210320 1 14450 0 0 /news/resultsaugust-september2011 1 56420 0 0 /news/551a9677e6947 2 15652 0 0 /news/551bc5e64ac1d 1 14742 0 0 /news/thamesmeadtown1-1carshaltonathletic-werenowhereneartheworstsidesayskeithmcmahon 1 25273 0 0 /news/sampsonappreciatesmessagesofsupport 1 11446 0 0 /news/erithandbelvedere020819 1 13053 0 0 /news/551bc99dbe7a4/drmartens/eastern/dartford/drmartens/eastern/chatham/10thnov03.html 2 15653 0 0 /news/erithtownunveilmarktompkinsastheirnewboss 1 13076 0 0 /news/marglaslett180515 1 18827 0 0 /news/wehavetomatchdartfordineverydepartmentsaysbromleycoachneilsmith 1 18684 0 0 /news/watcheuro2008atyourfootballclub 1 10719 0 0 /news/5thsept05.html 1 0 0 0 /news/ashfordunitedpulloffdoubletransfercoup 2 16933 0 0 /news/takeapuntonsomeonewhoishungrytosucceedsaysstaplehurstthird-teamboss 1 13142 0 0 /news/551a9cf53dc56 3 59387 0 0 /national-league/33 2 23428 0 0 /news/margate100818 2 25045 0 0 /news/stonesbossdelightedwiththefitnessofhisplayers 1 19269 0 0 /news/tributesfloodinforerithbelvederestalwart 1 18240 0 0 /news/wecanmixitwiththebestofthemsayshythetownbossscottporter 1 13660 0 0 /news/abusyweekendofkentishfootball 1 10950 0 0 /news/othernews/22nddec03.html 1 0 0 0 /news/551bc99dbe7a4/drmartens/premier/welling/drmartens/premier/welling/23rdsept03.html 2 15653 0 0 /news/othernews/24thJan04A.html 1 0 0 0 /news/cugleypraisesredbridgeskids 1 16093 0 0 /news/26thfeb04.html 1 0 0 0 /news/beckchic011122 3 26050 0 0 /news/savethewingscampaignkentsgreatfanscanplaytheirparttosavewellingunited 1 21047 0 0 /news/withsomeyoungplayersitlookstobeabrightfuturefortheclubsaysstevemckimm 1 12750 0 0 /news/tunwells060716 1 14101 0 0 /news/craywandererssearchforfriendly 1 11314 0 0 /news/acoupleofwinsthenweshouldbeoksayssittingbournebossjoedowley 1 15482 0 0 /news/imsurprisedwithourstarttotheseasonadmitsluchford 1 21035 0 0 /archive-2006-2014/203 1 19965 0 0 /news/wehavetodustourselvesoffandhavethatbeliefagainsayshernebaybosssimonhalsey 1 12703 0 0 /news/soccershorts110116 2 38586 0 0 /news/iwanttofinishthejobistartedsaysdolby 1 15418 0 0 /news/crowborough020418 1 17197 0 0 /news/crewealexandra1-0ebbsfleetunited-wevenotgotwhatwevedeservedadmitsprouddaish 1 21324 0 0 /news/551a95b412313 3 45676 0 0 /news/gillingham3-1charltonathletic-weredefinitelyintherewithatitleshoutsaysjackwheeler 1 35625 0 0 /news/erithbel240617 1 18176 0 0 /news/beckenhamtown2-1lewishamborough-werestrugglingabitupfrontadmitsjasonhuntley 1 21929 0 0 /news/off-coloursevenoaksgodownatwhitstable 1 11795 0 0 /news/werepreparingfornextyearsayslarkin 1 18231 0 0 /news/551a9c92f1483 3 48148 0 0 /news/resultsandforthcomingfixtures 1 72524 0 0 /news/suttonath180416 1 14609 0 0 /news/fleetplanforhattersvisit 1 14926 0 0 /index.php 11 111405 4 2 /news-conference-2003-2006/southern-counties-east-football-league 1 2510 0 0 /news/glebkspo110422 4 139574 0 0 /southern-counties-east-football-league/23 1 20620 0 0 /news/rymanleagueannouncefixtures 1 24376 0 0 /news/othernews/16thfeb04.html 1 0 0 0 /news/stoneschairmanissuesrallyingcryforbetterhomesupport 1 17127 0 0 /news/551bc5e835352 2 20398 0 0 /news/wevegot17cupfinalsremainingsaysmunday 1 20254 0 0 /news/hopefullywecantakeituptothenextlevelandprogresssayssevenacresidcupbossleehill 1 16082 0 0 /news/1stnov03.html 1 0 0 0 /kent-county-league/15 2 26063 0 0 /news/folkestoneinvicta091122 2 29705 0 0 /news/wp-admin/maint/maint/ajax-actions.php 1 0 0 0 /news/idehill301219 1 11512 0 0 /news/drmartens/eastern/sittingbourne/burnvsitt200304.html 1 0 0 0 /news/ryman/bromley/12thsept03.html 1 0 0 0 /news/carsmarg011018 3 63098 0 0 /news/orpington041015 1 13540 0 0 /news/dartford2-1ware-thepressureisallonsudburysaysburman 1 22175 0 0 /news/derestraveltowarlinghamfordoubleheader 1 10315 0 0 /news/22ndaug05.html 1 0 0 0 /news/binkswerestillinwithachancetosneakintotheplay-offplacesexclusiveinterview 2 25334 0 0 /news/russellvcdcray040515 2 24022 0 0 /news/nickysouthallresignsaswhitstabletownbossfollowingdisagreementwithbudgets 1 13518 0 0 /news/stonesareraringtogo 1 10955 0 0 /archive-2006-2014/87 1 20702 0 0 /news/551a99e42dc0a 1 12044 0 0 /news/berkhamstedtown1sittingbourne3 2 19952 0 0 /news/fiskexpectsanothertoughbattleagainstvickers 1 13197 0 0 /news/imgivingmyplayersmoreminutesonthepitchagainstlionssaysburman 1 18624 0 0 /news/kentseniorcupisnotmyprioritysayshessenthaler 1 14480 0 0 /news/wearealldesperatetodowellsaysdoverathleticbosschriskinnear 1 14678 0 0 /news/chathamtown2-0wingatefinchley-barnetthasbeenthefindoftheseasonsaysbinks 1 16506 0 0 /news/fishcval090215 1 29994 0 0 /news/soccershortswecantoverspendsayshessenthaler 1 57181 0 0 /news/facupfourthrounddraw 1 10448 0 0 /news/soccershortswarrilowforcedtoriskstarsforleaguecuptie-exclusive 1 23153 0 0 /news/whitstabletown1-0ramsgate-youcantlosehereandexpecttogetintothetopfivesaysward 1 24496 0 0 /news/ryman/26thjune03.html 1 0 0 0 /news/robbinsiwanthungryplayers-exclusiveinterview 1 11478 0 0 /news/551bc5dae34d4 4 38462 0 0 /news/vcdfarn171115 2 58577 0 0 /news/doverathletic2-0wellingunited-wehavenothingtofearsaysunbeatenhessenthaler 1 26424 0 0 /news/gillingham2-3nottinghamforest-theygavemeeverythingsaysgillinghambossjamesmarrs 1 24015 0 0 /news/sittingbourne010617 2 24376 0 0 /news/551a979a5d630 1 15895 0 0 /news/dorkwherne120316 2 56095 0 0 /news/warrilowdraftsinclarketocementplay-offplace 1 15215 0 0 /news/drmartens/premier/welling/margate021104.html 1 0 0 0 /news/wellingtown121020 1 16202 0 0 /news/tunbridgewells190119 1 13107 0 0 /news/idontwantittostartfallingapartsaysdartfordbosstonyburman 1 15370 0 0 /news/footballworldsupportsewell 1 11440 0 0 /news/favebeck240123 5 177385 0 0 /news/crosbietheclockstickingforconferencefootball 1 12958 0 0 /news/wewantasidefulloflocalplayerssayswellsbossfarnie 1 11902 0 0 /news/kfu090218 1 13757 0 0 /news/theroadtowembleyunderdogscanupsetthefavouriteswarnsburman-exclusive 1 13808 0 0 /news/551a99e4890e5 1 15112 0 0 /news/theresnotmanyteamsthatcancompetewithusinthisleaguesaysnickyforster 1 14745 0 0 /news/otfordunited0-3fleetdownunited-werecapableofupsettingafewteamssaysfleetdownboss 1 22369 0 0 /news/27thoct05.html 1 0 0 0 //www.mymolsoncoors.c 1 3711 0 0 /news/551a96db62163 2 14423 0 0 /news/551a9cf5507bc 3 40182 0 0 /news/dontforgettommysampsonsbenefitnightisonsaturdaynight 1 11624 0 0 /news/bromley270616 2 17882 0 0 /news/newfleetgroundideallywithinthreeyears 1 11790 0 0 /news/craywanderers010223 3 27314 0 0 /news/wardcallsforcharachterduringramsgatesbadpatch 1 17332 0 0 /news/wewereluckyadmitsmiles-exclusive 1 12699 0 0 /news/fiskleaveshythetownaresevenyearsservice 1 14106 0 0 /news/seagerunveilstwonewsigningstoaddcompetition 1 15129 0 0 /news/metropolitanpolice2-1folkestoneinvicta 1 17237 0 0 /news/walthamforest231004.html 1 0 0 0 /news/theplay-offsaretheminimumsayscraywanderersassistantpaulblade 1 12800 0 0 /news/404.php 1 0 0 0 /news/hastingsunitedladies1gravesendnorthfleetladies4 1 14386 0 0 /archive-2006-2014/21 2 26111 0 0 /news/phoenix281217 3 30623 0 0 /news/essexsidelaunchinitiative 1 11692 0 0 /news/daishbolstershissquadwithloansigninghearn 1 11531 0 0 /news/551bc99e29a64 2 32139 0 0 /news/wetweathercausesfixturehavoc 1 15175 0 0 /news/lyddtown270723 4 54510 0 0 /news/551bc5e876ea0 1 11334 0 0 /news/rymanreportssaturday9thdecember2006 1 19932 0 0 /news/551bc99dbe7a4/drmartens/eastern/ashford/drmartens/eastern/sittingbourne/sittingbournevwhyteleafe130903.html 2 15653 0 0 /news/551bc99aae600 1 4249 0 0 /news/bearsted171016 1 13519 0 0 /news/weneedtorememberhowfarwehavecomesaysfoley 1 17661 0 0 /news/wellingunited221119 1 12568 0 0 /news/551a99e54e2c8 1 17627 0 0 /news/stoneschairmanconsideringhisoptions 1 15774 0 0 /news/wehavetogetthejobdoneandcomeawayfromsportingbengalwiththreepointssaysrickybennett 1 16277 0 0 /news/metpolice230805.html 1 0 0 0 /news/thamesmeadtown1-0tunbridgewells-cablesclassprovestobedifference-exclusive 1 20734 0 0 /news/othernews/17thjuly03.html 1 0 0 0 /news/wellbebetternextseasonsaysdartfordbosstonyburman 1 13978 0 0 /news/racistabusehbeb121119 1 12756 0 0 /news/chathamtown2-0whitstabletown-iwanttopsixinapril-obrien 1 19600 0 0 /news/twointherunningforfishermanagementjob 1 22749 0 0 /news/sevenoaks010718 2 25281 0 0 /news/551a979a3f26e 1 5363 0 0 /news/sittingbourne2-4bartonrovers 1 14860 0 0 /news/telfordbringssomefamiliarfacestolordswood 1 10833 0 0 /news/imsurewecangoontobetterthingssaysbridonropesassistantkrishollidge 1 13323 0 0 /news/craywanderersacademyisafantasticsettingtofurtheryourcareersaysdarrenanslow 2 27469 0 0 /news/wellbetreatinghollandsblairseriouslysaysramsgatebosstimdixon 1 17333 0 0 /news/weneedtobeinthesouthpurelyforthefinancialaspectsayschathamtownbosskevinwatson 1 15504 0 0 /news/afcwimbledonsgreatescapeexclusivereactionfromthanet 1 15355 0 0 /news/chathamtown120422 1 12449 0 0 /news/glebkenn051220 5 161948 0 0 /news/atop-eightfinishwillbedeemedasasuccessfulseasonsaysderesbossmickycollins 1 20079 0 0 /news/fcelmstead070220 1 13277 0 0 /news/551a956caf380 1 6077 0 0 /news/beckenham210220 1 14165 0 0 /news/phoenix130816 2 24402 0 0 /news/551a9c0e4c4f7 2 15060 0 0 /news/soccershortsmargatepayofftaxbill 1 46656 0 0 /news/551a96787835e 3 50862 0 0 /news/ifwedontdowellenoughthenitsmyfaultsaysmargatebossiainoconnell 1 18004 0 0 /news/craywands121118 3 33889 0 0 /news/whitstabletown1-4craywanderers-wevegotarealchancetowintitle-jenkins 1 16581 0 0 /news/robleavesswanstiedupinaknott 1 17636 0 0 /news/wevegotthebestkentleaguestrikeforceclaimsgorman 1 15231 0 0 /news/hawkingetown241019 2 17939 1 1 /news/othernews/15thaug03.html 1 0 0 0 /news/551a99e3581f2 1 14388 0 0 /news/gillinghamapproachdoverathleticforhessenthaler 1 13287 0 0 /news/itsawrenchtoleavefisheradmitsassistantmanagerbryanglover 1 13314 0 0 /news/stoneschairmanstampsdownonill-discipline 1 12073 0 0 /news/hernebay010718 2 24258 0 0 /news/NationalLeague181121 2 15523 0 0 /news/franniecollinheadsgoalscoringchartsinkent 1 12411 0 0 /news/whitstabletownbeginsearchforreserveteamcoach 1 11206 0 0 /news/wevegotnothingtofearsayswellingunitedplayer-managerjamieday 1 13491 0 0 /news/vcdmaid110717 2 64738 0 0 /news/kennington280218 1 15202 0 0 /news/kentleague/sladegreen/13thoct04.html 1 0 0 0 /news/551a96dbd8acd 3 25350 0 0 /news/hollands290617 1 12579 0 0 /news/551a956cd87a1 1 5864 0 0 /news/thamesmeadbossmcmahontargetstop-tenfinish 1 14214 0 0 /news/beckenhamtown0-0erithtown-wastellleavesdominantbecksfrustrated 1 17957 0 0 /news/wedothebestwecanwiththeresourceswehaveavailablesaysfisherbossgarylisney 1 14022 0 0 /news/chatham241116 3 28378 0 0 /news/namechangeforgravesendnorthfleet 1 15840 0 0 /news/17thsept04.html 1 0 0 0 /news/beckenham170716 1 14297 0 0 /news/551bc5e7c41b2 1 16696 0 0 /news/craywanderers1-0southpark-last-gasplaurenthamicideliverssouthparkaknockoutpunch 1 35148 0 0 /news/dartford2-0mansfieldtown-werethirdonmeritsaysprouddartfordbosstonyburman 1 24268 0 0 /news/hytheheroesherefordaway-itfeelslikewevewonthefacup-saysskipperdavecook 1 19453 0 0 /news/tonbridge030317 2 26312 0 0 /news/walkervowstoresurrectsleepinggiant-exclusive 1 13809 0 0 /news/7thfeb05.html 1 0 0 0 /news/soccershortssevenoakstownbosskeithlevettslamsplayersoverlackofprofessionalism 1 67199 0 0 /news/551a931e48cea 1 12523 0 0 /news/dartford030919 3 19517 1 1 /kent-invicta-league/24 2 23995 0 0 /news/soccershortsiregretmyactionssayssuttonunitedbossdoswell 1 28120 0 0 /news/thecrowdshavebeendisappointingthisyearadmitsramsgatebosstimdixon 1 15979 0 0 /news/sewellcharitymatchbringsoutthestars 1 15248 0 0 /news/elmsorp070815 1 35383 0 0 /news/sporelms021222 3 78514 0 0 /news/ijumpedatthechancetobringshaunwelfordtomargatesaysbossiainoconnell 1 21991 0 0 /news/ryman/bromley/17thsept04.html 1 0 0 0 /news/tonbridgeangels0-10brentford-ijustfeelalittlebitletdownadmitsembarrassedwarrilow 1 23284 0 0 /news/551bc5dd91be7 2 18032 0 0 /news/551a9cf57e6be 3 33618 0 0 /news/sittingbourne291120 2 23348 0 0 /news/weregoingtomakeafistofitsaystonbridgeangelsbosstommywarrilow 1 17837 0 0 /news/thamesmeadtown4-1maidstoneunited-wellfightourwayoutoftroublesayskeithmcmahon 1 35448 0 0 /news/trophywinningbossinstilsanovermydeadbodyattitudeintohisplayers-exclusiveinterview 1 17816 0 0 /news/burmantellsfanstoraisetheroofasdartsreturntotheirbreadandbutter 1 13840 0 0 /news/collcroy300823 3 55854 0 0 /news/drmartens/eastern/erith&belvedere/19thoct04.html 1 0 0 0 /news/wealdstone171205.html 1 0 0 0 /news/rawplayerslookingtoshineathernebay 1 12065 0 0 /news/wecouldntworkwithoutanyfundssaysmiles-exclusive 1 16413 0 0 /news/hasimdeenplacedontransferlistbytrott-exclusive 1 13262 0 0 /news/hollandsandblair090421 1 11326 0 0 /news/fixturessaturday19thaugust2006 1 45277 0 0 /news/dover090815 1 12117 0 0 /news/letsendtheseasoninstylesayswhitstablechairman-exclusiveinterviews 1 17708 0 0 /news/pottersbartown290122 2 26245 0 0 /news/sponsorourlivecoverageovertheeasterperiod 1 11037 0 0 /news/princesparkcompletitiondateremainsontarget 1 11480 0 0 /news/doverathletic100920 1 11317 0 0 /news/bridpunj080120 2 42634 0 0 /news/beckenhamtown230422 2 24690 0 0 /news/erith210804.html 1 0 0 0 /news/wehavenopressureonusbeingtheunderdogsayscorinthianbossmattlonghurst 1 16427 0 0 /news/cray090915 3 42077 0 0 /news/551a9c0f3ed04 2 18138 0 0 /news/northwich250305.html 2 0 0 0 /news/lordswood030217 1 13177 0 0 /news/thelightsgooutatebbsfleetunited 1 15138 0 0 /news/saturdayssoccer11thmarch2006 1 12122 0 0 /news/invictaleague260216 1 13570 0 0 /news/wingate280804.html 1 0 0 0 /news/pecklong090415 2 64864 0 0 /news/myplayershaveapointtoproveagainstinvictaadmitshythebossfisk-exclusive 1 14610 0 0 /news/14thmar05.html 1 0 0 0 /news/wembleywinnersclubreflectonajobwelldone 1 15030 0 0 /news/folkestoneinvicta310523 2 29951 0 0 /news/wegavethemtoomuchrespectadmitsharris-exclusive 1 17613 0 0 /news/everyonesfullyawarewhattheprizeissaystunbridgewellsbossmartinlarkin 1 16698 0 0 /news/vcd190205.html 1 0 0 0 /news/bromley281118 2 22764 0 0 /news/bromvthurrockfac111003.html 1 0 0 0 /news/greenwichborough3-1tunbridgewells-iwasquiteconfidentwewouldwinitsaysjohncumberbatch 1 32813 0 0 /news/croydonath220917 1 12733 0 0 /news/fcelmssct211016 1 36148 0 0 /news/kentleague/ramsgate/kingstonian180904.html 1 0 0 0 /news/kentyouth/22ndjune03.html 1 0 0 0 /news/wemassivelyunderachievedlastyearadmitsmiltonfulstonbossaaronperry 1 22979 0 0 /news/bromvcor130304.html 1 0 0 0 /news/werenotlookingforanythingelseotherthanpromotionsaysmargatebossterrybrown 1 15647 0 0 /news/551bc5e7171f1 1 18938 0 0 /news/bromgrims190116 2 13690 0 0 /news/corinthian090819 1 12472 0 0 /news/greenwichboroughfacemake-or-breakgroundsharetalks 1 15786 0 0 /news/resultsseptember2022 3 168066 0 0 /news/551a92509a1a1 1 3312 0 0 /news/551bc5e1a1fec 2 26594 0 0 /news/maidstone301004.html 1 0 0 0 /news/551bc5e22d411 1 15217 0 0 /news/dartford1-3chathamtown 1 14476 0 0 /news/glebe291119 1 12264 0 0 /news/signingexperiencedplayersisdifficultadmitssladegreenboss 1 12196 0 0 /news/larkinconsignedtolosingstarcharliesharman 1 15730 0 0 /news/ebelnshi280215 1 26991 0 0 /news/burmancupcompetitionsareimportanttous-exclusiveinterview 1 14265 0 0 /news/yorathquitsmargateicouldntgetenoughoutofmyplayers 1 14995 0 0 /news/551bc5e7d44e3 2 15422 0 0 /news/margateissuerallyingcrytostayawayfans 1 11882 0 0 /news/sidneywarden13062018 2 27866 0 0 /news/quartetsigncontractstostaywithstones 1 12151 0 0 /news/551bc99dbe7a4/drmartens/premier/welling/ryman/bromley/bromvwalton060903.html 2 15653 0 0 /news/wewillnotrolloveranddieinsistsheaslewood-exclusiveinterview 1 11389 0 0 /news/23rdnov03.html 1 0 0 0 /news/facarlsbergtrophythirdqualifyingrounddraw 1 11262 0 0 /news/551a925006ece 2 16178 0 0 /news/queenspark150721 1 12118 0 0 /news/551a9c91666bd 2 15675 0 0 /news/crowborough210819 1 11781 0 0 /news/551a9798e2459 1 5484 0 0 /news/fleetreadyfortheirdayofdestiny 1 12047 0 0 /news/chessington150721 2 15162 0 0 /news/beckcori160822 6 197921 0 0 /news/wp-admin/ajax-actions.php 1 0 0 0 /news/spillerrelisheshisfreshstartatresurgentashfordtown-exclusive 1 15161 0 0 /news/16thnov04.html 1 0 0 0 /news/iwanthomeadvantageintheplay-offssayswarrilow 1 15704 0 0 /news/resultsjulyaugust2023 4 132578 0 0 /news/iwantustoplayforthingsandnotmakethenumbersupsaystonbridgeangelsbosstommywarrilow 1 15473 0 0 /news/551a9c0e74231 2 30679 0 0 /news/ifwestayupinourfirstseasonitwillbeafantasticachievementsayswellingbossjamieday 1 13993 0 0 /news/wellingunited1-2woking-defensiveinjuriescostus-admitspositiveford 1 29709 0 0 /news/pennockrelishestoughtestfromcharltonsstars-exclusive 1 15416 0 0 /news/livecoveragetonbridgeangels4-0hendon-angelsplay-offpushisrightonq 1 23910 0 0 /news/wevegottohitthegroundrunningsaysphoenixsportsjoint-bosssteveoboyle 1 14385 0 0 /news/551a96db8f381 2 14386 0 0 /news/kennshor111020 4 119974 0 0 /news/walkertellsdoverboardthanksforshowingfaithinme 1 14483 0 0 /news/folkestoneinvicta051120 2 27107 0 0 /news/iwasprettysureiwasheadingtohythetownsaysstrikerlukeharvey 1 15241 0 0 /news/dealtown200522 1 11839 0 0 /news/margatemaketheirpointathastings 1 12046 0 0 /news/3rdjan05.html 1 0 0 0 /news/sladevhyth130304.html 1 0 0 0 /news/mylong-termaimistolookathomegrowntalentsaysbutler 1 15806 0 0 /news/551a9c0f183d2 2 20515 0 0 /news/551a956bcbdd7 2 20388 0 0 /news/wp-admin/maint/css.php 1 0 0 0 /news/stanwemb070822 4 130266 0 0 /news/fatrophyspecialdefenderleemakeshiscomebackfromhorrificleginjury 1 12989 0 0 /news/eastwell221019 1 28639 0 0 /news/wewillbouncebackfromfacupexitinsistsburman 1 16040 0 0 /news/wp-admin/css/index.php 3 0 0 0 /news/championshipmanagerrymanleaguecup-tripletroubleforkentsremainingthreesides 1 11262 0 0 /news/margate1millwall1wewillbefitterbeforethestartoftheleagueseasoninsiststrott 1 18691 0 0 /news/margatedirectorpipertargetsplay-offplaces 1 16595 0 0 /news/bromley010718 2 18429 0 0 /news/kentleague/cray/30thaug03.html 1 0 0 0 /news/wewillturnitaroundinsistsmiles-exclusiveinterview 1 15014 0 0 /news/kentleague/sladegreen/sladevcray100204.html 1 0 0 0 /news/facupspecialgiantslookforwardtofacupshowdown 1 17621 0 0 /news/thamesmeadtownbosskeithmcmahongoestomarkettosignrichardbutler 1 13321 0 0 /news/folkestoneinvictasettoearn20kthrougheducation 1 20146 0 0 /news/soccershorts060616 1 15758 0 0 /news/wecanonlygoupatthemomentsayslovell 1 20926 0 0 /news/551bc5daa5317 4 33860 0 1 /news/thebarrhasnowbeenraisedadmitsangelschairmansullivan-exclusive 1 12322 0 0 /news/craywands100716 3 28019 0 0 /news/dartfordfansfuryoverwalthamforestpricehike 1 14107 0 0 /news/dartssignbarnesfromrivalsmaidstoneunited 1 12011 0 0 /archive-2006-2014/243 1 19248 0 0 /news/sittverit181103.html 1 0 0 0 /news/craywands021015 3 37198 0 0 /news/551a9798db589 1 4754 0 0 /news/greenvslade281003.html 1 0 0 0 /archive-2006-2014/99 1 20690 0 0 /news/crayvalley210820 3 28174 0 0 /news/folkestoneinvictasignbrendoncassfromchathamtown 1 13879 0 0 /news/soccershorts160519 2 43343 0 0 /news/551a9677642f9 2 15071 0 0 /news/551bc5e4cc107 1 11554 0 0 /news/551bc5e8b58b6 1 11233 0 0 /news/sutton190205.html 1 0 0 0 /news/newbosssimonhalseykeepslordswoodmanagementteamtogether 1 11894 0 0 /news/starmanwallisreturnstodoverathletic 1 15921 0 0 /news/2ndnov05.html 1 0 0 0 /news/tunbridgewells030715 1 17307 0 0 /news/canterbury201016 1 13098 0 0 /news/fleetfanshavetodelveintotheirpocketstoretainplayers 1 13486 0 0 /news/ryman/bromley/bromvmetr151103.html 1 0 0 0 /news/gillsbossandyhessenthalertellsscottporterimheretohelpyou 1 22159 0 0 /news/pre-seasonfriendlies-1 1 10107 0 0 /news/sittingbourne300819 3 37784 0 0 /news/crowboroughathleticdefenderchrisransomebecomesclubsshirtsponsor 2 17244 0 0 /news/chessingtonvsladefr260703.html 1 0 0 0 /news/myjobistoproduceconferencequalityplayerssaysdocker-exclusive 1 15747 0 0 /news/rymanleaguecupdrawfivekentderbiesinchampionshipmanagercupdraw 1 15413 0 0 /news/canterbuty180915 1 12791 0 0 /news/551bc5e77f8c1 1 14245 0 0 /news/crayleat190122 6 144199 0 0 /news/conference/margate/19thnov03.html 1 0 0 0 /news/hernebay200517 2 32172 0 0 /news/kentpairbenefitfromafcwimbledonsremoval 1 13348 0 0 /news/551a931e077b8 1 15309 0 0 /news/erithbelvedere2-0whitstabletown 1 14754 0 0 /news/551bc5e71f5aa 1 14904 0 0 /news/canterbury021015 1 12210 0 0 /news/551bc5e29881d 1 12774 0 0 /news/familyorientedclubtargetkentleagueinfiveyears 1 15481 0 0 /news/maidstone200805.html 1 0 0 0 /news/551a9c93045a2 3 47313 0 0 /.well-known/ 4 2286 1 1 /news/illbepleasedwithmidtableadmitsboroughbossmiles-exclusive 1 14216 0 0 /news/kentleague/thamesmead/21stjuly04A.html 1 0 0 0 /news/551bc99dbe7a4/drmartens/premier/dover/kentyouth/02-03honours.html 2 15653 0 0 /news/maidstone010820 1 12847 0 0 /news/glebtunb211123 3 95161 0 1 /news/ryman/bromley/7thjuly04.html 2 0 0 0 /news/weprobablyneedthreeorfourverygoodplayerstomountachallengesaysoboyle 1 13579 0 0 /news/fcelmstead010819 1 13356 0 0 /news/soccershortssladegreenkeeptheirfeetonthegrounddespitetengoalromp-exclusive 2 39377 0 0 /news/thamesmead230618 2 29248 0 0 /news/dulwich110318 2 24437 0 0 /news/conference/margate/26thfeb04.html 1 0 0 0 /news/551bc5e8d1584 1 13087 0 0 /news/strugglingwhitstabletownpartcompanywithmunday 1 15947 0 0 /news/drmartens/premier/welling/2ndjuly03.html 1 0 0 0 /news/drmartens/eastern/ashford/23rdaug04T.html 1 0 0 0 /news/matchreportsderesunveildimmocksigning 1 24656 0 0 /news/kentleague/cray/crayvsevenoaks200903.html 1 0 0 0 /news/imkeepingtheladsontheirtoessaystonbridgeangelsbosstommywarrilow 1 14252 0 0 /news/bridtunb190918 2 41458 0 0 /news/lordswood150520 2 15242 1 0 /news/551bc99dbe7a4/drmartens/eastern/dartford/drmartens/eastern/folkestone/10thjuly03.html 2 15653 0 0 /news/551bc5e540850 2 27277 1 0 /news/fleethoppingmadwith10-cardtrickofficial 1 17610 0 0 /news/credittotheboysforkeepingusintheconferencesayswellingunitedbossjamieday 2 16383 0 0 /news/thefacarlsbergvasesecondrounddraw 1 13898 0 0 /news/551bc5dc4e163 3 38075 0 0 /news/fordwaryofbromleyreaction 1 12585 0 0 /news/kinetic181121 2 26858 0 0 /news/weknowitsaworkinprogresssayshythetownassistantdarrenbeale 2 20209 0 0 /news/hollands100219 1 13961 0 0 /news/tunbridgewells250222 1 11832 0 0 /news/masonhailsfavershamsupport 1 14616 0 0 /news/Hamble250904.html 1 0 0 0 /news/kentleague/ramsgate/20thoct03.html 1 0 0 0 /news/thebigkickoffmyaimispromotionsaysburman-exclusive 1 15165 0 0 /news/hythetownsearchforfriendlyawaydate 1 11762 0 0 /news/gravesham110817 1 13594 0 0 /news/551bc5e87f7a8 1 12533 0 0 /news/winfolk140217 2 61173 0 0 /news/fisher130620 1 11481 0 0 /news/kspogleb210222 1 0 0 0 /news/551bc5e09bcba 1 24630 0 0 /news/thefatoprovidefundingfornewkentinvictaleague 1 12489 0 0 /news/kingstonian5-1sittingbourne-wegiftedthemfivegoalsadmitslovell-exclusive 1 21224 0 0 /news/FAStatement170720 3 26731 0 0 /news/kidscanbeourguestssayslordswoodnumbertwo 1 20687 0 0 /news/phoechar021116 2 62234 0 0 /news/ebbsfleet140116 1 14935 0 0 /news/dartford2-4gillingham-burchillcausesdartsastrikerheadache 1 25124 0 0 /news/sittingbourne070123 3 37151 1 1 /news/favershamtownscoop3000growthegamegrantfromthefootballfoundation 1 15214 0 0 /news/5thdec03.html 1 0 0 0 // 1 3771 1 1 /news/rustroch280318 1 11403 0 0 /news/sittingbournejobcameattherighttimeformesaysabbott-exclusive 1 17521 0 0 /news/robbinsconfidentforlengthyvaseawayday 1 16673 0 0 /news/weregoingtogiveiteverythingthatwevegotsaysbromleybossmarkgoldberg 2 27339 0 0 /news/551bc99dbe7a4/kentyouth/ryman/bromley/16thjuly03.html 2 15653 0 0 /news/weredeterminedtosucceedvowsseager 1 15870 0 0 /news/hessenthalerunveilsshort-termbodkindeal 1 12666 0 0 /news/KentFA060820 2 15637 0 0 /news/kentleague/sladegreen/sladevgreen140204.html 1 0 0 0 /news/551bc99dbe7a4/conference/margate/drmartens/eastern/sittingbourne/hastvsitt201203.html 2 15653 0 0 /news/wellgiveiteverythingthatwevegotsayslyddtownbossdavesmith 1 15993 0 0 /news/wevegotnothingtoloseandeverythingtogainsaysfolkestoneinvictabossneilcugley 1 14356 0 0 /news/werecontinuingtoworkhardonaddingtothesquadsayswellingunitedbossjamieday 1 16435 0 0 /news/bromleystand190518 3 27824 1 1 /news/bromvashfordfac160903.html 1 0 0 0 /news/28thJan04.html 1 0 0 0 /news/erithandbelvedere090620 1 13517 0 0 /archive-2006-2014/267 2 23657 0 0 /news/beaconsfield190205.html 1 0 0 0 /news/bromleyontheorientbromleywillbringaspecialcupatmospheretobrisbaneroad-barryhearn 1 15898 0 0 /news/croydon051121 1 12792 0 0 /news/craywanderers1-1lowestofttown-ithinkourpositionisperfectsaysianjenkins 1 23520 0 0 /news/wearestrugglingtoputoutafirstteamsquadadmitsrusthallbossgarysharman 1 13474 0 0 /news/dulwichhamletp-pcraywanderers 1 10155 0 0 /news/tunbridgewells1vcdathletic1aet-vcdathleticwin3-1onpenalties-exclusiveinterview 1 17793 0 0 /news/thamvcd110317 2 67067 0 0 /archive-2006-2014/194 1 19192 0 0 /news/551a956c134ec 1 3454 0 0 /news/warrilowwantsmorefluencyfromhisside 1 16183 0 0 /news/thesignofagoodsideishowmanypointsyoutakeagainstsidesbelowyousaystonyburman 1 13393 0 0 /news/dulwichhamlet2-4ramsgate-zackthomasisanametoberememberedsaysjimward 1 26719 0 0 /news/jenkinsfacescupfinalselectiondilemma 1 13271 0 0 /news/weknowthetaskaheadinsistsboroughboss-exclusiveinterview 1 11755 0 0 /news/ksports311016 3 20194 1 1 /news/glebe120621 4 63538 0 0 /news/facupspecialwallissitsoutwinnablecupreplay 1 14900 0 0 /news/dartford1-2wellingunited-itsalwaysnicetogetoneoveryourlocalrivalssaysmatthorne 1 28765 0 0 /news/551bc5e89440b 1 12539 0 0 /news/vickersgivehomegrowntalentachance 1 14913 0 0 /news/dartford1-4chelmsfordcity-hollowaysavewasthebestiveseen-burman 1 36670 0 0 /news/beckwalt161021 5 118830 0 0 /news/losingjointtopscorerisamassiveblowtoplay-offchasingsittingbourne-exclusiveinterview 1 14708 0 0 /news/bromley191017 1 14754 0 0 /news/551a9c0e8d486 2 13725 0 0 /news/margate211120 5 64050 0 0 /news/ramsgate070716 2 25783 0 0 /news/croydon4-7guernsey 1 19496 0 0 /archive-2006-2014/177 1 19128 0 0 /news/wealdstone1-0dartford-wealdstonewanteditmorethanusadmitstonyburman 1 21439 0 0 /news/soccershortsabbottinterestedinvacantwellingjob 1 43632 0 0 /news/chathamtown2-0metropolitanpolice-alcoholfuelledkidstarnishchatsfirsthomeleaguewin 1 20617 0 0 /news/551a925033c66 2 18469 0 0 /news/wp-apxupx.php 1 0 0 0 /news/stainestown0-2bromley-istillwantustoscoremoregoalssaysbromleycoachneilsmith 1 26995 0 0 /news/scefl250416 2 14887 1 1 /news/matchreports-1 1 31529 0 0 /news/farniehappywithbudgetsetbynewowner-exclusive 1 13631 0 0 /news/bromleyfc.tv/site/bromley-fc-join-junior-premier-league-young-players-apply-now/ 1 0 0 0 /kent-invicta-league/18 2 25453 0 0 /news/holmesdale031117 1 11874 0 0 /news/551a9250ed327 2 14005 0 0 /news/551a9250145be 2 18966 0 0 /news/thefavaseisawinnabletrophysayshythetownbossscottporter 1 17268 0 0 /news/championsfavershamtown8-0corinthian-luchfordifeelontopoftheworld 1 18963 0 0 /news/councilunveilplansforcanterburycitysnewstadium 1 19344 0 0 /news/tunbridgewells210320 1 13720 0 0 /news/ryman/bromley/23rdnov03.html 1 0 0 0 /news/wehavetotickalltheboxesbeforewesubmitplanningapplicationsayscraywandererschairman 1 18701 0 0 /news/grays210705.html 1 0 0 0 /news/chathamtown5-2ware-itwasanimportantresultforussayschathamtownbosskevinwatson 1 20042 0 0 /news/craywanderers3-2wingatefinchley-therewontbeabettergameineuropetonight-jenkins 1 26050 0 0 /news/ashfhast290122 6 175484 0 0 /news/itsbeenagreatstarttotheseasonsaysbromleyco-chairmanashleyreading 1 14060 0 0 /news/kentcounty/20thnov03.html 1 0 0 0 /fisher-2003-2006 14 183437 0 1 /news/dartford6-1enfieldtown-enfieldoutclassedbybreathtakingdarts 1 19502 0 0 /news/youcantbeatthatwembleywinningfeelingsaysseager-exclusive 1 19260 0 0 /news/erithandbelvedere250222 1 11757 0 0 /news/londonfa220416 4 35612 2 2 /news/theweekahead-14 1 11762 0 0 /news/itsreallyclosetocallsaysvcdathleticbossrickybennett 1 15776 0 0 /news/frozenfebruary 1 11988 0 0 /news/sittingbourne3-1thamesmeadtown 1 17758 0 0 /news/craywanderersp-pleatherhead 1 11503 0 0 /news/collkspo090917 2 44061 0 0 /news/punjabunited200821 1 14907 0 0 /news/ithinkthedealgameisanicegameforussaysdoverathleticbossnickyforster 1 14566 0 0 /news/lovellvowstoturnaroundashfordsfortunes 1 15409 0 0 /news/harrybeautymanturnsposh 1 14611 0 0 /news/everybodywantstobeatusnowsaysfrancis 1 14591 0 0 /news/hernebaystrengthentheirsquad 1 12494 0 0 /news/551a9c91ce4b2 2 16446 0 0 /news/29thapr05.html 1 0 0 0 /news/bromley160717 1 18023 0 0 /news/greenwichboroughsuspendplayerovershockingrefereeattack 1 11945 0 0 /news/drmartens/eastern/tonbridge/29thjune03.html 1 0 0 0 /news/jenkinssignsplayerstoplughisleakydefence-exclusive 1 17152 0 0 /news/crayleyt260716 4 68150 1 1 /news/sykochallengewebsitelaunched 1 11292 0 0 /news/whitstabletown041021 2 25785 0 0 /news/Gillsladies180715 2 20790 0 0 /news/cugleyprofessionalteamsgiveusagoodtest 1 17641 0 0 /news/18thsept05.html 1 0 0 0 /news/towerhamlets300321 1 11893 0 0 /news/wecanstillmaketheplay-offsinsistshessenthaler 1 16159 0 0 /news/erithbel010516 1 14968 0 0 /news/holmesdale201023 2 32516 0 0 /news/551a940f2acfb 4 29670 0 0 /news/hernebay140917 2 25965 0 0 /news/wehaveadaptedtorymanfootballsaysseager-exclusive 1 16505 0 0 /news/justinluchfordbringshisyoungerbrotherdanewithhimtowhitstabletown 1 13818 0 0 /news/lewisham190718 2 18889 1 1 /news/craighollowayisanimportantpartofbromleysfuturesaysassistanthaydenbird 1 17746 0 0 /news/551bc5e362361 1 14940 0 0 /news/551bc5db2ec42 4 31152 0 1 /news/stonespartcompanywithpeternott 1 14519 0 0 /news/551a9797c9082 1 3968 0 0 /news/gillingham6-1mkdons-itwasonewaytrafficsaysgillinghambossjamesmarrs 1 30197 0 0 /news/stainestown4-1margate-itwasmenagainstboysadmitsrelegatedyorath 1 24014 0 0 /news/fhp040317 1 10776 0 0 /news/new-lookboroyoungstersraringtogo 1 15341 0 0 /news/bromleyminshull230515 2 21403 0 0 /news/peoplesayweregoingtostruggle-imgoingtoprovethemwrongvowsangelsbosstommywarrilow 1 16448 0 0 /news/greenwich130805.html 1 0 0 0 /news/vcdathletic250920 2 25809 0 0 /news/wehavebeenonapoorrunofformadmitskentfootballunitedbosssammacneil 1 15832 0 0 /news/halls270621 3 40943 0 0 /news/551bc5e2d4b87 1 12117 0 0 /news/2ndjan05.html 1 0 0 0 /southern-counties-east-football-league/58 1 19418 0 0 /news/hopefullywecanhaveaniceruninthefatrophysayswhitstabletownbossnickysouthall 1 4695 0 0 /news/jenkinsinshockmoveforlong-servingdartsdefenderosborne 1 18704 0 0 /news/tonbridgeangels3-0tunbridgewells-brombyisinhighdemand-exclusiveinterviews 1 22295 0 0 /news/margate100423 2 26917 0 0 /news/whitstabletown2-0thamesmeadtown 2 23385 1 1 /news/kempsterwinningthefavaseandplayersaccoladewasthecherryonthecake 1 28364 0 0 /news/erhunoztumerhasacquittedhimselfwellonhistrialatburnleysaysdulwichhamletsgavinrose 1 13395 0 0 /news/greenhythe070418 2 64315 0 0 /news/hernebay240818 2 27700 0 0 /news/drmartens/eastern/sittingbourne/dartford201104.html 1 0 0 0 /news/vcdathletic010120 2 23896 0 0 /news/illbedisappointedifwerenotinthetoptwoattheendsayscharltonbossdarrenphillips 1 14744 0 0 /news/wereinamassivelearningcurvewiththesquadsayscraywanderersbosskeithbird 1 15796 0 0 /news/otfoideh290415 1 29453 0 0 /archive-2006-2014/140 1 19466 0 0 /news/thefavaseisawaytobringinmuchneededfundssayserithbelvederebossmattlonghurst 1 14097 0 0 /news/crayresvwhitreskicfinal290404.html 1 0 0 0 /news/fumingcugleytellshisplayersshowourfansthatyoucare 1 16171 0 0 /news/grayscray011117 2 54300 0 0 /news/hessenthalerschargesturnonthelights 1 15115 0 0 /news/dartford2-2tootingmitchamunited 1 19700 0 0 /news/dartford011119 3 17597 1 1 /news/well.php 1 0 0 0 /news/kennington030823 1 13995 0 0 /news/bromley190216 2 18594 0 0 /news/dulwich071116 2 23448 0 0 /news/bromley290418 1 14841 0 0 /news/551a979a7fdd8 1 4526 0 0 /news/daishhasdoneasterlingjobatfleetsaysrivalevans 1 13277 0 0 /news/resultsdecember2021 3 126442 0 0 /news/brodstairsmergewithramsgatetogivelocalplayersthebestopportunitytofulfiltheirpotential 1 13721 0 0 /news/dulwichhamlet0-1folkestoneinvicta-cugleydrydenhasagreedsettlementandplaysforfree 1 31718 0 0 /news/craywands121018 3 33496 0 0 /news/stonebridgeshowdowndartswanttofollowinthefleetsfootsteps-exclusiveinterviews 1 27265 0 0 /news/29thmar05.html 1 0 0 0 /news/uccdhfsp120419 1 25979 0 0 /archive-2006-2014/67 1 20261 0 0 /news/facupsecondqualifyingrounddraw-1 2 13957 0 0 /news/bridon150117 3 25270 1 1 /news/premiershiprefofficiatessykochallenge 1 12693 0 0 /news/ebbsfleetunited1-0burtonalbion-battlingfleetseffortsallinvain 1 18309 0 0 /news/fisher270704.html 1 0 0 0 /news/551bc5d99975d 2 18534 0 0 /news/thefa.com. 1 0 0 0 /news/margate1-2tonbridgeangels 1 18958 0 0 /news/snodlandtown180920 2 16570 0 0 /news/lordswood180119 1 13763 0 0 /news/resultsoctober2023 4 169710 1 0 /news/551bc99dbe7a4/kentleague/ramsgate/kentleague/whitstable/7thnov03.html 2 15653 0 0 /news/drmartens/eastern/ashford/18thnov04.html 1 0 0 0 /news/15thmay05.html 1 0 0 0 /news/brombarn040919 2 37100 0 0 /news/ashfordunited100123 4 41742 1 1 /news/551bc99ae4d32 2 14928 0 0 /news/17thaug05.html 1 0 0 0 /news/551bc5e8e80cd 1 16716 0 0 /news/aveley290904.html 1 0 0 0 /news/ramsraise801foryoungroadaccidentvictim 1 12753 0 0 /news/551a9c92210cb 2 14807 0 0 /news/551bc5e2380f5 1 12108 0 0 /news/551a9718bcea4 2 14166 0 0 /news/kentseniorcupfuturekentmanagerswantgillinghamfinal 1 36221 0 0 /news/kentleague/tunbridgewells/27thoct04.html 1 0 0 0 /news/hallspor170519 1 29451 0 0 /news/551bc99dbe7a4/conference/margate/kentleague/VCD/4thsept03.html 2 15653 0 0 /news/imgoingtograbmyopportunitywithbothhandsandgoforitsaysnikitawhinnett 2 18257 0 0 /news/hernebay060815 2 25087 0 0 /kent-invicta-league/7 3 44867 0 0 /news/alanturveytostanddownasrymanleaguechairman 2 17409 0 0 /news/farnieitstimetobond-exclusiveinterview 1 12618 0 0 /news/holmesdale0-1favershamtown-werepunchingaboveourweightadmitshughes 1 19132 0 0 /news/jenkinswantsmorefromhispromotionchasingside 1 14931 0 0 /news/ticketsforkentsbiggesteverderbysoldout 1 11439 0 0 /news/markharrisreturnstoholmesdaleasnewchairman 1 13737 0 0 /news/afccroydon230218 1 12179 0 0 /news/551bc5df82d92 3 34489 0 0 /news/ryman/bromley/4thjan04.html 1 0 0 0 /news/romewasntbuiltinadaywarnsashfordunitedbosstonyreynolds 1 19761 0 0 /news/tunverith111003.html 1 0 0 0 /news/tootingbec310521 1 12790 0 0 /kent-invicta-league/30 2 23090 0 0 /news/hythe010116 2 28068 0 0 /news/bexfav140516 1 35188 0 0 /news/551a9799460df 1 6356 0 0 /news/hernebay3-1hanworthvilla-ourfavaseruniskeepingmyplayersattheclubsayssimonhalsey 1 23346 0 0 /news/thecouncilmuststandanddeliversaysfolkestoneinvictachairmanmarkjenner 1 14516 0 0 /news/ashfordmaketripleloanswoop-exclusiveinterivew 1 16762 0 0 /news/thamesmeadtown3-1romford-ithoughtwewereabitunplayableattimessayskeithmcmahon 1 24252 0 0 /news/rothwelltown1sittingbourne0 1 12751 0 0 /news/551bc5dc57056 3 37333 0 0 /news/dulwich170915 2 25791 0 0 /news/drmartens/premier/dover/18thnov04.html 1 0 0 0 /news/551a9797cca67 1 3544 0 0 /news/551a96dc6731c 3 42276 0 0 /news/dartford5-1alfretontown-wefeltthiscouldbeamassivethreepointssaystonyburman 1 19522 0 0 /news/wellturnitaroundinsistscugley 1 16335 0 0 /news/doverathletic2-0bishopsstortford-wehaveaplatformtobuildonsayshessenthaler 1 21374 0 0 /news/whitworthi031015 2 56679 0 0 /news/chatham080205.html 1 0 0 0 /news/welltopplethegiantsofftheirperch-mcmahon 1 16981 0 0 /news/lordswood281217 1 12380 0 0 /news/inevercountmychickens-wehavetogettherefirstsaystonbridgeangelsbosstommywarrilow 1 14290 0 0 /news/folkestoneinvicta2-1favershamtown-itsablowtoourplay-offhopesadmitsrayturner 1 32575 0 0 /news/wp-includes/database.php 1 0 0 0 /news/ourpitchresemblesthickchocolatesauceadmithernebay 1 11888 0 0 /news/551a9cf4ef32f 3 45991 0 0 /news/lordswood1-1whitstabletown-wefancyourchancesinreplaysaysmetcalf 1 22592 0 0 /news/lordsbrac021217 1 26178 0 0 /news/jenkinswaryofclinicalrivalstrikers 1 14924 0 0 /news/joeford150519 1 11247 0 0 /news/bromvegh021203.html 1 0 0 0 /tier-football/4 2 22166 0 0 /news/sittingbourne270118 2 28253 0 0 /news/hessenthalerputsrecordstraightoverhocktonspeculation 1 11545 0 0 /news/welling211217 1 12210 0 0 /news/tootingmitchamunited2-2sittingbourne 1 14406 0 0 /news/craywarrilow100415 3 43490 0 0 /news/drmartens/premier/dover/Northwood040904.html 1 0 0 0 /news/resultsaprilandmay2022 3 178966 0 0 /news/drmartens/premier/dover/23rdjuly04.html 1 0 0 0 /news/ineedtoknowwhereistandwithmybudgetsayswarrilow 1 25037 0 0 /news/myplayershaveconfidenceandbeliefineachothersayswandsassistantjoefrancis 1 15043 0 0 /news/formerenglandstarsinvestinourbeautifulgame 1 16021 0 0 /news/551bc5def03af 1 14567 0 0 /news/kentleague/hernebay/7thjuly03.html 1 0 0 0 /news/dartford3-1tonbridgeangels-thisisthelevelwewanttobeatsaysalexobrien 1 19150 0 0 /news/fleetvsitt100404.html 1 0 0 0 /news/craywands061017 3 27891 0 0 /news/ryman/bromley/casuals140904.html 1 0 0 0 /news/wellhavethebestgroundinthekentleaguewhenitscompletedsaysnortonsportsbentaylor 1 20866 0 0 /news/ksporglebe040417 2 67913 0 0 /news/favershamtownmanagerjustinluchfordlooksatthebiggerpicture 1 18217 0 0 /news/resultsoctober2019 3 118898 0 0 /news/everygameisimportantnowsaysfolkestoneinvictabossneilcugley 1 15272 0 0 /news/titlechallengersmargateandmaidstoneunitedaimtostandanddeliver 1 14252 0 0 /news/beckeast060922 3 73606 0 0 /news/tonbridgeangelspmoleseyp 1 9920 0 0 /news/othernews/SECWFL180104.html 1 0 0 0 /news/nextyearwellbelookingtowintheleaguesaysbeckenhamtowncoachdeanharrison 1 13891 0 0 /news/fisher0-6afccroydonathletic-allicandoistotallyapologisesaysfisherbossbillywalton 1 29021 0 0 /news/mcmahonaddstohisattackingoptions 1 11681 0 0 /news/551bc5e806841 2 23943 0 0 /news/charltonathletic010421 1 13145 0 0 /news/sevenoaks260305.html 1 0 0 0 /news/thanetsundayleagueunveilnewsponsor 1 13844 0 0 /news/551a9c0e3e40d 2 14381 0 0 /news/maidstone150519 1 13252 0 0 /news/DCMSLetter280920 5 33462 3 3 /news/wp-content/plugins/seoplugins/db.php 1 0 0 0 /news/rusthall081118 1 12407 0 0 /news/mynewcoachingteamwillhelptheclubmoveforwardtowardspromotionsaysramsgatebossjimward 1 11915 0 0 /news/wevegottheexperiencetohandlethebigmatchoccasionsayswellsbossmartinlarkin 1 19406 0 0 /news/wevegottobeonourtoesorlordswoodwillbiteusonthebacksidesayshythebosstimdixon 1 14603 0 0 /news/ihavetakentheclubasfarasipossiblycansaysdealtownchairmandaylemelody 1 15308 0 0 /news/awinoverheybridgeswiftswillputusinagreatpositionsaysthamesmeadtownbosskeithmcmahon 1 14735 0 0 /news/itsfantastictobeonthesamepitchaschelseasaysbromleyassistantmurrayjones 1 15199 0 0 /news/seagerrelishingderbyclashatfolkestone 1 12351 0 0 /news/551a979837c89 1 6891 0 0 /news/localoffendersassistwithramsgatesgroundimprovements 1 12615 0 0 /news/551a931e9055e 2 49150 0 0 /news/wedobelievethatweshouldbeutilisinglocaltalentadmitsmargatedirector 1 17224 0 0 /news/ryman/bromley/13thjuly04.html 1 0 0 0 /news/foleyexpectstoughopeneratwells 1 12939 0 0 /news/fcelmstead130815 1 15329 0 0 /news/headtoheadtheresgoingtobemoretwistsandturnssayshythetownbossscottporter 1 16648 0 0 /news/fcelmstead180219 1 12149 0 0 /news/lordswood310719 1 15328 0 0 /news/wellgoouthellforleathertowinourfinalthreegamessaysfolkestoneinvictabossneilcugley 1 15376 0 0 /news/551bc99dbe7a4/kentleague/lordswood/drmartens/eastern/sittingbourne/sittingbournevwhyteleafe130903.html 2 15653 0 0 /news/551a9677a3b59 2 14975 0 0 /news/25thnov05.html 1 0 0 0 /news/stevefirkinsbringshisgreenwichboroughsquadtofisher-garyabbottfindsnewjob 1 12855 0 0 /news/bromley021117 1 19533 0 0 /news/dartford2-1eastbourneborough-ivegottobehappywithtwowinsoutoftwosaystonyburman 1 19119 0 0 /news/drmartens/eastern/erith&belvedere/3rdmar04.html 1 0 0 0 /news/elthampalace2-2orpington-werodeourluckalittlebitadmitsorpingtonbossseanglover 1 26589 0 0 /news/wecantwaittogetgoingagainsaysfolkestoneinvictabossneilcugley 1 13816 0 0 /news/whuchar060515 1 29538 0 0 /news/tunbridgewells270722 1 12747 0 0 /news/ramsgate2fleettown0includingtodaysresults 1 19207 0 0 /news/bromley110619 3 25363 0 0 /news/margate2stainestown5-includessaturdaysresults 1 24455 0 0 /news/551bc99dbe7a4/kentcounty/conference/gravesend/8thnov03.html 2 15653 0 0 /news/doverswoopforprolificstrikercooper 1 13399 0 0 /news/imsearchingforfirepowerupfrontsaysoconnell 1 13201 0 0 /news/tundeaderonmustaysfaithfultocrayvalley 1 11800 0 0 /news/werefindingitverydifficultatthemomentadmitsramsgatebosstimdixon 1 15568 0 0 /news/551a99e36fd72 1 18169 0 0 /news/soccershortskempsterhangsuphisboots 1 21721 0 0 /news/folkestone060516 2 27606 0 0 /news/551bc5e393a85 1 22009 0 0 /southern-counties-east-football-league/45 1 20049 0 0 /news/justinluchfordfitsthebillsayswhitstabletownchairmanjoebrownett 1 14171 0 0 /news/whitstable250620 2 27723 0 0 /news/stonesdefenderpenstwo-yeardealatmiddlesbrough 1 11381 0 0 /news/551a99e497b9a 2 34498 0 0 /news/maidstoneunitedconsiderlegalproceedingsoverturfwarwithconference 1 20718 0 0 /news/3rdnov05.html 1 0 0 0 /news/burmangetshisbruciebonus-exclusiveinterview 1 14511 0 0 /news/dartford4-2ashfordtownmiddlesex-disasterousmarchcostusaplay-offplaceadmitsburman 1 30639 0 0 /news/borehamwood1-2folkestoneinvicta 1 17200 0 0 /news/lewisham290116 2 17782 0 0 /news/tilbury240704.html 1 0 0 0 /news/22ndjune05.html 1 0 0 0 /news/tonbridgeangelsbossstevemckimmunwrapsstrikerjoetaylorfromunderneathhischristmastree 1 12149 0 0 /news/551a9cf4da674 2 17672 0 0 /news/551a9c929ef3b 2 17971 0 0 /news/soccershortswerepunchingwellaboveourweightadmitssittingbournebossmattwyatt 1 27829 0 0 /news/17thjuly03.html 2 0 0 0 /news/phoeerit080323 4 46214 0 0 /news/wereplayingforpridenowadmitsward 1 13523 0 0 /news/bromley1-2craywanderers-iwanttogoonandwinthelondonseniorcupsaysianjenkins 1 21795 0 0 /news/551bc99bcde95 2 25416 0 0 /news/theclubisheadingintherightdirectionandimhappytostaysayswellingbossjamieday 1 13861 0 0 /news/551bc5dbdf448 3 30361 0 0 /news/dartford1-0basingstoketown-weverodeourluckalittlebitadmitsdartsbosstonyburman 1 27522 0 0 /news/drmartens/eastern/folkestone/folkvcorb210204.html 1 0 0 0 /news/idontthinkanybodycanbelieveititsafairytaleforasmallclublikeourssaysterryhill 1 16233 0 0 /news/troubledfishergivenstayofexecutionandmayfinishtheseason 1 11743 0 0 /news/margate3-0afcwimbledon-imsodelightedwithwhatwevegotheresaysmargatebossterrybrown 2 34196 0 0 /news/doverathletic0-1bathcity-wewerewellbelowourbesttodayadmitsnickyforster 1 17407 0 0 /news/kingstonianhandtheinitiativeovertocraywanderers 1 16896 0 0 /news/margate220421 2 26431 0 0 /news/551a9798a59c5 2 19486 0 0 /news/551bc5ddc1a9c 1 14675 0 0 /news/phoesoh080417 3 75509 0 0 /news/itmakesabsolutesenseforthepeopletosupportmyplanssayschairmangaryhillman 1 13572 0 0 /gravesend-2003-2006/3 4 35097 0 0 /news/bromleyretaineightplayersfromlastseason 1 14305 0 0 /news/551a97b10a642 2 29772 0 0 /news/sheppey080416 2 17729 0 0 /news/drmartens/eastern/sittingbourne/greatwakering161104.html 1 0 0 0 /news/thereareplacestoplayforsaysashfordunitedbosspaulchambers 1 12973 0 0 /news/551a956b676cb 1 3023 0 0 /news/551a96776e428 2 18263 0 0 /news/greenwich240217 2 26820 0 0 /news/551a979aaa044 1 5127 0 0 /news/imustsayitisapleasuretoworkwithsuchatalentinerhunoztumersaysgavinrose 1 17810 0 0 /news/ivegotnodoubtsofussurviving-mcmahon 1 14593 0 0 /news/ramsstrikerwelfordreturnstoformerclub 1 12532 0 0 /news/551a95b3b9f84 2 17026 0 0 /news/NationalLeague150121 2 15399 0 0 /deal-2003-2006 15 174276 2 2 /news/gravesendnorthfleet2-0graysathleticdeadlyduostrikeagainassixthplacedfleetshine 1 16720 0 0 /news/theresmoreexpecationsonusthisyearsaysbromleybossmarkgoldberg 1 15357 0 0 /news/hernewith261018 2 56376 0 0 /news/weregoingtogivesomeoneagoodgoingoverwarnsramsassistant 1 12823 0 0 /news/long-servingcugleyputspentopapertostayatinvicta 1 11450 0 0 /news/merrychristmas 1 9831 0 0 /news/wp-content/themes/about.php 1 0 0 0 /news/longhurstringsthechangesforcupreplay 1 13318 0 0 /news/dartford3-2fchalifaxtown-theresaneasywayandadartfordwaysaysproudbosstonyburman 1 24816 0 0 /news/othernews/coneyhall210804.html 1 0 0 0 /news/snodlandtown201023 2 25416 0 0 /news/wellingdover010115 1 13469 0 0 /news/kentcountyfaholdtrialsforgirlsteam 1 11645 0 0 /news/551bc5e817a7b 1 26235 0 0 /news/weareheadingintherightdirectionsaysseager 1 15403 0 0 /news/stonebridgeshowdownitsagameforthefanssaysdaish 1 25548 0 0 /news/drmartens/eastern/folkestone/folkvsali030104.html 3 0 0 0 /news/wefaceourtoughtesttesttodatewarnsford-exclusiveinterview 1 13088 0 0 /erith-belvedere-2003-2006/www.heineken.co.uk/ 1 3218 0 0 /news/tunwells060917 1 13504 0 0 /news/ramsgate011216A 2 31222 0 0 /news/dartfordbosstonyburmanreleasesfourplayersfollowingtheirtop-eightfinish 1 12590 0 0 /news/holmesdale180920 1 15141 0 0 /news/welosttoabetterteamadmitspennock-exclusiveinterview 1 25816 0 0 /news/angelsdayofdestinyyoucantdoallthishardworkandthrowitallawayalexobrien 1 17255 0 0 /news/wewanttoimprovetheleagueformsaysfolkestoneinvictabossneilcugley 1 13847 0 0 /news/halseyexpectingfiercefavershamshieldclash 1 15043 0 0 /news/beckcant051218 1 30478 0 0 /news/favershamtown2-1whitehawk-wevegotnoreasontofearanyoneinthisleaguesaysluchford 1 37000 0 0 /news/idhatetoseesittingbournegounder-butitisthatbadsaysconcernedjoint-bossjimward 1 13040 0 0 /news/loverleaveswithourblessingsaysfrancis 1 14877 0 0 /news/551bc5e2d7500 1 10730 0 0 /news/thebigkickoffthanetsidesaimtoupsetpremiergiants-exclusive 1 15643 0 0 /archive-2006-2014/15 2 25556 0 0 /news/corinthian070920 1 14164 0 0 /news/551bc5df128af 1 14819 0 0 /news/551bc5dc5a42f 3 53663 0 0 //fonts.googleapis.c 1 3711 0 0 /news/thorogoodpromisesashfordtownfansabetterseason-exclusiveinterview 1 18751 0 0 /news/afccroydon080917 1 12321 0 0 /news/28thjuly05.html 1 0 0 0 /news/otford290318 2 17285 0 0 /news/craywands291018 3 46768 0 0 /news/lydd210417 1 13585 0 0 /news/milesappointedheadcoachatharrowmeadow-exclusive 1 12456 0 0 /news/kentfootballunited240921 1 13153 0 0 /news/551bc5db52fb1 3 33438 0 0 /news/wellingunited080719 2 16096 0 0 /news/drmartens/premier/welling/sutton131104A.html 2 0 0 0 /news/sladegreen1erithbelvedere2 1 12582 0 0 /news/craywhit291123 51 707562 16 23 /news/551bc5e847686 1 12699 0 0 /news/folkestone140917 2 25856 0 0 /news/smithtookarisktojoinusadmitscugley 1 17865 0 0 /news/gillingham150517 2 24267 0 0 /news/matchreportsinvictaandstonesrelegationconcerns 1 26525 0 0 /news/551a97b1b5888 1 14518 0 0 /news/wearefarfromthefinishedarticlesaysramsgatebosstimdixon 1 13660 0 0 /news/sevencant130118 1 37921 0 0 /news/losingtodoverathletichurtmeadmitsunder-fireandyhessenthaler 1 16961 0 0 /news/fraserfranksdeservestomovebackintofull-timefootballsayswellingunitedbossjamieday 1 14990 0 0 /news/wehaveathree-yearplanandexpecttoseeitthroughthegoodandbadtimessaysramsgatechair 1 15375 0 0 /news/sheppey220920 1 14436 0 0 /news/bromley200220 2 14575 0 0 /news/warrilowvowstokeepunbeatenrungoing 1 14840 0 0 /news/craywands241218 3 35324 0 0 /news/hollandsandblair.co.uk 1 0 0 0 /news/imoptimisticwelldoprettywellsaysdealbossderekhares 1 17902 0 0 /news/551bc99dbe7a4/drmartens/eastern/ashford/kentleague/sladegreen/17thjuly03.html 2 15653 0 0 /news/concernedwardindesperateraceforreplacementgoalkeeper 1 15949 0 0 /news/folkestone240320 2 24061 0 0 /news/551bc5e59fa27 1 15560 0 0 /news/wp-content/languages/wp-login.php 1 0 0 0 /news/wemustbouncebacksaysplay-offchasinghume 1 12720 0 0 /news/551a95b3cad8b 4 32705 0 0 /news/ihaveeveryconfidencethatmysquadisgoodenoughtobeateastprestonsaysjohn-paulcollier 1 15240 0 0 /news/hollands&blair060821 1 16003 0 0 /news/margate300519 2 23228 0 0 /news/551a9c0f30822 2 15423 0 0 /news/leyton0-4tonbridgeangels-imstilltargetingtheplay-offssayswarrilow-exclusive 1 19596 0 0 /news/551bc5e37a082 1 12755 0 0 /news/margatemissoutonprolificstrikertuohy 1 12849 0 0 /news/joneshasbeenawonderfulservanttotheclubsayslovell 1 17748 0 0 /news/otfohals040315 1 32442 0 0 /news/burgessvsittfat011103.html 1 0 0 0 /news/bromley030816 2 20749 0 0 /news/margate2folkestoneinvicta1 1 14990 0 0 /news/glebesutt070516 2 51203 0 0 /news/cumberbatchhailsexcellentmatatasigning-exclusiveinterview 1 13854 0 0 /news/wemustputbarrenspellbehindussayslovell 1 13642 0 0 /news/tonbafcw230716 2 51346 0 0 /news/folkchic170922 2 66497 0 0 /news/craywanderers3-3carshaltonathletic-weretoogoodtogodowninsistsjenkins 1 40473 0 0 /news/bromgoldberg150415 2 21988 0 0 /news/ramsgate230916 5 32843 2 2 /news/wehavetodriveforwardandfinishintheplay-offssayswellingunitedbossjamieday 1 13732 0 0 /news/ebbsfleet300620 1 13083 0 0 /news/tonbridgeunveilanotherdoublesigning 1 17094 0 0 /news/whithern081218 5 134958 3 2 /news/Soccershorts190517 3 28797 0 0 /news/bromspen240218 2 36576 0 0 /national-league/13 2 24052 0 0 /news/margate171218 2 25475 0 0 /news/otfocroc211020 5 140569 0 0 /news/kentleague/whitstable/7thnov03.html 1 0 0 0 /news/sittingbourne0-1dartford-handsupwelosttoagreatgoaladmitsabbott 1 38129 0 0 /news/stonespreparefortheireightcup-finals 1 16719 0 0 /news/badscray041118 1 30599 0 0 /news/favershamtownfansplantodonatefundsforgrounddevelopmentfund 1 11805 0 0 /news/iintendtoleadhernebayintotherymanleagueinour125thyearsaysnewchairman 1 14818 0 0 /news/weputaverygoodargumentforward-ramsgatechairman 1 14692 0 0 /news/drmartens/eastern/erith&belvedere/29thsept04.html 1 0 0 0 /news/favstrgoodwin130515 1 18316 0 0 /news/whitstable190419 2 24198 0 0 /news/croydon240518 1 14448 0 0 /news/lordswoodisaniceplacetobeatthemomentsaysbossjasonlillis 1 13834 0 0 /news/ramsgate170519 2 24920 0 0 /news/croycray121218 1 23289 0 0 /news/hythetownplanaheadfordoversmouth-wateringcupvisit 1 11979 0 0 /news/corinthian121020 1 12875 0 0 /news/blamemeifwedontgetpromotedsayswarrilow 1 15716 0 0 /news/leadinggoalscorers 1 32160 0 0 /news/rymanleagueplay-offnewskentseniorcupfinalputbacktopre-season 3 30045 2 0 /news/drmartens/eastern/ashford/20thoct04.html 2 0 0 0 /news/drmartens/premier/welling/fixtures.html 1 0 0 0 /news/erithbelvedere2-2hythetown 1 14657 0 0 /news/crockenhillcaughtusonagooddaysayshollandsblairbosspaulpiggott 2 20964 0 0 /news/aaronperryrelishesnewchallengeattudorsports 2 20024 0 0 /news/bromley020805.html 1 0 0 0 /news/kentleague/sladegreen/29thnov04.html 2 0 0 0 /news/hernebay200523 2 27159 0 0 /news/crowborough201017 1 13022 0 0 /news/cugleyruesbadluck 1 17979 0 0 /news/551bc5e242893 1 10705 0 0 /news/craywanderers5-1dulwichhamlet-hopefullywellmoveonfromthissteppingstonesaysmikepaye 2 37463 0 0 /news/tonbridgeangels2-3ramsgate-ramsgettherubofthegreentoknockouttheirbogeyside 1 22458 0 0 /news/iwasntexpectingsixpointsovertitle-rivalsadmitsburman 1 17763 0 0 /news/kentleague/tunbridgewells/lordswoodu18050904.html 1 0 0 0 /news/resultsmarch2017 2 99395 0 0 /news/thurrockawaywasoneofourbestawayperformancesreflectshessenthaler 1 13567 0 0 /news/favershamtown110522 2 24611 0 0 /news/forebrid050220 1 25558 0 0 /news/7thapr05.html 1 0 0 0 /news/footballsjustaroundthecorner 1 10903 0 0 /news/dartstarget2000asfeelgoodfactorspreads 1 27337 0 0 /news/bromleytvdebut121115 2 17868 0 0 /news/membersrecommendedtoselltopstarstofundnewsquad 1 13519 0 0 /news/hendonmccann160515 2 38825 0 0 /news/maidstoneunited2-0hythetown-werebeingpunishedforourmistakessaysscottporter 1 19652 0 0 /news/tonbridge040516 2 25186 0 0 /news/kentleague/beckenham/beckenham.html 1 0 0 0 /news/551bc99d41ae7 2 26661 0 0 /news/ihaveachievedtheobjectivesiwassetandmoresayssimonaustin 1 16542 0 0 /news/drmartens/premier/welling/8thsept04.html 1 0 0 0 /news/kentleague/sladegreen/beckenham041204.html 1 0 0 0 /news/thisseasonhasbeenaroller-coasterwithupsanddownsreflectschathamtownbosskevinwatson 1 15917 0 0 /news/rusthall1-4hildenboroughathletic-adamdaviesisaqualityplayersaysbossandrewmckechnie 1 30324 0 0 /news/bromhava310115 2 34700 0 0 /news/soccershorts010619 2 36787 0 0 /news/bromleystrikermcbeantargetsplay-offpush 1 12768 0 0 /kent-county-league/11 3 41500 0 0 /news/551a96dc238c2 4 59337 0 0 /news/bromley070617 1 14920 0 0 /news/wevegotatoughstartbuthopefullywecangetsomegoodresultsalongthewaysaysjamieday 1 15573 0 0 /news/kentleague/thamesmead/greenwich170804.html 1 0 0 0 /news/sitthern091021 5 172675 0 0 /news/551bc5dd9c45b 1 13564 0 0 /news/resultsareimportantandthechairmanwantstogetawayfromthebottomthreesaysnickdavis 1 16951 0 0 /news/tompkinswantsachancetomanageatahigherlevel-exclusive 1 13615 0 0 /news/invictaunveilfundaydetails 1 19009 0 0 /news/neilsonhopetestswillenablehimtoplaylonger 1 16505 0 0 /news/551bc5e045a1d 2 24759 0 0 /news/sporasco111019 1 26654 0 0 /news/hugheswantstobowlthemover 1 15813 0 0 /news/whiteast181221 5 147625 0 0 /news/dealtown191121 4 54810 0 0 /news/ourchristmasfixturesareverytoughsaysdealtownbossalbiebarker 1 13335 0 0 /news/551a931de3281 1 11307 0 0 /news/matchreportslilywhitessmashtenpastbengal 1 28662 0 0 /news/hollands190216 1 12819 0 0 /news/551a95b3c3a3f 3 34066 0 0 /news/551a9677c2d53 2 18772 0 0 /news/551a931e2a71c 2 24212 0 0 /news/stay-awayfansflockbacktoresurgentashfordtown 1 13124 0 0 /news/551a956c80edb 1 4962 0 0 /news/551a96db8ce5e 2 15484 0 0 /news/551bc99dbe7a4/drmartens/eastern/dartford/othernews/favase4thround.html 2 15653 0 0 /news/itsabouttimewebeattheangelssaysward-exclusiveinterviews 1 17050 0 0 /news/thorogoodwecameupagainstaqualitystriker-exclusive 1 14673 0 0 /news/tonbridgeangels3-3lowestofttown-iffeelslikealossadmitstommywarrilow 1 24913 0 0 /news/dulwhamp210717 2 50368 0 0 /news/hayesandyeadingannouncemerger 1 15764 0 0 /news/sevenash130416 1 32695 0 0 /news/weneedtogetbackontrack-hessenthaler 1 14487 0 0 /news/icantwaittogetstartedataqualityclubsaysnewbromleycoachhugolangton 1 12234 0 0 /news/551a97b28b988 1 15625 0 0 /news/dealtown190120 1 14327 0 0 /news/wellingunitedbossjamiedaymakesdoubleswoop 1 14162 0 0 /news/cosgrovewantssteelfromhissidetoavoidthirdstraightcupexit 1 14814 0 0 /news/ebbsfleetunited2-2afcwimbledon-gutteddaishaskswheredidhegettheextratimefrom 1 36579 0 0 /news/charltonathletic230120 3 28899 0 0 /news/hernebay260416 3 27026 0 0 /news/phoenix060418 2 25971 0 0 /news/erithtown170617 1 13717 0 0 /news/551a9c0e44cf7 2 15785 0 0 /news/kentsidesavoidfirstroundofchampionshipmanagercup 1 13745 0 0 /news/holmesdale030222 1 16499 0 0 /news/budgetcutswillmakeittoughwarnshume 1 18423 0 0 /news/551a95b3b7135 2 17993 0 0 /news/21stnov05.html 1 0 0 0 /news/ayruhear050221 4 81010 0 0 /news/icantgoonforeversayslong-servingvickersbossford-exclusiveinterview 1 14862 0 0 /news/rochches140916 1 26142 0 0 /news/drmartens/eastern/ashford/ashvsitt240204.html 1 0 0 0 /news/ebelvwhit250715 2 65859 0 0 /news/551bc99ab1058 1 4877 0 0 /news/newfacilitiesaregreatfortheareasaysthamesmeadtownbosskeithmcmahon 1 15532 0 0 /news/crowboroughathletic040823 1 12635 0 0 /archive-2006-2014/100 1 20690 0 0 /news/myfirststintofmanagementhasleftasourtasteinthemouthsayssimonpettit 1 15861 0 0 /news/tonbridgeangels2-1maidstoneunited-tonbridgewinuglywestkentbattle 1 20097 0 0 /news/551bc99dbe7a4/kentleague/cray/conference/gravesend/gravesend.html 2 15653 0 0 /news/tonbridge160620 1 11927 0 0 /news/bashvsitt010504.html 1 0 0 0 /news/drmartens/premier/dover/3rdjuly03.html 1 0 0 0 /news/551bc5db38e92 3 44098 0 0 /news/glebe091221 1 12873 0 0 /news/ashfordtown0croydonathletic1-cumberbatchwerefocusedtomakesurewestayupexclusive 2 24490 0 0 /news/chathamtown290916 3 26637 0 0 /news/551bc99c26302 2 22922 0 0 /news/croydon071020 1 11555 0 0 /news/wevehadtoworkhardtogettothestagewereatnowsaysvcdathleticsgeorgemitchell 1 18710 0 0 /news/kentleague/maidstone/guildford110904.html 1 0 0 0 /news/yorathandsouthallwillleadustosuccessnextseasoninsistspiper 1 12372 0 0 /news/ourlatestsigningswilladdcreativityandflairsaysfrancis 1 14365 0 0 /news/sporkenn221119 1 37663 0 0 /news/deresgettheirkitson 1 13309 0 0 /news/charltonathletic150321 1 12054 0 0 /news/551bc5dca17b9 3 37071 0 0 /news/signingdeanstandenisprobablythebiggestintheclubshistorysaysthamesmeadbossmcmahon 1 12905 0 0 /news/beckenham050821 1 13271 0 0 /news/tunbridgewells6-1farnhamtownfarnieasksfansformoreemotion-exclusive 1 19310 0 0 /news/werelookingforwadtoplayingagainstabigclubsayscrayvalleybossstevechapman 1 13559 0 0 /news/theboardhavebackedmebrilliantlytobringtomdavistotheclubsaystommywarrilow 1 18140 0 0 /news/vcdathletic3-1withamtown-wevegivenourselvesachancetowintitlesaystonyrussell 1 32825 0 0 /news/wewouldlovetogetintothekentinvictaleaguesaysapmcontrastbosskrisbrowning 1 15078 0 0 /news/folkestone180519 2 25813 0 0 /news/hernebay090405.html 1 0 0 0 /news/wewontbeeasytobeatsaysfisherjoint-bossbillywalton 2 21029 0 0 /news/whitstabletown300720 2 23233 0 0 /news/codybeingwelllookedafterbynorwichcity-mcdonaldfamily 1 12089 0 0 /news/richiedavieswillgethischancetobecomeaprosaysmickycollins 1 11710 0 0 /news/551bc99dbe7a4/kentleague/erithtown/othernews/favase3rdround.html 2 15653 0 0 /news/returningwesfoderinghamgetsthenodatbromley 1 17777 0 0 /news/imherebecauseiwanttodowellintheleaguesaysstonesbossjaysaunders 1 18238 0 0 /news/fisher030816 1 13757 0 0 /news/whitbeck250423 8 110239 1 1 /news/551a96dbe762a 1 4610 0 0 /news/lyddtown120118 2 18966 0 0 /news/551bc99dbe7a4/othernews/kentleague/sladegreen/2ndjuly03.html 2 15653 0 0 /news/bromley0-2doverathletic-wereblowinghotandcoldadmitsdoverbossmartinhayes 1 23141 0 0 /drmartens/premier/welling/28thjune05.html 1 9955 0 0 /news/hollbeck110817 1 14162 0 0 /news/rymanleagueinitiativewillraiseafeweyebrowsadmitsturvey 2 15360 1 1 /news/551a979a17655 1 5110 0 0 /news/erithbelvedere3-2vcdathletic-wedliketoemulatewhathernebaydidsaysmickycollins 1 30813 0 0 /news/551a99e502b0d 1 16873 0 0 /news/crayhors180318 3 71600 0 0 /news/chathamtown1-2vcdathletic-itwasthemostiveenjoyedaresultthisseasonsaystonyrussell 2 43277 0 0 /news/facuprunwouldsortthecluboutfinancaillyallyearsaysthamesmeadtownbosskeithmcmahon 1 16830 0 0 /news/kingstonian180904.html 1 0 0 0 /news/551bc99dbe7a4/drmartens/eastern/erith&belvedere/drmartens/eastern/ashford/11thaug03.html 2 15653 0 0 /news/theweekahead-10 1 11319 0 0 /news/doverathletichasarealbeliefinitsyouthsystemsaysacademymanagermichaelsandmann 1 15909 0 0 /news/wellseehowgoodgreenwichboroughareonaugust9thsaysphoenixsportsbosstonybeckingham 1 16041 0 0 /news/webelievewecangetthroughtothenextroundsaysbromleybossmarkgoldberg 1 13027 0 0 /news/551a971899cbb 3 31315 0 0 /news/fishshep010322 6 163218 0 2 /news/wejustfrozeonthebigstageadmitscopley 1 14762 0 0 /news/sittingbournesearchfornewbackersaschairmanstepsdown 1 24710 0 0 /news/soccershortsburgesshilltownsecuretheirrymanleaguestatus 1 19764 0 0 /news/suttshep230416 1 31566 0 0 /news/charltonathletic090421 1 13375 0 0 /news/22ndsept04.html 1 0 0 0 /news/551bc5dda2d72 1 14819 0 0 /news/chathamtownunveilnewgoalkeepersigning 1 11372 0 0 /news/wellgivebansteadtherespecttheydeservesaysshaunwelford 1 13304 0 0 /news/backingthefleettowembleyglorysupportusandwelldofleetfansproudsaysbarrett 1 13536 0 0 /news/craychar201217 3 46742 0 0 /news/ithinkweregettingtherewardsforthehardworkwereputtinginsaysnickyforster 1 14040 0 0 /news/551a97b0d8190 2 31492 0 0 /news/tuncor120816 3 104645 0 0 /news/walthamforest1-1ashfordtown 1 13380 0 0 /news/ebbsfleetunited3-1aldershottown-heroicfleetwithintouchingdistanceofwembley 1 18251 0 0 /news/myoperationwasaresoundingsuccesssayswalker 1 10918 0 0 /news/snodstan290723 1 31735 0 0 /archive-2006-2014/84 1 20638 0 0 /news/wingmarg140120 2 23059 0 0 /news/tonbridgeangels010521 1 14074 0 0 /news/rochesterunited121221 1 11752 0 0 /news/margatefanspitchintopurchasenewtools 1 12209 0 0 /archive-2006-2014/5 3 44409 0 0 /news/doverathletic1-2bromley-whatagreatwinforuswewereimmensesaysproudmarkgoldberg 1 30394 0 0 /news/margate130622 5 59535 0 0 /news/tonbridgeangels0-0brentford-impressedbrentfordwillhopefullyreturnnextyearsayswarrilow 1 27750 0 0 /news/canterburycity221220 1 14783 0 0 /news/sceflstatement260321 1 11633 0 0 /news/551bc5de22f97 2 18762 0 0 /news/bromholl150516 3 54532 1 1 /news/phoenixsportstohavetheextraedgeovertheirrivals 1 12468 0 0 /news/oldbrom200516 1 11978 0 0 /news/folkestone080616 2 24632 0 0 /news/chathamtownbosskevinwatsonunveilstwonewdefenders 1 13511 0 0 /news/551bc5df0537c 1 16865 0 0 /news/itsagreathonourtobeinchargeofthisfantasticclubsaysnewfisherbossbillywalton 1 15078 0 0 /news/551a9cf57040c 3 33892 0 0 /news/resultsaugustseptember2010 1 75369 0 0 /news/sceflstatement310720 1 13023 0 0 /news/punjbroa100819 1 27860 0 0 /news/551a979806bd0 2 20499 0 0 /news/shaunwelfordisgoingtobringalotofgoalsandgoodtimestoourclubsaysscottporter 1 15162 0 0 /news/sutton120216 1 15187 0 0 /news/faversham110920 2 29489 0 0 /news/cugleyexplainspipersdeparture 1 12139 0 0 /news/vickersbossfoleymakestwounprecedentedstarsignings 1 16265 0 0 /news/holmesdale1-2dulwichhamlet-lotsofpositivestotakeoutofthegamesaysrossmitchell 1 19621 0 0 /news/sportbeck070119 1 29331 0 0 /news/tunbridgewells300720 1 11834 0 0 /news/croydon090218 1 12770 0 0 /news/kentleague/sladegreen/beckvslad070204.html 1 0 0 0 /news/itwillbenicetogointoagameasunderdogssayschathamtownbosskevinwatson 1 13749 0 0 /national-league/15 2 24649 0 0 /news/551a967886b6d 3 40115 0 0 /news/aclubofdoverssizeshouldbeaimingtogetoutofthisleaguesaysdarylmcmahon 1 13998 0 0 /news/551bc99dbe7a4/drmartens/eastern/ashford/othernews/12oct03.html 2 15653 0 0 /news/crystalpalace230517 1 12881 0 0 /news/ivebeentryingtosignpulmanforalongtimeadmitslovell 1 23911 0 0 /news/doverathleticbossnickyforsterbeginssearchforlocalgem 1 14257 0 0 /news/craywanderers2-5afchornchurch-myworstopeningdaydefeatadmitswandsbossianjenkins 1 23113 0 0 /news/551a9c0f0e9b3 4 31152 0 0 /news/holmesdale290418 1 12376 0 0 /archive-2006-2014/125 1 19148 0 0 /news/newfisherbossstevefirkinstobeunveiledtofansatannualgeneralmeeting 1 15786 0 0 /news/wevedonebetterthanweexpectedatthestartoftheseasonsaysfavershamcoachclivewalker 1 14579 0 0 /news/ifwecanplaywellithinkwecangotoarundelandwinsaysphoenixbosssteveoboyle 2 14841 0 0 /news/551bc99c0c137 2 48324 0 0 /news/championsivesetmysidemoretargetstoreachsaysburman 1 20384 0 0 /news/KentFAStatement101220 3 32403 0 0 /news/ashfordsufferwidespreaddamageaftervandalsransackhomelands 2 18740 0 0 /news/551bc5e34f243 1 14513 0 0 /news/maidstoneunited2-1tonbridgeangels 1 20980 0 0 /news/dulwich250416 2 31280 0 0 /news/redbridge0folkestoneinvicta2 1 17612 0 0 /news/maidstoneunited2-3ashfordtownmiddlesex-walkerslamsshockingdefendingfortrophyexit 1 16788 0 0 /news/margatelaunchgatechatservice 1 11924 0 0 /news/homegrowntalenthaskeptusupsayscugley-exclusive 1 14000 0 0 /news/wewillbothbeatthedropinsistswalker-exclusive 1 12964 0 0 /news/kennington141019 1 12419 0 0 /news/gravesham071117 1 11646 0 0 /news/iwouldloveoneyeartotakeasidewithabigcrowdsaysvcdathleticbosstonyrussell 1 16270 0 0 /news/AFCWimbledon251005.html 1 0 0 0 /archive-2006-2014/55 1 20758 0 0 /news/sittvburg170104.html 1 0 0 0 /news/551a931e3d02b 1 13453 0 0 /news/tonbridgejuniordian120715 2 36234 0 0 /news/erithandbelvedere210821 1 13022 0 0 /news/ijustneedtobegivenachancesomewheresaysbillywalton 1 13818 0 0 /news/551a95b3cd471 2 25411 0 0 /news/everyoneattheclubisonamassivehighatthemomentsaysphoenixjoint-bosssteveoboyle 2 18710 0 0 /news/itsafootballclubthatgetsitshandsdirtytomakesurewesurvivesaysthamesmeadtownboss 1 21115 0 0 /news/twentynineyearswithoutatrophyitsstartingtofeellikeenglandadmitsmickycollins 1 14173 0 0 /news/flackwell021004.html 1 0 0 0 /news/wingatefinchley1-2sittingbourne-itmeanssomuchtoplaylucrativedartfordtie-abbott 1 30425 0 0 /news/whitstablepreparedfornewcampaignsaysseager 1 13118 0 0 /news/drmartens/eastern/sittingbourne/berkhamsted250904.html 1 0 0 0 /news/sittvfolk030404.html 1 0 0 0 /news/glebdart190919 1 42392 0 0 /news/551bc99c08ed2 2 17700 0 0 /news/arleseytown1sittingbourne3 2 20429 0 0 /news/chathamtown0-2withamtown-icantreallyfindanythingpositiveaboutgameadmitskeithlevett 1 22832 0 0 /sittingbourne-2003-2006/2 2 29622 0 0 /news/erithtown260518 1 12295 0 0 /news/bognorregistown120322 3 27349 0 0 /news/drmartens/eastern/sittingbourne/sittvdart141003.html 2 0 0 0 /news/beckchat040120 1 37514 0 0 /news/play-offheroescugleytookthepressureawayfromussaysjackson 1 27951 0 0 /news/kentleaguetitledualwewerechampionsfor25secondsadmitsstunnedseager 1 17091 0 0 /news/wp-content/plugins/dzs-zoomsounds/savepng.php 1 0 0 0 /news/lifesabeachforrams 1 14145 0 0 /news/wedontwantarelegationbattletobepartofouragendasaysbromleybossmarkgoldberg 2 22102 0 0 /news/551a956d08a5b 1 6830 0 0 /news/bromley1-2concordrangers-weweresecondbesttonightineverydepartmentadmitsmarkgoldberg 2 32923 0 0 /news/DCMSStatement231120 3 34531 0 0 /news/erithtown091015 1 16531 0 0 /news/dartford3-0chipstead-ourmainconcernwasgettingthrough-burman 1 22458 0 0 /news/lisneytellsbig-spendingcroydonathleticdonotunder-estimateus 1 22312 0 0 /news/551a931ec327b 2 31568 0 0 /news/itsbeenthehardestseasoniveeverhadinfootballsaysfolkestoneinvictabossneilcugley 1 17350 0 0 /news/othernews/cafcladies8thdec03.html 2 0 0 0 /news/phoenix260118 2 25471 0 0 /news/551a967754ab6 2 17508 0 0 /news/kentleague/VCD/14thjuly04.html 1 0 0 0 /news/tostayintheleaguewillbeamassiveachievementsaysthamesmeadtownbosskeithmcmahon 1 17045 0 0 /news/hythetown050815 2 25632 0 0 /news/kentcountyleaguestatement181220 1 12071 0 0 /news/wingsbossjamiedaydrawscomfortfrompositivevibesaheadoflutonclash-6312tosavewings 1 18976 0 0 /news/march2007fixturelist 1 26085 0 0 /news/ourambitionsfortheseasonareblunt-wewantpromotionsayskfubosssammacneil 1 13531 0 0 /news/gillingham031019 2 22738 0 0 /news/resultsoctober2014 1 69157 0 0 /news/maidstone230720 2 14414 0 0 /news/itsprobablythefirsttimewevehadtofacehythewhenwevenotbeenthefavouritessayscugley 1 15805 0 0 /news/punjab180119 1 12642 0 0 /news/551bc99d4d5e6 2 19039 0 0 /news/dartford050619 3 19164 1 1 /news/bromleyontheorientcomeoutinforceonourmemorabledaysaysbromleyownerjerrydolke 1 13973 0 0 /news/charity130417 1 12317 0 0 /news/ihavedecidedtotakeastepbackfrommanagementtofocusonoff-the-pitchmatterssaysleehill 1 12000 0 0 /news/tunbkspor141020 4 100134 0 0 /news/othernews/13thseptroundup.html 1 0 0 0 /news/faversham220620 2 24339 0 0 /kent-invicta-league/23 2 24764 0 0 /news/551a9c92ee208 3 31464 0 1 /news/hessenthalerhooksagoalkeeper 1 14362 0 0 /news/brompal300715 2 32656 0 0 /news/itsmegafrustratingthatno-onesupportsussaysmeadbosskeithmcmahon 1 17262 0 0 /news/ashford170817 6 42899 3 3 /news/therefereehadnoideawhatwasgoingonorwhathewasdoingblastsstrouts 1 15378 0 0 /news/sladegreenjobisupforgrabssayscaretakermalin 1 16970 0 0 /news/551bc5e6b69e1 1 18423 0 0 /news/hythe070716 2 25230 0 0 /news/551a99e44e724 1 14775 0 0 /news/kentleague/sladegreen/readingreplay310804.html 1 0 0 0 /news/becksimprovefloodlightingatedenparkavenue 1 12609 0 0 /news/fordexplainshisdeparturefromvcdathletic 1 15702 0 0 /news/transferfeadlinedaydeals010221 1 17390 0 0 /news/foresthillpark060718 1 14194 0 0 /news/551a99e47289b 2 28228 0 0 /news/robbinsgetshiscroydoncareerofftoawinningstart 1 14793 0 0 /news/matatasdrivingambitiontosucceed 2 20162 0 0 /news/weneedtheweathertobekindtoussayscraywanderersbosskeithbird 1 16120 0 0 /news/folkestoneinvicta3-2hastingsunited-wegaveiteverythingsaysplay-offfinalistneilcugley 1 28070 0 0 /news/vcdathletic1hernebay1exclusiveinterviews 1 15429 0 0 /news/551a956c1500f 1 4973 0 0 /news/erithbel301117 1 13409 0 0 /news/551a97b1953c1 1 15408 0 0 /news/wecantrelyonotherteamssayslovell 1 15875 0 0 /news/maidstone220518 2 15047 0 0 /news/craywandsFlamingoPark140318 3 31912 0 0 /news/ashbymakesquainhisfirstsummersigning 1 11332 0 0 /news/gillingham090122 1 12701 0 0 /news/551bc5db700ef 3 62185 0 0 /news/princesparkopenerisallticket-exclusiveinterview 1 12858 0 0 /news/ifyoulookatoursquaditsgoodenoughtogetpromotedsaysstonesbossjaysaunders 1 15052 0 0 /news/wedontwanttheseasontoendsayswhitstabletownbosspeternott 1 12243 0 0 /news/thepressureisonmargatesaysthamesmeadtownbosskeithmcmahon 1 13733 0 0 /news/kentleague/tunbridgewells/21stjuly04.html 1 0 0 0 /news/wetrulybelievewecanfinishinastrongpositionsayselthampalacescharliemccarthy 1 13066 0 0 /news/ihavetheutmostrespectforourkentleaguerivalssayscroydonboss-exclusiveinterview 1 17432 0 0 /news/stonesconfirmhomelandsgroundsharedeal 1 13176 0 0 /news/angelstransferlisttwokeyassetstobringinextrafunds 1 26030 0 0 /news/drmartens/premier/dover/23rdaug04.html 1 0 0 0 /news/dealtown190819 1 11703 0 0 /news/tonbhyth071117 3 92953 0 0 /archive-2006-2014/107 1 20791 0 0 /news/fisherinvitesupportersforsix-monthprogressreport 1 12908 0 0 /news/drmartens/eastern/sittingbourne/ashford091104.html 1 0 0 0 /news/bromley210517 1 14980 0 0 /news/phoenixsports6-1sevenacresidcup-thisclubisgoingtogetbiggersayssteveoboyle 1 31504 0 0 /news/stalbanscity4-0tonbridgeangels-wehaventgotladsthattaketheirchancessayswarrilow 1 31426 0 0 /news/wedontfearhernebaywerespectthemsayserithtownbosstonyrussell 1 14215 0 0 /news/welosttothebettersideadmitsseager-exclusive 1 13453 0 0 /news/551bc99c19980 2 29090 0 0 /news/rymanleagueannouncenewinitiatives 1 11844 0 0 /news/davidsonbreakslegduringkentseniortrophytie 1 12126 0 0 /news/551bc99c3673f 2 20987 0 0 /news/bromleyrecallstrikerpaulvinesfromhisloanspellatmaidstoneunited 1 16903 0 0 /news/rustgleb050317 1 17747 0 0 /news/ebbsfleet231120 1 11981 0 0 /news/gillingham020919 2 15849 0 0 /news/18thapr04A.html 1 0 0 0 /news/551bc5dfd8ba2 1 27826 0 0 /news/551a9c92e5865 2 33671 0 0 /news/551a96dc0b355 1 3379 0 0 /news/weneedsupporttomoveforwardsaysfavershambossjustinluchford 1 21328 0 0 /news/deanharrisonwasthestand-outcandidateinareallyimpressivefieldsaysfisherchairman 2 17272 0 0 /news/gillihadtotakeoverteamaffairsasitwasajollyupunderharmsworth-exclusive 1 18191 0 0 /news/551a96dca0bc4 2 25468 0 0 /news/glebe170320 1 24248 0 0 /news/dolbykeepshisoptionsopen 1 14672 0 0 /news/bridonropes1-0hollandsblair-allwecandoisgiveourselvesachancesaysbridonropesboss 1 25329 0 0 /news/tonbridgeangels1-5horsham-itsadaytoforgetadmitswarrilow-exclusive 1 27253 0 0 /news/mileswemuststeponthegastoreachfinal-exclusiveinterview 1 14302 0 0 /news/bromanch150215 2 36364 0 0 /news/FAStatement090621 3 41444 0 0 /news/luchforddefendsplayinghisteaminreserveshocker 1 17192 0 0 /news/resultssept2015 2 118473 0 0 /news/favershamcontinuestoimprovebothonandoffthepitchsaysrayturner 2 16257 0 0 /news/erithtownbears301117 1 13942 0 0 /news/wearethrilledtobehostingourfirstinternationalsaysdartfordco-chairmanbillarcher 1 12323 0 0 /news/wemustcutoutindividualmistakes-daish 1 12479 0 0 /news/551bc5e747ef2 1 16716 0 0 /news/idontwantfanstogohomewiththehumpsayscraybossianjenkins 1 18832 0 0 /news/weresearchingfortherightmanforthejobsaysfisherboard 1 12513 0 0 /news/langtonrelishingimportantmonthahead 1 13957 0 0 /news/thissquadofplayerswillnotgetusrelegatedinsistsward 1 16171 0 0 /news/lordswood101117 1 12083 0 0 /news/whitstablebay280617 1 11702 0 0 /news/beckcroy140921 1 30935 0 0 /news/wehavetogiveravensachancetodevelopsayscouncilleader 1 13670 0 0 /news/torqnott120621 9 133014 5 5 /news/wp-content/plugins/wp-file-manager/lib/files/abruzi.php 1 0 0 0 /news/farepresentativefailstoturnupatleaguemeeting 1 13363 0 0 /news/crockenhill060815 2 16773 0 0 /news/wemustliveuptoexpectationsinsistsdartsboss-exclusiveinterview 2 21605 0 0 /news/wellgetoutofourstickyspotinsistsfrancis 1 16091 0 0 /news/cyrilwindiate260219 2 15304 0 0 /news/wealwayssaidwewontstandinanyoneswayofprogressingsayssittingbournebossnickdavis 1 14464 0 0 /news/551bc5e86c3eb 1 11531 0 0 /news/dartford0-1charltonathletic-sawyerpleasedwithattackingoptions 1 19352 0 0 /news/551bc99dbe7a4/kentleague/sladegreen/othernews/13thseptroundup.html 2 15653 0 0 /news/ashford250118 3 28790 0 0 /news/soccershorts1300raisedbyashfordandwellinglegends 1 47280 0 0 /news/conference/gravesend/2ndjuly03.html 1 0 0 0 /news/manchester270517 2 28388 0 0 /news/whitstabletownbosspeternottsnapsupprolificstrikerkeelanmooney 1 11856 0 0 /news/wererelishingplayingtwogamesaweeksaysward 1 19195 0 0 /news/kentleague/tunbridgewells/27thsept04.html 2 0 0 0 /news/hernebay2-0collierswoodunited-idontfearournextvaseopponentssaysconfidenthalsey 2 61892 0 0 /news/soccershortsifwecanstayupthenwewillbedoingreallywellsaysdoversbarrycogan 1 25052 0 0 /news/wp-22.php 1 0 0 0 /archive-2006-2014/183 1 19331 0 0 /news/wellscoachgibbonsreflectsonamixedseason 1 14263 0 0 /news/idontexpectaneasyopeneratfisherwarnsfirkins 1 13255 0 0 /news/551a979925585 1 5827 0 0 /news/wellingunited130623 2 23768 0 0 /news/chathamtown1-2gillingham-thetrophycabinethasntbeenopenedforsolongsayskevinwatson 1 19499 0 0 /news/vcd190918 2 31609 0 0 /news/kentleague/whitstable/whitstablevdeal250803.html 1 0 0 0 /news/greeniesfridaypreview7thapril2006 1 16988 0 0 /news/lottoptsformovetodulwichhamlet 1 11782 0 0 /news/lawrencesdisappearanceupsetsseager 1 15029 0 0 /news/pennockwemusttakeourchancesagainstweymouththechelseaofconferencesouth 1 13515 0 0 /news/sctstan150917 1 27823 0 0 /news/fleethanded15214ticketsforfatrophyfinal 1 13996 0 0 /news/chatham110817 1 12549 0 0 /news/bridonropes050619 2 14725 0 0 /news/wedontfearhigherleaguehorshaminsistseveritt 1 14142 0 0 /news/ifeelitsveryimportanttogainmomentumgoingintocupfinalsayslyddtownbossdavesmith 1 12499 0 0 /news/tunwells020916 1 11939 0 0 /news/wp-content/plugins/formcraft/file-upload/server/php/files/a57bze8931.php 1 0 0 0 /news/greeniesfridaypreview-whowilljoinfleetinlastqualifyinground 1 18735 0 0 /news/resultsoctober2018 2 107032 0 0 /news/ashfordtownquittherymanleague 1 11836 0 0 /news/weresorrytoseeyouleavesayschatschairman 1 13199 0 0 /news/wellbepreparedforpottoncupclashinsistsoboyle 1 12819 0 0 /news/hythetown3-4maidstoneunited-maidstonewanteditmorethanusadmitsscottporter 1 34083 0 0 /news/charltonathletic0-6sheffield-werepositivethatwecanbeatdurhamsayssheffieldcoach 2 32791 0 0 /whitstable-2003-2006/2 1 14429 0 0 /news/myplayershavemadehistoryforsevenoakstownsaysaproudjones 1 16029 0 0 /news/551a92505d62c 3 28074 0 0 /news/551bc5e34201f 1 16269 0 0 /national-league/34 2 23277 0 0 /news/drmartens/eastern/ashford/22ndnov04.html 2 0 0 0 /news/bigcrowdexpectedatthebelmontforcanterburycitysreturn 1 15730 0 0 /news/551bc5dee9569 1 21843 0 0 /news/dorkgreen130816 3 65201 0 0 /news/23rdsept05.html 1 0 0 0 /news/favershamtown2-1maidstoneunited-wewerentattheracesadmitsjaysaunders 1 18528 0 0 /news/stafav120915 2 62059 0 0 /news/551a9797c563c 1 3308 0 0 /news/wejusthavetoreactatconcordrangerssayscraywanderersbossianjenkins 1 12537 0 0 /news/officialsontheendofcoldblastfromfrancis 1 15920 0 0 /news/afccroydonathletic190523 2 21056 0 0 /news/tunbridgewells080819 1 11951 0 0 /news/ourfootballisoutofthisworldsayswelford 1 14204 0 0 /news/soccershortssladegreenappointlonghurst 1 27048 0 0 /news/bromashot160816 2 38932 0 0 /news/sittingbourne1-0waltoncasuals-lovellnotpleasedwithperformanceashissidegojointtop 1 17655 0 0 /news/jackbaldwinssuccessstoryistheproudestdayofmymanagerialcareersaysjustinluchford 1 17266 1 0 /bromley-2003-2006/5 2 18227 0 0 /news/warrilowrelishinghornetsreunion-exclusive 1 20093 0 0 /news/mcpheerelishesplainmoorreturn 1 14317 0 0 /news/ashftonb140518 4 134907 0 0 /news/gillingham160819 2 21902 0 0 /news/bromleywrexham08082015 2 39174 0 0 /news/bowryjoinsbromleysnewlookmanagementteam 2 13472 0 0 /news/goldbergwevegotareallygoodchanceofgettingpromotedthisyear 1 17845 0 0 /news/30thapr05.html 1 0 0 0 /news/benjudgeisanimportantbitofthejigsawwithhisexperienceatthebacksaystommywarrilow 1 13980 0 0 /news/wewanttostayinthiscompetitionforaslongaspossiblesaystommywarrilow 1 16635 0 0 /news/vcdathletic270423 2 41315 0 0 /news/stansfeld110920 1 14695 0 0 /news/itsevidentwecantcompetewiththebigboysadmitselthampalacebossterrynaden 1 14949 0 0 /news/cosgroveconfirmshisinterestinwatts-exclusive 1 15201 0 0 /news/damiannotabletocommithimselftofolkestone 1 13928 0 0 /news/doverathleticbeginsearchfornewsponsors 1 11724 0 0 /news/eritcray140823 2 73969 0 0 /news/doubletransferdealfallsthroughateleventhhour 1 14105 0 0 /news/angelsgettheirmainman 2 15546 0 0 /news/arisremainsupbeatoverwandsplay-offchances 1 13046 0 0 /news/551a92508bafe 2 21201 0 0 /news/soccershorts170720 2 39555 0 0 /chatham-2003-2006/3 3 27863 0 0 /archive-2006-2014/135 1 19481 0 0 /news/greenwich260518 2 24113 0 0 /news/myhurtplayerswanttoputthingsrightsaysburman 1 16395 0 0 /news/sevenoaks070120 3 32770 0 0 /news/theresthingsthatarentrightatthemomentadmitshessenthaler 1 14562 0 0 /news/drmartens/eastern/tonbridge/12thaug04.html 1 0 0 0 /news/ilikedderesprofessionalismandplanssaysnewsigninglyons 1 14468 0 0 /news/crockenhill0-4lyddtown-wewanttogoashighaswecanintheleaguesayslyddbossdavesmith 1 30700 0 0 /news/afacuprunwillbringthecrowdstogreatnessparksaysjones 1 17324 0 0 /news/ryman/bromley/14thmar04.html 1 0 0 0 /news/9thapr04.html 1 0 0 0 /news/craywanderers1-0metropolitanpolice-osbornshowshisclassascraymakehistory 1 29886 0 0 /news/flanaganexplainswhyhehadtoleaveinvicta 1 14989 0 0 /news/tonbridgeangels030522 1 13138 0 0 /news/551a931eb13d2 2 26716 0 0 /news/FAStatement191220 3 29352 0 0 /archive-2006-2014/273 2 22796 0 0 /news/craywanderers1-2burgesshilltown-francisimproveorfaceeviction 1 36049 0 0 /news/dartford1uxbridge2tonightsresults 1 5393 0 0 /news/551bc5e0eeead 1 18743 0 0 /news/stonereturnstobromley 1 11600 0 0 /news/saliashf200216 1 29987 0 0 /news/ebbsfleetunited4-1graysathletic-daishheapspraiseonlocalteenagestrikersakindeandmoore 1 29857 0 0 /news/holmesdale0-3wellingunited-daysetforbudgettalkswithchairmanonfriday 1 37653 0 0 /news/folkestoneinvicta1windsoreton0 1 16109 0 0 /news/myplayersneedtostartwinningtheirownpersonalbattlesfumesnott 1 18634 0 0 /news/sheppey161116 1 13672 0 0 /news/551a97986e309 2 17861 0 0 /news/ramsunveilroystonsigning 1 11065 0 0 /news/folkestoneinvicta0-1afcwimbledon 1 14684 0 0 /news/faversham190620 2 25057 0 0 /news/theresabitofpressureonbothteamslookingfortheirfirstwinsaysbromleycoachneilsmith 1 17625 0 0 /news/551bc5e8b0434 1 11784 0 0 /news/crayhari090322 3 47848 0 0 /news/dartfordcoachinvitesgoalkeeperstobattleitout-exclusive 1 14089 0 0 /news/eastdart200419 2 41029 1 1 /news/gotanynews-1 1 10230 0 0 /news/wereupforthefightinsistsbromleycoachneilsmith 1 14537 0 0 /news/pitchero.com/clubs/suttonathletic 1 0 0 0 /southern-counties-east-football-league/51 1 19951 0 0 /news/551bc5e5b7969 1 13904 0 0 /news/wemustbeattheteamsaroundussaysdaish 1 19130 0 0 /news/chathamtown2-0thamesmeadtown-chatsnewboysimpressduringderbydaydelight 1 18189 0 0 /archive-2006-2014/163 1 18957 0 0 /news/wiskerhasthepotentialtobethebestintheleaguesaysseager 1 16297 0 0 /news/sporkent270317 1 32642 0 0 /news/wemustfindthecuttingedgesaysseager 1 13705 0 0 /news/ryman/bromley/4thjuly04.html 1 0 0 0 /news/maidstone091117 1 14132 0 0 /bromley-2003-2006/4 2 18248 0 0 /news/wellingunited130120 1 12346 0 0 /news/crayrussell070515 3 27600 0 0 /news/charltonathleticsealmovetobaylissavenue 1 14000 0 0 /news/themostimportantthingistostayinthisdivisionsaystonbridgeangelsbosstommywarrilow 1 12527 0 0 /news/kinglydd030923 4 125110 0 0 /news/wewillstruggletokeepholdoffourbetterplayerssayserithtownassistantlewwatts 1 22500 0 0 /news/phoenix260418 1 13576 0 0 /news/ashford151005.html 1 0 0 0 /news/margate080618 3 26142 1 1 /news/bashvfolk081103.html 1 0 0 0 /news/luchfordrubbishesbigspendingtag 1 12198 0 0 /news/charlton281217 3 31560 0 0 /news/ryman/bromley/bromvashfordfac160903.html 1 0 0 0 /drmartens/eastern/folkestone/gravesend160705.html 1 9955 0 0 /news/kentishfootballaresoproudofthefleetwewerespotonsaystwo-goalheromcphee 1 16281 0 0 /news/bromley080818 2 22740 0 0 /news/551a92505a9d6 2 15394 0 0 /news/maldon170905.html 1 0 0 0 /news/tonbridgeangels090920 1 13092 0 0 /news/werelishupsettingthebigboyssaysbinks-exclusive 1 14930 0 0 /news/wellingunited140322 1 12381 0 0 /news/imdelightedtohavejean-michelsigereonboardsayschathamtownbosskevinwatson 1 11407 0 0 /news/peckham220117 2 15771 0 0 /news/lordswood230916 1 11623 0 0 /news/ws.php7 1 0 0 0 /news/metcalfrallieshistroopsafterheartbreakingfacupexit 1 17561 0 0 /news/warrilowthreatenstowieldtheaxe 1 14945 0 0 /news/ithasnotbeeneasytolandjackpartersayswhitstabletownchairmangaryjohnson 1 14142 0 0 /news/hessenthalerwantshomeformtogetbackontrack 1 20688 0 0 /news/wellfindoutabitmoreourselvesagainstcroydonathletic-ward 1 14708 0 0 /news/tonbridgeangels1-1weston-super-mare-youslipandyougetpunishedsaystommywarrilow 1 27954 0 0 /news/uckfdart220918 3 51788 2 2 /news/bromley2-1suttonunited-wegaveourfanswhattheywereaftertodaysaysmarkgoldberg 2 39504 0 0 /news/wehopeournewgroundwillbeanassettofisherandourlocalcommunitysaysfisherchairman 1 16110 0 0 /news/croyvcd240816 3 72609 0 0 /news/1stdec05.html 1 0 0 0 /news/aveleysexpectationsareashighasourssaysfrancis 1 16022 0 0 /news/conference/gravesend/3rdoct04.html 2 0 0 0 /news/551bc5e3de50e 1 11465 0 0 /news/croydon0-5phoenixsports-youdontwinanythingindecembersayssteveoboyle 2 39394 0 0 /news/dolbyslamspiscinaoverhisdecisiontoleave 1 13640 0 0 /news/551bc5e4edb02 1 11329 0 0 /news/kentleague/sevenoaks/sporting061104.html 1 0 0 0 /news/551a96dbe1bd1 2 15939 0 0 /news/551a95b45037b 2 20385 0 0 /news/551bc5e029d65 3 46436 0 0 /news/551bc5e800da8 1 16392 0 0 /news/551a99e39e8c6 1 11792 0 0 /news/suttfish100822 1 28650 0 0 /news/theweekahead-8 1 14191 0 0 /news/dartford3-1doverathletic-weneedtopulltogethertogetoutofthisholesaysshanehuke 1 23275 0 0 /news/werereadytopouncesayshalsey 1 22581 0 0 /news/burgesshilltown0-2ashfordtown 1 13056 0 0 /news/aldershot221005.html 1 0 0 0 /archive-2006-2014/147 1 19391 0 0 /news/551bc5e855693 1 10267 0 0 /news/551bc5dab80ea 3 24755 0 0 /news/wp-admin/xl2023.php 2 0 0 0 /news/lillisstepsdownashernebaymanager 1 12434 0 0 /news/sctmasonsimms130219 1 11307 0 0 /news/drmartens/premier/dover/22nddec03.html 1 0 0 0 /news/margate270817 2 29018 0 0 /news/kirstydowle121219 3 31460 0 0 /news/mymainaimistogetbackintofull-timefootballandbromleycanhelpmesaysharryharding 1 16347 0 0 /news/neilcugley1000 2 28612 0 0 /news/551a9c0f252cc 2 22981 0 0 /news/551a9250c39a2 4 37961 0 0 /news/551bc99dbe7a4/drmartens/eastern/tonbridge/drmartens/eastern/sittingbourne/13thaug03.html 2 15653 0 0 /news/fordcallsuponlocalsupporttoseethemthrough-exclusiveinterview 1 19827 0 0 /news/551bc5df37c77 1 14041 0 0 /news/midweekfixtures-1 1 48116 0 0 /news/teamnightsoutwillhelpourpromotioncausesaysbrady 1 14096 0 0 /news/stonespromotenottandcornwellfromwithin 1 16755 0 0 /news/551bc5e2ab850 1 11055 0 0 /news/stalbans050405.html 1 0 0 0 /news/wehavetogetbackintoplay-offhuntsayspennock 1 12664 0 0 /news/551bc99dbe7a4/drmartens/eastern/ashford/othernews/pitches25thjuly03.html 2 15653 0 0 /news/whitstabletownunveilnickysouthallastheirnewmanager 1 13553 0 0 /news/12thoct05.html 1 0 0 0 /news/eastphoe291016 2 60857 0 0 /news/551a9798de1bc 1 4998 0 0 /news/racistattacks210919 1 17299 0 0 /news/fishersaytheyoweusonewarnshernebaybosssimonhalsey 1 13560 0 0 /news/southernyouth/12thjuly03.html 1 0 0 0 /news/wallisstepsdownasfolkestoneinvictachairman 1 11338 0 0 /news/fisheru18vbromu18070304.html 1 0 0 0 /news/551bc5e37fceb 1 14213 0 0 /news/drmartens/eastern/tonbridge/16thfeb04.html 1 0 0 0 /news/wp-content/style.php 1 0 0 0 /news/551a9c92105a0 3 42801 0 0 /news/holmcray281015 1 32157 0 0 /news/burmantellshissidetogetontheirbike 1 12775 0 0 /news/dulwichhamlet050320 1 12279 0 0 /news/glebe290116 1 12825 0 0 /news/dulwich050718 1 13672 0 0 /news/newwellsbossmakesdoubleswoop 1 11932 0 0 /news/551a9250f260d/25thjuly05G.html 2 6643 0 0 /news/ksports171116 1 13135 0 0 /news/olliesstayingunlesswegettherightoffersaysward-exclusive 1 15051 0 0 /news/margate180521 5 60855 0 0 /archive-2006-2014/45 1 21004 0 0 /news/eagledeyedmullinputschelmsfordonthespot-fatrophynews 1 23440 0 0 /news/othernews/20thaug03.html 1 0 0 0 /news/rusthall020719 1 11979 0 0 /news/favershamunveilreardonasnewreserveteammanager 1 15025 0 0 /news/551bc99e48d20 2 20632 0 0 /news/551a99e5551da 1 20387 0 0 /news/bromleyt020419 2 41414 0 0 /news/erithbelvedere0-2godalmingtown-cosgrovewewerebossedoutofthegamebyadirectside 1 25967 0 0 /news/sceflstatement060620 1 10908 0 0 /news/mcmahonwevegotagreatchancetogetintotheplay-offs 1 16043 0 0 /news/soccershortskcfapublishcountycupdraws 1 27217 0 0 /news/551a97b1c93c0 1 15136 0 0 /news/ebbsfleetunited1-1colchesterunited-theresstillroomforimprovementadmitsdaish 1 21216 0 0 /news/tunwells300615 1 12101 0 0 /news/551bc99b7f9fd 1 4002 0 0 /news/aveley050205.html 1 0 0 0 /news/damianabelleftunderabitofacloudadmitswhitstabletownbossjustinluchford 1 12055 0 0 /news/soccershortspersonalreasonsforcefordtoswiftlyquitderes 1 32634 0 0 /news/tunbgleb250220 1 11165 0 0 /news/25thmay04.html 1 0 0 0 /news/brombrai280217 2 37235 0 0 /news/phoenix010418 2 25667 0 0 /news/sheppey180920 1 13623 0 0 /news/wellwest251117 1 26958 0 0 /news/551a9bb0029bc 3 29140 0 0 /news/22ndoct04.html 1 0 0 0 /news/551bc5e26bacc 1 13243 0 0 /news/551bc5e4f16ef 1 12316 0 0 /news/drmartens/eastern/folkestone/heybridge301004.html 2 0 0 0 /news/erith147sports130615 2 19623 0 0 /news/551bc5dd0d7c9 1 23045 0 0 /news/beckenhamtown2-1mauritiussports-weturnedupwiththewrongattitudesayshuntley 1 36254 0 0 /news/551bc5e3d3f79 1 15471 0 0 /news/chathamtown0-2graysathletic-werenotabadteamonthebackofoneresultsayskevinwatson 1 18710 0 0 /news/weknowwhatwevegotinourchangingroomsaystunbridgewellsbossmartinlarkin 1 12528 0 0 /news/2ndjuly03.html 2 0 0 0 /news/bromley210417 2 22960 0 0 /news/bromleians060718 2 20493 0 0 /news/tunbridgewells1lordswood1-farnieimresignedtolosingwhitehouseexclusiveinterview 1 19133 0 0 /news/doverathleticgothatextrainchtoclinchtitle 1 13188 0 0 /news/glebe01112019 1 12316 0 0 /news/kspoholm170719 1 31630 0 0 /southern-counties-east-football-league/22 1 19589 0 0 /news/551a97b0ac9f9 1 16855 0 0 /news/alfanew.php7 1 0 0 0 /news/bearsted291217 1 12827 0 0 /news/weneedtomakeourhomegamesastoughaspossibleforotherteamssayswellingbossjamieday 1 13696 0 0 /news/bromley151219 2 19303 0 0 /news/sittingbourne030217 2 27441 0 0 /news/rymanpaircountthecostofbrokendreams-exclusive 1 19438 0 0 /news/wefaceatallordertoreachtheplay-offsadmitsford 1 14983 0 0 /news/wellcomeoutfightingvowsburman 1 15229 0 0 /news/tunbridgewells1-3erithtown-imveryambitiousandiwanttokickonsaystonyrussell 1 36026 0 0 /news/langtonlooksforwardtoworkingwithlovell 1 16231 0 0 /news/gillingham210519 2 30696 0 0 /news/sevenoaks181015 1 13046 0 0 /news/soccershortsfavershamstruckbyboltoutoftheblue 1 15684 0 0 /news/ryman/bromley/29thsept03.html 1 0 0 0 /news/no-onecancatchwhitstableconceedsmcmahon-exclusiveinterview 1 15761 0 0 /news/551a95b46ab2d 2 18787 0 0 /news/mitchellgivescountyleaguequartettheirchancetoshine-exclusive 1 14777 0 0 /news/whitstabletown2beckenhamtown0 1 15497 0 0 /news/sevenoaks071204.html 2 0 0 0 /news/27thaug04.html 1 0 0 0 /news/551a956c896ef 1 3507 0 0 /news/hessenthalerre-signslocalhero 1 13898 0 0 /news/kentleague/ramsgate/ashfordu18vramsgateu18.html 1 0 0 0 /news/sladevsport170404.html 1 0 0 0 /news/ihaveenjoyedeightwonderfulyearsatebbsfleetunitedsaysliamdaish 1 12617 0 0 /news/551a9678b44b5 3 32850 0 0 /news/wedbehappyaslarrytogetintotheplay-offssaysashby 1 15649 0 0 /news/chelsea4-0dartford-wellrememberthisfortherestofourlivessaysderenibrahim 2 38762 0 0 /news/ramsgate1-1margate-refereetakesflackasninecardsareproducedinbattleofthanet 1 28657 0 0 /news/bromley100519 2 15247 0 0 /news/sct310818 2 17146 0 0 /news/tunbridgewells1-0dunstonuts-itfeelsspecialtoknockouttheholderssaysmartinlarkin 1 28820 0 0 /news/crockenhill300816 2 14274 0 0 /news/chipstead3-0whitstabletown-itwasdiabolicaladmitsupsetmunday 1 31102 0 0 /news/551bc99dbe7a4/drmartens/eastern/ashford/kentleague/tunbridgewells/tunvslade130903.html 2 15653 0 0 /archive-2006-2014/4 3 43418 0 0 /news/folkestone061219 2 25325 0 0 /news/23rdjune04.html 1 0 0 0 /news/fisher140719 1 12394 0 0 /news/folkestoneinvicta1-0harlowtown-mevdeserveshistestimonialsayscugley-exclusive 1 21122 0 0 /news/welling141216 1 12399 0 0 /news/walkertellshissidetostayclearofrelegationzone 1 13633 0 0 /news/551bc99dbe7a4/drmartens/eastern/sittingbourne/kentleague/ramsgate/29thsept03.html 2 15653 0 0 /news/browntargetskentleaguereturn-exclusive 1 12860 0 0 /news/thefacarlsbergtrophyfinalebbsfleetunited1-0torquayunited-fleetbringthetrophyhome 2 36043 0 0 /news/551a9c0e3530f 2 14514 0 0 /news/thamesmead161004.html 1 0 0 0 /news/drmartens/eastern/folkestone/maidstone030804.html 1 0 0 0 /news/erithbelvedere2-0favershamtown 1 14275 0 0 /news/phoenix220319 2 24530 0 0 /news/gillsafcwimb111015 2 65512 0 0 /news/protheroeappealsagainstgrossmisconduct 1 11863 0 0 /news/soccershortsprotheroeu-turnashewantswingsjob 1 50909 0 0 /news/snodlandtown091019 1 12184 0 0 /news/hythes27-goalstrikerpens18-monthcontract-exclusive 1 18238 0 0 /news/therealdealtommysampsonswembleymanuscript 1 11829 0 0 /news/cugleywecoulddowithalift 1 17709 0 0 /news/wegotoutofjailadmitshessenthaler 1 12749 0 0 /news/wellcomebackevenstrongernextseasonsaysramsgatechiefrichardlawson 1 18566 0 0 /news/nodisrespecttothelondoncupbutpromotionisourprioritysaysianjenkins 1 16627 0 0 /news/tonbethu140215 2 55210 0 0 /news/kentleague/deal/Sampson7.html 1 0 0 0 /news/ramsgate051020 3 34051 0 0 /news/eritburg220823 4 114182 0 0 /news/unfortunatelyasaclubwerenotinapositiontotemptthemtostayadmitswhitstabletownboss 1 12374 0 0 /news/greenwich090205.html 1 0 0 0 /news/croydon070220 1 12272 0 0 /news/othernews/6thdec04.html 1 0 0 0 /news/wemustwinourhomegamessayscugley-exclusive 1 15029 0 0 /news/trottwearetreatingwhitstablewithrespect-exclusive 1 14454 0 0 /news/brombris191119 2 39113 0 0 /news/angelsgolive 1 12545 0 0 /news/sheppey291217 1 13018 0 0 /news/551a979a2e2e3 1 4839 0 0 /news/wellingtown030921 1 13083 0 0 /news/stonesapposetrophypresentationtiming 1 17722 0 0 /news/itsbusinessasusualatbromleysaysassistantmanagerhaydenbird 1 21279 0 0 /news/dulwichhamlet1-1maidstoneunited-theresgoingtobealotmoretwistsandturns-jaysaunders 1 29686 0 0 /news/drmartens/eastern/ashford/24thmar04.html 1 0 0 0 /news/stonesunveilsubstantialsponsorshipdealwithbritelitewindows 1 12450 0 0 /news/ryman/bromley/5thdec03.html 1 0 0 0 /news/promotedthamesmeadprepareforlifeinrymanonenorth-exclusive 1 14312 0 0 /news/chancetoplayback-to-backchampions 1 10143 0 0 /news/551a956b9ab5b 2 17053 0 0 /news/goodinggetstheblues-exclusiveinterview 1 17631 0 0 /news/overthetwogameswewerethebettersideagainstgrayssayshernebaybosssamdenly 1 15698 0 0 /news/12thjuly04.html 1 0 0 0 /news/13thjune04.html 1 0 0 0 /news/drmartens/eastern/folkestone/8thjuly03.html 2 0 0 0 /news/drmartens/premier/dover/4thoct04.html 1 0 0 0 /news/2ndsept05.html 1 0 0 0 /news/webelievewehavesignedthebestplayeratthislevelsayskfumanagersammacneil 1 14927 0 0 /news/abbotthasthedefencetocausestainesashock 1 18732 0 0 /news/wevedroppedbelowourhighstandardsadmitsfrancis 1 14447 0 0 /news/551a9c9247459 3 59282 0 0 /news/canterburycity120622 2 16594 0 0 /news/kentcountyleague3hertfordshireseniorcountyleague0 1 14002 0 0 /news/wemustkeepholdofourbestplayerssaysbrady 1 15224 0 0 /news/avelcars161219 3 44924 0 0 /news/wevegottoconcentrateongoingasfaraswecansayshernebaybosssimonhalsey 1 15695 0 0 /southern-counties-east-football-league/26 1 20461 0 0 /news/gorere-signsforhishome-townclub 1 11033 0 0 /news/hollandsblair4-3lyddtown-wewerentatourbesttodayadmitsblairbosspaulpiggott 1 32672 0 0 /news/ashfordtown2-2corinthiancasuals 1 12636 0 0 /news/551bc5e1c32b9 2 18588 0 0 /news/551bc5e38531b 1 16634 0 0 /news/whitstable020220 2 25517 0 0 /news/theresnothingtoworryaboutinsistsupbeatlangton 1 17089 0 0 /news/tompkinsunveiledascroydonsnewmanager 1 13372 0 0 /news/gillsratcliffe230415 1 13131 0 0 /news/551a9c9160346 3 31864 0 0 /news/thekentleaguetitleraceiswideopensaysnortonbossbentaylor 1 22423 0 0 /news/iwanttotastemorekentcupsuccesssaysgillsskipperlyon 1 18312 0 0 /archive-2006-2014/80 1 20625 0 0 /news/hayesyeadingunited4-2ebbsfleetunited-myplayershavecheatedmesaysdaish 1 28578 0 0 /news/darttorq041218 2 40051 0 0 /news/drmartens/premier/dover/15thoct04.html 1 0 0 0 /news/ryman/bromley/havantvbromfayc020903.html 1 0 0 0 /news/favershamaimingtobreakintotopsix 1 17236 0 0 /news/sladegreen0-4whitstabletown-whitstablemoveonestepclosertoryman 1 11967 0 0 /isthmian-league/49 3 44110 0 0 /news/551bc99ddb764 2 24748 0 0 /news/reviseddrawsthefatrophyandthefavase 1 11031 0 0 /news/erithtown1beckenhamtown2exclusiveinterviews 1 19865 0 0 /news/hopefullywecannowturnanewleafasjanuaryapproachessaysramsgatebossdeanhill 1 12760 0 0 /news/soccershorts030916 2 41105 0 0 /news/angryjennerfightforthecluborgetout 2 17176 0 0 /news/fansraisefundsfordartford 1 11974 0 0 /news/wellletourfootballdothetalkingsayslewishamboroughbosskevinharris 1 15598 0 0 /news/theresnoreasonwhybeckenhamtowncantrealisetheirfullpotentialsayscoachdarrenanslow 1 14263 0 0 /news/croycroy071216 1 34262 0 0 /archive-2006-2014/131 1 20184 0 0 /news/drmartens/eastern/tonbridge/10thsept04.html 1 0 0 0 /news/sevedart140718 3 73310 1 1 //kentishfootball.c 1 3711 0 0 /news/551bc5e7de2d6 2 16566 0 0 /news/invictaextendhighly-ratedkeepersstay 1 11054 0 0 /news/whitstable290105.html 1 0 0 0 /news/chelmsfordareaclassabovewarnscugley 1 18324 0 0 /news/kentleague/hythe/sevenoaks140804.html 1 0 0 0 /news/sheppeyunited140723 2 24135 0 0 /news/kfuksp030217 1 12689 0 0 /news/wereaimingforashighaswecangetsaysholmesdalebossjohn-paulcollier 2 20079 0 0 /news/erithandbelvedere080105.html 1 0 0 0 /news/551a99e41a77f 2 31680 0 0 /news/wevegottheheartdeterminationandspirittogetusthroughsayskeithmcmahon 1 19990 0 0 /news/lordswoodunveilmitchellastheirnewmanager-exclusive 1 11956 0 0 /news/craywanderers190622 3 26308 0 0 /news/craywanderers220322 3 31160 0 0 /news/rochester031117 1 11951 0 0 /archive-2006-2014/38 2 25529 0 0 /news/wemustavoidslippingupagainstcasuals-langton 1 12315 0 0 /news/wehavetotakethebullbythehornsandgetoutofourlittlerutsaysjoefrancis 1 16576 0 0 /news/cordiceeveryonewillgetachance 1 24715 0 0 /news/garyjohnsonappointedontherymanleagueboard 1 12850 0 0 /news/551a931e3262e 1 11321 0 0 /news/whitebringsindagenhamstrikertogivedoverthecuttingedge 1 19960 0 0 /news/eastbournevlordsfac230803.html 1 0 0 0 /news/englandbidfor2018worldcup 1 13082 0 0 /news/burmansdartsembarkonbigweek 1 16012 0 0 /news/crayafcw160317 1 27117 0 0 /news/kentleaguecupfinalwewillgivesevenoakstheutmostrespectsayshalsey 1 20262 0 0 /news/folkestone270320 2 28737 0 0 /news/wewanttobuildateamthataretochallengeforthetopthreesaysfisherbossstevefirkins 1 17909 0 0 /news/sittingbourne3-2waltoncasuals-willishasabrightfutureinthegamesayslovell-exclusive 1 20618 0 0 /news/folkestone181119 3 28869 0 0 /news/wemustprogressinthefacupsaysburman 1 12933 0 0 /news/redhillthugstarnishdoverathleticfacupwin 1 23337 0 0 /news/youjustwanttogetthemtothehighestpositionthattheycouldpossiblygettosaysrayturner 1 17119 0 0 /news/hythhern010220 2 67830 0 0 /news/dartford0-3borehamwood-welosttoabettersideconfessesburman-exclusiveinterview 1 17110 0 0 /news/november2009fixtures14-28november2009 1 51316 0 0 /news/wilkinsjoinsthepolice 1 12919 0 0 /news/ebbsfleetunited0-0yorkcity-ourfixturebacklogisridiculouscomplainsdaish 1 20441 0 0 /news/competitionwillkeepusonourtoessaysflanagan 1 17920 0 0 /news/12thsept03.html 2 0 0 0 /news/551bc5db806ad 3 32370 0 0 /news/551bc99dbe7a4/kentcounty/drmartens/eastern/dartford/7thjuly03.html 2 15653 0 0 /news/AFCWimbledon151105.html 1 0 0 0 /news/soccershortstunbridgewellslaunchsupportersdeal 1 18017 0 0 /news/greenwich110117 2 26680 0 0 /news/lordswood110123 1 12882 0 0 /news/daneluchfordfollowsolderbrotherjustintohorsham 1 13143 0 0 /news/holmfish150921 4 132970 0 0 /news/newashfordownersettoannouncethreenewqualitysigningsinmidweek 1 12240 0 0 /news/551bc5e25ed55 1 13536 0 0 /news/halifax080305.html 1 0 0 0 /news/erithbelv250915 1 12335 0 0 /news/punjab291217 1 12690 0 0 /news/bridonropes180119 2 15216 0 0 /news/folkestone140319 3 31557 0 0 /news/theplayersaresufferingfromalackofconfidenceatthemomentsayswhitstablesjustinluchford 1 14608 0 0 /news/551bc5e01cfcc 1 16350 0 0 /news/stoneschairmanclearsupstadiumconcerns 1 14042 0 0 /news/sevenseven190815 1 35189 0 0 /news/dockerscupheroeswehavenothingtofearsaystompkins-exclusive 1 16322 0 0 /news/whyteleafe0-3beckenhamtown-wevedeservedallthreetrophiessaysjasonhuntley 2 39776 0 0 /news/folkestonecapturerowland 1 14487 0 0 /news/551bc99dbe7a4/kentleague/thamesmead/kentleague/cray/1stsept03.html 2 15653 0 0 /news/551a96777d843 3 19727 1 1 /news/551bc5daba658 4 28165 1 0 /news/wewillneedtobeatourbestifwearetohaveachanceofbeatingeastbournesayshugolangton 1 14121 0 0 /news/stanfarn050515 2 39013 0 0 /news/whitstabletown0-6metropolitanpolice-embarrassing 1 36962 0 0 /news/vcdathletic0-1gillingham-imgotthebestsquadinsistsfoley-exclusive 1 21051 0 0 /news/bromalde191019 2 40627 0 0 /news/16thmay05.html 1 0 0 0 /news/wellingunited2-1concordrangers-concordmadeitdifficultforusadmitsbarryashby 1 23953 0 0 /news/vcdathletic0-2needhammarketaet-thequalitywasmissingadmitsfoley-exclusive 1 19145 0 0 /news/fishafcc290216 1 31049 0 0 /news/551a9677dab31 2 21267 0 0 /news/margateunveilbutlerastheirsurprisechoice 1 13968 0 0 /news/beingjoint-managerisnotformeadmitssimonhalsey 2 17662 0 0 /news/hayesputscontractsonhold 1 19122 0 0 /news/stoneschairmanreflectsonfifteenyearsatthehelm 1 16331 0 0 /news/favershamtown0-2ramsgate-justinluchfordslamsjimwardoverpenaltymissbust-up 1 18774 0 0 /news/margate250517 1 12571 0 0 /news/greenleyt300718 2 50809 0 0 /news/foleytargetstrioaheadofrymandebut 1 13711 0 0 /news/binksoptsforretirementtosupporthissonsfootballingcareer 1 14581 0 0 /news/jamiedaycontinueshissquadreshapingatebbsfleetunited 2 55040 0 0 /news/551a9c91b4b92 3 58578 0 0 /news/Enfitonb160118 4 84649 0 0 /news/rochester161017 1 12139 0 0 /news/soccershortsiwanttowinrymanleaguecupsaysburman 1 15927 0 0 /news/warrilowstrikersmuststartdoingsomedamage 1 14793 0 0 /news/551a9677b8280 3 37163 0 0 /news/16thjuly03.htm 1 0 0 0 /news/othernews/KYLFIX110204.html 1 0 0 0 /news/bromleysprideinbecomingahearttowntomarkcharitys50thanniversary 1 13553 0 0 /news/punjab030120 1 13121 0 0 /news/551a9798c6d6f 1 5005 0 0 /news/dartford4-2bromley-weknewbromleyweregoingtohaveagosaysdartfordbosstonyburman 1 30830 0 0 /news/551a9c0e66a03 2 14239 0 0 /news/551a979971515 1 4571 0 0 /news/gettingsentoffonmydebutwasstupidadmitshagan 1 14883 0 0 /news/margate130519 2 27239 0 0 /news/hamilton-omolethankfulforhistimeonloanatfolkestone 1 15326 0 0 /news/chathamtown0-1chipstead-angryobriencallshissideinforsundaymorningtraining 1 23069 0 0 /news/551a9797c748a 1 3386 0 0 /news/greenrams291116 4 85697 2 2 /news/551a979ace0d3 1 4622 0 0 /news/goalkeepersearchesfornewrecruitsforacademythatgavecorinthiandefenderdanbenthischance 1 14717 0 0 /news/margate280519 3 27186 0 0 /news/maidstone010116 1 11619 0 0 /news/itstakenusafewmonthstogetintoourstrideadmitsfisherbossbillywalton 1 18073 0 0 /news/551bc99c3aad5 2 18863 0 0 /news/goldbergcontinueswithhissquadbuilding 1 12817 0 0 /archive-2006-2014/260 1 19154 0 0 /news/551bc5e172656 1 16735 0 0 /news/tonbphoe031115 3 67220 0 0 /news/englandlionesses280615 1 14664 0 0 /news/kentishmanagersquestiontime 2 13225 0 0 /news/tunbridgewells1-1vcdathletic-rogersheroicshandswhitstablethetitle-exclusives 1 23037 0 0 /news/lordswood220917 1 12094 0 0 /news/dealtown291119 1 11768 0 0 /archive-2006-2014/198 1 18754 0 0 /news/beckcrow021019 3 55957 0 0 /news/rustkenn030423 4 134082 0 0 /news/551a9677a0e19 3 32086 0 0 /news/vcdhyt260119 2 76694 0 0 /news/fleetflyinghighastheyunveilnewsponsor 1 14294 0 0 /news/stoneschairmanasksforfinancialsupport 1 16644 0 0 /news/wellsblastmindlessmoronsafterattackcauses10kofdamage 1 13751 0 0 /news/fleetactivewithsuportersfortomorrowscheme 1 12394 0 0 /news/sevenoaks050517 2 19068 1 1 /news/weplaysomegoodfootballsohopefullypeoplewillcomeouttowatchussaysjamieday 1 14742 0 0 /news/doverathleticbossmartinhayesaddstohissquad 1 19040 0 0 /news/dicksonsnappedupbydulwich 2 13600 0 0 /news/cugleyunveilsedgeashisnewplayer-coach 1 18176 0 0 /news/wp-admin/js/about.php 1 0 0 0 /news/551bc99dbe7a4/kentleague/sevenoaks/drmartens/premier/welling/23rdsept03.html 2 15653 0 0 /news/tunvlordswood130803.html 1 0 0 0 /news/beckenhamtown300922 3 38985 0 0 /news/mypriorityistowinthekentleaguevowshythebossscottporter 1 16040 0 0 /news/sevenacre080416 1 11961 0 0 /news/drmartens/eastern/fisher/13thaug04.html 1 0 0 0 /news/specialyouthreportweneedtogivetheyoungstersachancetodevelop 1 21667 0 0 /news/othernews/31stJan04.html 1 0 0 0 /archive-2006-2014/170 1 19498 0 0 /news/cray131205.html 1 0 0 0 /news/hernebay220423 5 83290 0 0 /news/sladevwhitstable111003.html 1 0 0 0 /news/551bc5de54fb2 1 14067 0 0 /news/wewanttogetthehabitofwinninggamessaysebbsfleetunitedbossliamdaish 1 15277 0 0 /news/westhamlegendcotteecomestokent 1 11297 0 0 /news/hytheheroeswellbebangupforitandreadytocauseanotherfacupshockwarnsscottporter 1 20595 0 0 /news/551a931db4ea7 1 11965 0 0 /news/erithandbelvedere090123 1 16308 0 0 /news/closuretalkhasallbeenblownoutofproportioninsistsmalin-exclusive 1 16464 0 0 /news/crayave080915 3 70581 0 0 /news/kentfootballstarvictimofseriousknifeattack 1 11971 0 0 /news/wevegottogotothreebridgeswiththerightattitudesaysmaidstoneunitedbossjaysaunders 1 13205 0 0 /news/soccershortsletshopecome5pmonsaturdaywereinthenextroundofthefacup-longhurst 1 35749 0 0 /news/actordyernolongerourchairmansaysborosecretary 1 12284 0 0 /news/beckfave180423 5 139795 0 0 /news/defenderlloydhasnocommoncourtesyfumesseager 1 12128 0 0 /news/sittguer090118 3 60511 0 0 /news/tonbridgeangels3-3chathamtown-milesitsgoingwell-exclusiveinterviews 1 18568 0 0 /news/portermustdeliverpromotioninsistshythechairman 1 16558 0 0 /news/footballconferencefixturelist 1 10919 0 0 /news/maidstoneunited5-3abingdonunited 1 14801 0 0 /news/bromley290619 2 25381 0 0 /news/chathamlookingtorekindleoldflame 2 16784 0 0 /news/26thnov05.html 1 0 0 0 /news/mainstayswithangels-exclusive 1 12039 0 0 /news/551a979a3909a 1 6057 0 0 /news/kingstonian040904.html 1 0 0 0 /news/simonbalsdon230919 1 11505 0 0 /news/holmesdale2-4beckenhamtown-wewereonadifferentplanettothemsaysmichaelmarks 1 25582 0 0 /news/551a956d0e8a5 1 7127 0 0 /news/cugleywemusttakepointsoffeastthurrocktonight 1 16937 0 0 /news/wehavehadabrilliantseasonsaysbromleycoachhugolangton 1 14410 0 0 /news/fansloseconfidenceinmyfcaschairmanstepsdownatfleet 1 19092 0 0 /news/ebbsfleetunited0-1stevenageborough-thedaywhenstevenageshatteredourdreams 1 36101 0 0 /news/aylesburyunited0-0margate-weveturnedthecorneradmitstrott-exclusive 1 19290 0 0 /news/drmartens/eastern/folkestone/6thaug04.html 1 0 0 0 /news/beckenham231020 4 55166 0 0 /news/tonbridgeangels300423 2 24788 0 0 /news/kentleague/maidstone/22ndjuly03.html 1 0 0 0 /news/fisher010219 1 11992 0 0 /news/dartford1-2leatherheadsmashandgrableatherheadwinmarscarterscomeback-exclusive 1 19222 0 0 /news/greenwich230218 2 28431 0 0 /news/beckenhamtown4erithtown0 2 16876 0 0 /news/wp-includes/xleet-shell.php 1 0 0 0 /news/hernebay011017 2 26570 0 0 /news/dulwichhamlet3-1hendon-theresnolimithowgoodtheycanbecomesaysgavinrose 1 24874 0 0 /news/wearelookingforasmanydartfordfansaspossibletogetofftoagoodstartsayskeithmcmahon 1 13456 0 0 /news/3rdjuly03.html 1 0 0 0 /news/551bc5e151028 1 15717 0 0 /news/kentleague/whitstable/3rdoct04.html 1 0 0 0 /news/ebbsfleet071118 1 11647 0 0 /news/maidstoneunited0-0croydonathleticwedidntperformtonightadmitstabletoppinghume 1 18333 0 0 /news/faversham110619 2 24492 0 0 /news/dannywardwevegotthebestadultplayersinthanet 2 18330 0 0 /news/sittingbourne3-2chipstead-abbottsetshat-trickherobrady20-goaltarget 1 17567 0 0 /news/drmartens/eastern/dartford/26thjune03.html 1 0 0 0 /news/defendersdavisandclearyreturntostones 1 14207 0 0 /news/20thmar05.html 1 0 0 0 /news/erithtown3-5woodstocksports-icouldnothaveaskedforanymoresaysscottappleton 1 26675 0 0 /news/martinweneedtomarchintothoseplay-offs-exclusiveinterviews 1 14910 0 0 /news/imenjoyingmyfootballatfavershamtownsaysstrikeradrianstone 1 12309 0 0 /news/hodgsonshownthedoor 1 11591 0 0 /news/hullcitysnapupfolkestoneinvictastrikerjohanterhorst 1 17305 0 0 /news/facupfirstrounddrawwellingunitedhandedhometieagainstlutontown 1 16472 0 0 /news/ianvarley191117 1 12634 0 0 /news/551a95b39bbdc 3 36637 0 0 /news/thamesmeadconfidentofcausingupset-brickieswithouttopscorer-exclusiveinterviews 1 16028 0 0 /news/myplayerscouldwalkintoanyotherkentleagueteamsaysfisherbossstevefirkins 1 14101 0 0 /news/itsimportantwetryandkeepourrungoingsaysfolkestoneinvictabossneilcugley 1 15376 0 0 /news/551a97988ebdd 2 19881 0 0 /news/thebigkickoffbournelooksaheadtoopeningdaygrudgematch-exclusive 1 15565 0 0 /news/folkestonestagescharitymatchfortwokenthospices 1 11609 0 0 /news/551bc5e2bd220 1 11320 0 0 /news/dulwich180617 2 25155 0 0 /news/keithmcmahonbringsryanbriggstobaylissavenue 1 13606 0 0 /news/brentwoodtown1-1thamesmeadtown-wecameheretomakeushardtobeatsaysmeadbossmcmahon 1 21262 0 0 /news/doverathletic1-2borehamwood-wecangoaverylongwaysayshessenthaler 1 19519 0 0 /archive-2006-2014/64 1 20725 0 0 /news/drmartens/eastern/sittingbourne/maldon301004.html 1 0 0 0 /news/burytown111204.html 1 0 0 0 /news/ilford291005.html 1 0 0 0 /news/551a9250e78aa 2 27963 0 0 /news/sevenoakstown1-1maidstoneunited-ivegotreallyhighhopesforusthisyearsaysmickycollins 1 29000 0 0 /news/havantvbromfayc020903.html 1 0 0 0 /news/burmanwantstoclaimbraggingrightsoverarch-rivals 1 15377 0 0 /news/551a95b453342 2 20224 0 0 /news/iamconfidentwecanchallengetoachievetheclubspromotiongoalsaysbearsbosstonycornwell 1 12197 0 0 /news/stonesgivenclearancetocontinueathomelandsstadium 1 17054 0 0 /news/paulfoley230617 2 29249 0 0 /news/crowborough170617 1 11704 0 0 /news/deal100818 1 11766 0 0 /news/sevenoaksbidtoendtheirtunbridgewellsjinx 1 15411 0 0 /news/iwanttobeinvolvedwithaseriousambitiousclubsayschristuley 1 12268 0 0 /news/eastgrinsteadtown051121 2 24806 0 0 /news/sevenacresidcup2-1tudorsports-wevedoneeverythingwewantedtodosaysdannyfrost 1 28700 0 0 /news/barnbrom081019 2 41102 0 0 /news/wehavethemakingsofanexcellentteamadmitslillis 1 11142 0 0 /news/fisher2-2craywanderers4-3pens-thedifferencewasthefisherkeepersaysjenkins 1 29700 0 0 /news/ebbsfleet140820 1 13473 0 0 /news/thebigkickoffwhitstabledepletedfortheirspecialday-exclusive 1 15000 0 0 /news/kentleague/deal/15thaug03.html 1 0 0 0 /news/wellstickinthereandwellkeepgoingrighttothedeathsayslewwatts 1 13567 0 0 /news/551bc5dd4a45f 2 17916 0 0 /news/crowborough290616 1 11727 0 0 /news/551bc5e5488ea 2 20787 0 0 /news/crowborough150416 1 11676 0 0 /news/twellserithb060216 1 33240 0 0 /news/551bc5e86ea8c 1 13736 0 0 /news/551a967774333 3 30992 0 0 /news/dulwichwaldren080615 3 30218 0 0 /news/soccershortscrayvalleystrikerchrismcgintytrainswithenglandsquad 1 44539 0 0 /news/ryman/bromley/bromvmole230803.html 1 0 0 0 /news/folkestoneinvicta0-3ramsgate 1 18576 0 0 /news/plentyofkentishderbiestolookforwardto 1 17553 0 0 /news/bromley110518 2 16706 0 0 /news/wejustwantedtofollowupsaturdaysperformanceandwinsaysfrustratedrayturner 1 16972 0 0 /news/chathamtown1-3corinthian-casuals-welackedsomeleadershipadmitsfrustratedobrien 1 25719 0 0 /news/ashfordmiddlesexwasalwaysatoughplacetogosaysstonesbossjaysaunders 1 12035 0 0 /news/resurgentclubstrivesfornew25-yearlease-exclusiveinterviews 2 27165 0 0 /news/metrogas180321 3 34571 0 0 /news/dartford210122 5 53239 0 0 /news/551bc99dbe7a4/drmartens/eastern/ashford/ryman/bromley/20thdec03.html 2 15653 0 0 /news/resignationsatkentleaguegreenwichborough-garlandappointedcaretakermanager 2 20177 0 0 /news/larkfield300721 4 48798 0 0 /news/punjab290318 1 13971 0 0 /news/NationalLeagueclubstatement200221 2 20154 0 0 /news/rochester080718 1 12908 0 0 /news/tonbridge270716 2 26350 0 0 /news/burmanputsdovershowdowntothebackofhismind 1 13821 0 0 /news/faversham290916 2 28500 0 0 /news/hillingdon231004.html 2 0 0 0 /news/4thjuly05.html 1 0 0 0 /archive-2006-2014/60 1 20975 0 0 /news/othernews/3rdaug04.html 2 0 0 0 /news/hessenthalerplansshake-upatchampions-electdoverathletic 1 12775 0 0 /news/borehamwood121105.html 1 0 0 0 /news/tapletoppingangelsdefybookiesodds-exclusiveinterviews 1 19260 0 0 /news/crockenhill050715 2 20996 0 0 /news/releasingpairwasadifficultdecisionihadtomakeadmitsburman 1 16020 0 0 /news/551a9678d7cc0 3 44848 0 0 /news/11thmar05.html 1 0 0 0 /news/551bc5dd15c54 1 15120 0 0 /news/deal030905.html 1 0 0 0 /news/551a931dbca95 1 13250 0 0 /news/wellhavetobeatourbestsaystunbridgewellsbossmartinlarkin 1 14051 0 0 /news/551bc5de40b76 1 15191 0 0 /drmartens/eastern/ashford/ramsgate101205.html 1 9955 0 0 /news/icantmakeanychangesadmitsfrustratedlovell-exclusive 1 15773 0 0 /news/edinanna031221 1 17698 0 0 /news/greentoot061216 2 59795 0 0 /news/bromvwhyt280204.html 1 0 0 0 /news/ashfordtown3-3sittingbourne 1 15477 0 0 /news/mcdonaldscoresonhisdreamdebut 1 12808 0 0 /news/werestillnotplayingtoourfullpotentialsayssevenacresidcupassistantmartinreece 1 12360 0 0 /news/wevegotthebestpairofcentrebacksinourleaguesaysfolkestoneinvictabossneilcugley 1 12993 0 0 /news/erith147sp270316 1 12101 0 0 /news/551bc99dbe7a4/kentcounty/ryman/24thjune03.html 2 15653 0 0 /archive-2006-2014/121 1 19741 0 0 /news/551a96dbb2a79 2 15548 0 0 /news/drydensignsnewcontracttostayatcrabble 1 11925 0 0 /news/itsamatterofpickingupthepointsoverchristmassaysdartfordbosstonyburman 1 20139 0 0 /news/soccershorts150116 2 52069 0 0 /news/tonbridgeangels1-0craywanderers-angelsbossdedicatescupfinalwintomaddams-exclusive 1 15809 0 0 /news/burmanvowstoenddartfordswildernessyears-exclusive 1 15649 0 0 /news/551a9c9190d61 2 18700 0 0 /news/folkestone161016 2 30147 0 0 /news/whitstabletown0-3chipstead-peoplehavegottohavefireintheirbellies-lane 1 17741 0 0 /news/dartschairmanrelisheshomecoming-exclusiveinterview 2 19604 0 0 /news/wevegottopolishuponourdefending-yorath 1 16451 0 0 /news/ebelyaxl180115 1 29723 0 0 /news/wewillnotfinishbottominsistslordswoodsjohnguest 1 16557 0 0 /news/crayhors090319 3 66137 0 0 /news/kentcounty/17thdec03.html 2 0 0 0 /news/craywands270418 3 34638 0 0 /news/NationalLeague140420 2 14010 0 0 /archive-2006-2014/192 1 19216 0 0 /news/beckenham020815 1 15854 0 0 /news/4thmay05.html 1 0 0 0 /news/crayvhyth260404.html 1 0 0 0 /news/drmartens/premier/welling/13thaug04.html 1 0 0 0 /news/whitstable01101 1 15022 0 0 /news/hythetown220218 2 27981 0 0 /news/holdersheroicssavesborough 1 15238 0 0 /news/kentleague/sevenoaks/3rddec04.html 1 0 0 0 /news/favershamtown130523 1 14664 0 0 /news/erithtown101023 2 23820 0 0 /national-league/35 2 23945 0 0 /news/margatevfarnborough250803.html 1 0 0 0 /news/tunbridgewells050821 1 12743 0 0 /news/welldoourlevelbesttoknockholdersoutsayslovell 1 13553 0 0 /news/barnet170320 2 18125 0 0 /news/fordsoptionslimitedduetoopeningdayinjuries 1 18032 0 0 /southern-counties-east-football-league/29 1 21197 0 0 /news/wingatefinchleyhavefivesentofftoabandonkickitoutmatchagainstthurrock 1 12873 0 0 /news/tunbridgewells040619 1 13166 0 0 /news/551bc5e0e65cd 1 13474 0 0 /news/551bc99d3d898 2 19136 0 0 /news/croydon240921 1 12989 0 0 /news/margatelaunchyouthacademy 1 12962 0 0 /news/551a931da0a2b 1 12634 0 0 /news/rymanleagueannounceprizemoneyawards 2 16491 1 0 /news/millwall031019 2 25359 0 0 /news/kentleague/sladegreen/abingdon231004.html 2 0 0 0 /news/gravesendnorthfleet1accringtonstanley3 2 22568 0 0 /news/11thapr05.html 1 0 0 0 /news/lewishamborough3-2meridianvp-thereisalotofworktobedonesaysdarrellqueeley 1 30635 0 0 /news/vcdappointnewchairmanandissuebondstoaidgroundredevelopment 1 13089 0 0 /news/drmartens/eastern/sittingbourne/tootingvsittfat041003.html 1 0 0 0 /news/drmartens/eastern/ashford/2ndsept04.html 1 0 0 0 /news/conference/margate/margatevfarnborough250803.html 1 0 0 0 /news/wehavetocarryonwhereweleftoff-abbott 1 20247 0 0 /news/hythe200915 3 29145 0 0 /news/brentfordsignleggeforundiclosedfee 1 14845 0 0 /drmartens/premier/welling/6thjan05.html 2 12477 0 0 /news/woking3-0dartford-thepressureisonmeadmitsdartfordbosstonyburman 1 26653 0 0 /news/551a9c0f0bd54 4 34874 1 1 /news/glebe210917 1 12262 0 0 /news/hythetown170919 2 24538 0 0 /news/8thjuly05.html 1 0 0 0 /news/551a9c92b2d26 2 24022 0 0 /news/tunbridgewells300819 1 12748 0 0 /news/mymainaimistohelpmeridianbecomeabetterclubfromtoptobottomsaysliamkelly 1 15163 0 0 /news/ashfordtown0-4worthing-lovellultimatumplayformeorgetout 1 21962 0 0 /news/kentleague/beckenham/whitstable301004.html 1 0 0 0 /news/whitstabletown4-1wembley-lambwevegottobuildonthefoundationslaidbyseagerhalsey 1 24905 0 0 /news/dealtown010219 1 12002 0 0 /southern-counties-east-football-league/7 2 40873 0 0 /news/soccershortsfisherunveilmarcbirchamtransfercoup 1 20105 0 0 /news/farnobg210616 1 15939 0 0 /news/crayvcorin230316 1 32910 0 0 /news/burmanidontwantmercanariesatdartford-exclusiveinterview 1 20964 0 0 /news/fleetpresentsummerschoolspectaculars 1 11916 0 0 /news/9thfeb04.html 1 0 0 0 /news/551bc5e00f0fc 2 17050 0 0 /news/theclubisinsafehandsinsistsangelschairmansullivan 1 15029 0 0 /news/4thsept03.html 1 0 0 0 /news/newstofollowherelater-1 1 9743 0 0 /cray-2003-2006/www.heineken.co.uk/ 1 3208 0 0 /news/kentfootballunited070521 1 11168 0 0 /archive-2006-2014/280 2 23771 0 0 /news/17thoct04.html 1 0 0 0 /news/promotionisabigdealforstones 1 13849 0 0 /news/19thaug03.html 1 0 0 0 /news/taxmanclampsdownonkentleagueclubs 1 13909 0 0 /news/gravesham090718 1 11361 0 0 /news/areyoustillsearchingforanewclub 1 13007 0 0 /news/eastbourneborough090921 1 12267 0 0 /news/dealtown270519 1 15238 0 0 /news/dorkbrom141219 1 25463 0 0 /news/isthmianleaguestatement301220 2 22653 0 0 /news/MolevBrom010104.html 1 0 0 0 /news/8thmay05.html 1 0 0 0 /news/ifwedontperformthenwellgetbeatwarnswellingunitedbossjamieday 1 20019 0 0 /news/uxbridge030105.html 1 0 0 0 /news/hallsathletic101120 1 11520 0 0 /news/iminchargeofthewholelottfornowsayscumberbatch-exclusiveinterview 1 13823 0 0 /news/7thsept04.html 1 0 0 0 /news/wearekeentogrowourstudentfan-basesaysdulwichhamletchairmanjackpayne 1 15222 0 0 /news/crockenhill110617 2 18800 0 0 /news/staplehurst260520 1 12459 0 0 /news/jamal.php 1 0 0 0 /news/atthemomentwearefindingwaysofgettingbeatsaysvcdbosstonyrussell 2 19097 0 0 /news/corinthianbosstonysitfordboostedwithreturnofstrikepairing 1 16281 0 0 /news/glebe290518 1 14069 0 0 /news/maidstoneunitedareupforsale 1 13401 0 0 /news/letshopewecangotowellingandcauseamassiveupsetsaysthamesmeadtownbosskeithmcmahon 1 16971 0 0 /news/wejustwanttheshowontheroadsaysward 1 15548 0 0 /news/wp-admin/css/colors/coffee/xmrlpc.php 1 0 0 0 /news/551a967852f31 2 17296 0 0 /news/KSTFinalPreview160404.html 1 0 0 0 /news/mysidecanhandlethepressureinsistsdouble-chasingmcmahon-exclusive 1 14956 0 0 /news/kentleague/tunbridgewells/tunverith111003.html 2 0 0 0 /news/lewisham290615 1 11161 0 0 /news/wp-content/xl2023.php 1 0 0 0 /news/itssuchabonustotheteamwhenthefansgetcrabblerockingsaysdoverskipperiansimpemba 1 14342 0 0 /news/rusthall230916 1 12561 0 0 /news/wellingtown241118 1 14172 0 0 /news/conference/gravesend/11thaug04.html 1 0 0 0 /news/gravesend010205.html 1 0 0 0 /news/imnotgoingtothrowthetowelininsistsfisherbossbillywalton 1 14433 0 0 /news/stoneshaveyearsonyouthfulopeningdayopponents 1 13775 0 0 /news/images/xmrlpc.php 1 0 0 0 /news/551bc5df4372b 1 15213 0 0 /news/folkestoneinvicta4-1whitstabletown-werenotgoodenoughadmitsafuriouspeternott 1 24532 0 0 /news/ramsgatebosswardcatchusifyoucan 1 16539 0 0 /news/folkhors291022 2 63611 0 0 /news/greenwich010916 2 26173 0 0 /news/greenwichboroughbossstevefirkinsislookingforwardtohisfacupdebut 1 20246 0 0 /news/ebbsfleetunited1-0weymouth-barretthomesintowardswembley 1 18210 0 0 /news/wellingtown270919 1 13321 0 0 /news/kentleague/sladegreen/reading280804A.html 1 0 0 0 /news/kswillbeabigscalpifwecollectthreepointssayswarrilow 1 16947 0 0 /news/551a99e55af71 1 16941 0 0 /news/dulwich160318 2 30753 0 0 /news/phoenixsports2-2blyspartans2-4pens-spot-onwatkinsmadeamendssayscarlrolls 1 30585 0 0 /news/551a99e51c7ce 1 16643 0 0 /news/sharman300515 2 17538 0 0 /news/18thnov03.html 2 0 0 0 /news/551bc99a63087 1 12299 0 0 /news/glebe010516 2 19153 1 1 /news/551a97b162892 1 15243 0 0 /news/doverathletic030820 1 11989 0 0 /news/erithbel050317 1 15630 0 0 /news/sportingbengalunited0-5erithbelvedere-newmanagementteamcelebratefirstwin 1 14064 0 0 /news/paulfoleypartscompanywithchathamtown 1 23783 0 0 /news/ryman/bromley/25thmar04.html 1 0 0 0 /news/facuppreviews 1 23506 0 0 /news/rymanleaguefixturesnowpublished 1 10433 0 0 /news/thamesmead120317 2 39884 0 0 /news/glebelt181116 1 36347 0 0 /news/soccershortsdaishforcedtooffloadallofhisnon-contractedplayers 1 18634 0 0 /news/beckrust231121 2 41790 0 0 /news/27thjan05.html 1 0 0 0 /news/soccershortsramsgatestarsreturntohonourloyalservantwarrenschulz 1 26913 0 0 /news/beckinghamsshockresignationhasrockedusadmitsthurgood 1 15563 0 0 /news/sevenoakstown4-4folkestoneinvicta-eight-goalepicgoodadvertforkentfootball-jones 1 23810 0 0 /news/trottunveilsretainedplayerslistfornextseason 1 11279 0 0 /news/kentleague/sladegreen/Hamble250904.html 1 0 0 0 /news/16thfeb05.html 1 0 0 0 /news/angelsdayofdestinywevegotthefinishinglineaheadofustommywarrilow 1 19590 0 0 /news/kentfootballunited310818 1 13009 0 0 /news/551a9bb004cc5 3 167257 0 0 /ryman-2003-2006 15 150588 1 1 /news/theplayershaveexceededmyexpectationssayscugley 1 15121 0 0 /news/551a96db75893 2 15825 0 0 /news/hydesigningisabigthingforussaysfisk-exclusive 1 13214 0 0 /news/sittfav120416 2 68505 0 0 /news/january2007fixtures 1 34450 0 0 /news/551a9678d364c 3 40639 0 0 /news/iexpectpromotionsaysburman 1 17234 0 0 /news/warrilowwemustkeepgoodhabits-exclusive 1 15807 0 0 /news/gravesendgoalkeeperselectedforengland 1 10984 0 0 /news/faversham130821 5 61485 0 0 /news/londonlions1-2fisher-ithoughtitwasagoodtestsaysfisherbossstevefirkins 1 21546 0 0 /news/walton180105.html 1 0 0 0 /news/5thjan05.html 1 0 0 0 /news/theweekahead-6 1 21316 0 0 /news/551bc5db58460 4 49124 0 0 /news/551a9cf598f9a 2 21883 0 0 /news/ihopeoursupporterscanallplaytheirpartsaysfavershamtownbossrayturner 2 18367 1 1 /news/551a96db77a94 2 16460 0 0 /news/whitstable150619 2 28273 0 0 /news/ourenforcedlay-offhascausedproblemsinmanyareassaysdoverathleticbossnickyforster 1 12612 0 0 /news/rymanleaguelineupvcdathleticthrownoutofrymanleague 1 25343 0 0 /news/flyingphoenixarerightlybeingtippedasthetitlefavourtiessaysmattlonghurst 1 15187 0 0 /news/sevenoaks111116 1 13544 0 0 /news/ihavebeenworkingover-timetoensurewehaveeverythinginplacesaysjustinluchford 1 15135 0 0 /news/glebe161017 1 11390 0 0 /news/letsdoourbittokeeptwokentclubsaliveandkicking 1 10897 0 0 /news/theclubisgoingintherightdirectionsayswoodstocksportsbossbentaylor 1 15873 0 0 /news/folkestoneinvicta040123 2 27873 0 0 /news/kingstonian4-1thamesmeadtown-yougetpunishedatthislevelsayskeithmcmahon 1 28389 0 0 /news/551a97b273c30 1 17167 0 0 /news/faversham210417 2 27903 0 0 /news/transferdeadlineday310120 2 35876 0 0 /news/drmartens/eastern/tonbridge/5thsept04.html 2 0 0 0 /news/cugleyletsdoourselvesjusticeandknockoutrams 1 12779 0 0 /archive-2006-2014/36 2 26179 0 0 /news/greenwich280716 2 30381 0 0 /news/551a9677cfe22 2 15567 0 0 /news/itsnodisrespecttothekentseniorcupbuttheleagueismoreimportantsayskeithmcmahon 1 14822 0 0 /news/craytunw271116 1 33217 0 0 /news/dealtown070116 1 12244 0 0 /news/crowborough040118 1 17406 0 0 /national-league/14 2 25183 0 0 /news/rivalmanagerscomplainaboutderbydraw-exclusiveinterviews 1 18796 0 0 /news/michaelthalassitistributes 2 27461 0 0 /news/551bc99b3c739 1 5081 0 0 /news/bromley081118 2 25046 0 0 /news/vcdhanw131018 2 61340 0 0 /news/fordnewgroundisgivingusafreshinjectionoflife 1 14029 0 0 /news/long-servingfordleavesvickers-exclusive 1 12248 0 0 /news/kentleague/cray/croydon210804.html 1 0 0 0 /news/margate2-0suttonunited-weknowwhatwevegottodosaysyorath 1 18161 0 0 /news/mayorbacksboroughspromotionbid 1 14756 0 0 /news/itsnicetobeunderdogsittakesabitofpressureofftheboyssaysjaysaunders 1 16394 0 0 /news/551bc5dd2523e 1 14978 0 0 /news/ryman/bromley/corivbrom200903.html 1 0 0 0 /news/551a99e4f1045 1 18686 0 0 /news/obrienisournewborn-leadersaysburman 1 12188 0 0 /news/folkestoneinvicta010521 3 28643 0 0 /news/hythetown110522 2 25159 0 0 /news/551a931ea557b 2 38570 0 0 /news/boroughsackmanagerialpair-exclusive 1 11287 0 0 /news/afccroy290116 1 12847 0 0 /news/kentleague/beckenham/27thaug03a.html 1 0 0 0 /news/drmartens/eastern/sittingbourne/hastvsitt201203.html 1 0 0 0 /news/cugleyreadytodelveintosummertransfermarket 1 13375 0 0 /news/wemaystruggletofillthebenchwarnsfleetchairman 1 11910 0 0 /news/conference/margate/12thaug04.html 1 0 0 0 /news/551bc99dbe7a4/drmartens/premier/dover/kentleague/sladegreen/didcotvsladefac060903.html 2 15653 0 0 /news/ourhomeformdrivesmemadadmitsdoverathleticbossmartinhayes 1 15556 0 0 /news/tonbridgeangels0-0bromley-myplayersgavemeheartdesireanddeterminationsaysstevemckimm 1 29872 0 0 /news/jonesexpectsbumpercrowdfordulwichhamletvisit 1 14825 0 0 /news/itsremarkablethatwevebeensotightatthebackduringinjurycrisissayshessenthaler 1 19357 0 0 /news/soccershortsdoverathleticchairmanpaysforfansdayout 1 22229 0 0 /news/lordswood270217 1 14659 0 0 /news/wevegottwomassivegamescomingupnowsaysmaidstoneunitedbossjaysaunders 1 13964 0 0 /news/lovellbringsleaderflanagantohomelands 1 14530 0 0 /news/crayvalley201017 1 12800 0 0 /news/551bc5e8610f6 1 10923 0 0 /news/551bc5e13f2d5 1 17514 0 0 /news/imlookingforwardtohelpingcrayvalleytocontinuetopushintherightdirectionsaysjoeford 1 21466 0 0 /news/hollands250816 1 13943 0 0 /news/threepointsoverwhitstablewillkeepusintheplay-offpacksaysgaryabbott 1 18011 0 0 /news/551bc5de2098e 1 10975 0 0 /news/glebe101221 1 12626 0 0 /news/theresnoreasonwhywecantremainunbeatensaysabbott 1 13094 0 0 /news/kentseniorcupfristrounddraw 1 10408 0 0 /news/sevenoakslouiscollins240715 1 12004 0 0 /news/favershamtown0-0whyteleafe-iwouldhavetakenapointbeforehandadmitsrayturner 1 14988 0 0 /news/551a96dc907df 2 19421 0 0 /news/tunwhigh240115 1 28818 0 0 /news/551bc5deb4609 2 16453 0 0 /news/bromleystrikersignsfornottinghamforest 1 10978 0 0 /news/glebpunj130821 4 152302 0 0 /news/whitstabletown0-1dulwichhamlet-rivalbossrosesaidsorrytomerevealedcaretakernolan 1 22684 0 0 /news/soccershorts120517 2 41523 0 0 /news/givemechancesandiwillscoreinsistspinnock 1 13748 0 0 /news/matatareturnsforvisittohigh-flyingswifts 1 14135 0 0 /news/maidvslade251003.html 1 0 0 0 /news/551bc5e684f12 1 11878 0 0 /news/conference/gravesend/14thjuly04.html 1 0 0 0 /drmartens/eastern/folkestone/1stjan06.html 1 9955 0 0 /news/whenyouthinkyouvearriveditkicksyouupthebacksidesaysdartfordbosstonyburman 1 13738 0 0 /news/wemustnotletourhighstandardsslipsayswarrilow-exclusive 1 16003 0 0 /news/551a97b286c15 1 17062 0 0 /news/sheppeyunited060721 1 15370 0 0 /news/wehaventwonanythingyetadmitswhitstablechairman 1 14071 0 0 /news/wejustwanttokeepourwinningrungoingsaysalexobrien 1 23851 0 0 /news/dartscriticiseeaglesoverteam-sheetfarce 1 13381 0 0 /news/margate2-2dartford-kentsidesdrawlittlecomfortwithapointapiece 1 21627 0 0 /news/iwanttoavoidsemi-finalheartbreakagainsaysfisk-exclusiveinterview 1 16459 0 0 /news/robswaineretirement110122 2 16312 0 0 /news/ifeelihavealottoofferchipsteadsaysurbanrapartistmrrootsy 1 19530 0 0 /news/whyhaventcasualsbeenrelegatedaskesupsetdartsfan-exclusive 1 12440 0 0 /news/eastvsitt170404.html 1 0 0 0 /news/551bc5e1b9022 1 16284 0 0 /news/elmslord190716 1 28908 0 0 /news/551bc5e452fa0 1 10950 0 0 /news/wejustgetblownoutofthewatersaysvcdathleticbosstonyrussell 1 16004 0 0 /news/doverathleticclosinginontransfertargets 1 13522 0 0 /news/werestickingtogetherandfinishingoffthejobthattonyrussellstartedsaysjamescollins 1 16355 0 0 /news/551a9677cd394 2 15159 0 0 /news/dorking280805.html 1 0 0 0 /news/kentleague/beckenham/30thjune03.html 1 0 0 0 /news/crayvalleygrabkentleagueplaceassportingbengalmovetoessexleague 1 13840 0 0 /news/21stapr05.html 1 0 0 0 /news/maidstoneunited2-0walthamabbey-relegationwouldbeadisasterinsistsnott 1 33517 0 0 /archive-2006-2014/244 1 19112 0 0 /news/yoarthtargetsthreenewplayers 1 14993 0 0 /news/phoenix271017 2 30609 0 0 /news/werenotgoingtomakethenumbersupinsistslangton 1 17931 0 0 /news/551bc99be3e45 2 23390 0 0 /news/ibelievewearebuildingsomethingspecialatlewishamsayschairmanraysimpson 1 17217 0 0 /news/championsdoverathleticwinpromotionandchairmanvowswereonourwayback 1 13391 0 0 /news/imdelightedthatjakeandkurtishaveagreedtostayforthenewseasonsaysjamieday 1 13303 0 0 /news/althoughitwillbedifficultwearegoingtodoeverythingwecantomaketheplayoffs-bird 1 13214 0 0 /news/stevebrownextendshisstaywithebbsfleetunitedforanothertwoyears 1 14723 0 0 /news/margate250419 2 24687 0 0 /kent-invicta-league/19 2 24540 0 0 /news/wellingunited280921 1 12029 0 0 /news/scallyplaysdowngillsembargo 1 11504 0 0 /news/worthingunited230815 1 13907 0 0 /news/551a97b1552cb 1 19204 0 0 /national-league/4 5 50454 1 0 /news/ashford230517 3 31300 0 0 /news/ifweplaythewaywecandothenwerepositivewecangetaresultsaysjackparkinson 1 17723 0 0 /news/edgwaretownconfirmtheirsaddemise 1 11331 0 0 /news/ramscray271121 5 160410 0 0 /news/551bc5e4b2525 1 10466 0 0 /news/chatfav160117 3 72171 0 0 /news/551bc99dbe7a4/kentleague/hernebay/kentleague/4thnov03.html 2 15653 0 0 /news/551bc5dc40f85 5 46943 2 2 /news/wrexham3-2ebbsfleetunited-daishruessloppydefending 1 16355 0 0 /news/wevegottostringacoupleofresultstogethersaysmcmahon 1 12894 0 0 /news/wingssignpairintimefortrophytie 1 11688 0 0 /news/dartschairmanlooksforwardtobumperpayday 1 15116 0 0 /news/crayvpaghamfac310803.html 1 0 0 0 /archive-2006-2014/206 1 20143 0 0 /kent-invicta-league/26 2 23932 0 0 /news/rivalsstrengthenaheadofbasementbattle-exclusive 1 17369 0 0 /news/17thjuly05.html 1 0 0 0 /news/weneedtogetbacktowinningwayssaysthamesmeadtownbosskeithmcmahon 1 16983 0 0 /news/greenwichboroughbattleagainstalltheoddstotopkentleaguetablewithjust35inthebank 1 23221 0 0 /news/551a9677ee7b0 2 17152 0 0 /news/chelmsford200805.html 1 0 0 0 /news/scefldeclinetocommentonthefutureofthreeofitsmemberclubs 1 15041 0 0 /news/crayhillman150515 3 34216 0 0 /news/chathamtown0-2dulwichhamlet-theplayersarentgivingtheirbestsayswatts 1 21502 0 0 /news/vcdathletic051121 2 25384 0 0 /news/vcdphoe291219 12 200895 9 9 /news/glebstan061023 2 51019 0 1 /news/eandblonghurst160515 1 13707 0 0 /news/drmartens/eastern/sittingbourne/19thaug03.html 1 0 0 0 /news/sevenoakstown1-3whitstabletown-seagersmenpilepressureonvickers 1 19056 0 0 /news/maidstoneunited1-0sittingbourne-whenthelightswentoutithoughtherewegoagain-saunders 1 17013 0 0 /news/551bc99dbe7a4/conference/gravesend/ryman/bromley/5thdec03.html 2 15653 0 0 /news/wp-content/database.php 1 0 0 0 /news/551a96dc7350e 4 60004 0 0 /news/sheppey080419 1 14801 0 0 /news/folkestoneinvicta171123 5 58189 0 0 /news/27thjune04.html 1 0 0 0 /news/croydonathletic1-0folkestoneinvicta-isupposetheresafearoflosingmyjobsayscugley 1 30409 0 0 /news/soccershortswehavetobeatourverybesttostunebbsfleetinfacupsayshythebosstimdixon 1 48473 0 0 /news/sittingbourne1-1ashfordtown-debollasigningisourbestoneyetsaysabbott 1 20698 0 0 /news/wellcori120220 1 39697 0 0 /news/551a99e50bfbd 1 15835 0 0 /news/551bc5e79011f 2 18357 0 1 /news/crowbfarn060816 1 29870 0 0 /news/sevenoaks310515 2 18506 0 0 /news/leatherhead0-1hythetown-thenewhytheisabetterhythesaysscottporter 1 27438 0 0 /news/idontthinkiwasgivenafairchancesaysformererithtownbossjamescollins 1 19707 0 0 /news/551bc99dbe7a4/conference/margate/kentleague/maidstone/maidvslade251003.html 2 15653 0 0 /news/keepingfolkestoneupthisseasonwillbemybestachivementtodatesaysneilcugley 1 12925 0 0 /news/charlton100620 3 28387 0 0 /national-league/40 2 22252 0 0 /southern-counties-east-football-league/8 2 40206 0 0 /news/551a95b3ae4f2 2 16778 0 0 /news/hollandsandblair031022 1 14627 0 0 /news/e&bvfolk010104.html 1 0 0 0 /news/barwell071115 2 36651 0 0 /news/551a95b386dcc 3 32249 0 0 /news/551a967890bca 3 44760 0 0 /news/developmentleague110522 2 14104 0 0 /news/canterburycity060219 1 13031 0 0 /news/drmartens/eastern/erith&belvedere/chatham300804.html 1 0 0 0 /news/chathamtownbosskevinwatsonbringsinjonpilbeamfromtunbridgewells 1 13715 0 0 /news/myintentionistobringtheyouththroughsayssevenoakstownbosssimonjones 1 15891 0 0 /news/stonesshockwalkerhartenedwithinitialplayerresponsedespitecut-backs 1 13314 0 0 /news/551a9c91940b2 2 18710 0 0 /news/hernebay200320 2 33583 0 0 /news/chatham030520 1 11589 0 0 /news/ramsgate180817 2 24858 0 0 /news/fisher040720 1 11011 0 0 /news/dropdown.php 1 0 0 0 /news/551bc99bc7163 2 24639 0 0 /news/theroadtowembleythreekentsidesleftinthefinalqualifyinground 1 12594 0 0 /news/21stmar05.html 1 0 0 0 /news/myplayersowemeawinningperformance-abbott 1 14803 0 0 /news/samdenlycallstimeonhiswhitstabletowncareer 1 13302 0 0 /news/13thaug04.html 1 0 0 0 /news/kfu040718 1 12866 0 0 /news/sindensignsforkentleaguersvcdathletic 1 15985 0 0 /news/bromley1harrowborough1 2 18645 0 0 /news/LondonFAStatement171220 1 14558 0 0 /news/beinginthefatrophylasteightisagreatachievementsaysdartfordbosstonyburman 1 16408 0 0 /news/soccershortswehaventreallybeenatourbestadmitstable-toppingvickersbossrickybennett 1 74076 0 0 /news/burmanwantsaperfectchristmas-exclusive 1 16474 0 0 /news/aldershottown190320 2 15634 0 0 /news/crayvalley070716 1 11732 0 0 /news/resultsnov2015 3 130557 0 0 /news/greenwichboroughgivenanewleaseoflife-exclusive 1 16022 0 0 /news/ithasbeenahardyearbutwellputitrightin2013intheleaguevowsmarkgoldberg 1 14505 0 0 /news/stonesbidfarewelltobourneparkaftereightyears 1 12487 0 0 /news/maldontiptree2-2thamesmeadtown-whenwereupagainstitwecomeoutfightingsaysmcmahon 1 37291 0 0 /news/drmartens/eastern/tonbridge/22ndsept04.html 1 0 0 0 /news/stevenscontrolexpectedtobefinalisedinsix-weeks 1 11261 0 0 /news/werehavingtocatchupadmitsconcernedcanterburycitybossadegower 1 15692 0 0 /news/16thaug03.html 1 0 0 0 /news/drmartens/eastern/dartford/20thsept04.html 1 0 0 0 /news/folkestoneraisesecondshareissuetohelpachieveconferencestatus 2 15971 0 0 /news/dartford2-2wealdstone-peoplewererunningallovertheplacelikeheadlesschickens-burman 1 21267 0 0 /news/fishgleb021119 1 36245 0 0 /news/fishermillwall260117 2 23080 0 0 /news/conferenceapprovetheuseof3gpitchesfrom2015 2 15892 0 0 /news/551bc5e1cbaf2 2 19252 0 0 /news/551a96db79ff8 2 16356 0 0 /news/cumberbatchweknowwhatourproblemsare-exclusiveinterview 1 14309 0 0 /news/spiceoptsformovetokentrivals 1 16247 0 0 /news/canterburycitychairmanplotspromotionintokentleague 1 13325 0 0 /news/551a979830791 2 18963 0 0 /archive-2006-2014/193 1 19175 0 0 /news/cray130805.html 1 0 0 0 /news/maidstoneunited4-1ramsgate-ijustthinkwellgetbettersaysstonesbossjaysaunders 1 19361 0 0 /news/3rdaug03.html 1 0 0 0 /news/551bc99dbe7a4/nationwide/gillingham/drmartens/eastern/erith&belvedere/27thnov03.html 2 15653 0 0 /news/551bc5dea96a5 1 11154 0 0 /news/whitstabletownfacefinancialsetbackasthievesstrikethebelmont 1 16107 0 0 /news/chatham260305.html 1 0 0 0 /news/foleymovesswiftlytosnapupkeeperbradshaw 1 13707 0 0 /news/551a9797d7f16 2 24043 0 0 /news/fisher230922 1 13076 0 0 /news/sladevlord170104.html 1 0 0 0 /news/gillingham4-4aldershottown 1 16732 0 0 /news/kentleague/beckenham/hernebay231004.html 1 0 0 0 /news/milesfrustratedasstonespriseawayhisbestplayer-exclusive 1 16994 0 0 /news/itsreallyhardtokeepabovewatersaysboroboss 1 20348 0 0 /news/milesruesbadluckwithcupdraws-exclusiveinterview 1 18187 0 0 /news/kentleague/cray/20thjuly03.html 1 0 0 0 /news/onemorewinwillmaintainourstatuspredictscugley 1 15166 0 0 /news/551bc5e59acf1 1 14359 0 0 /news/becktunb200319 1 30202 0 0 /news/soccershorts210721 2 34841 0 0 /news/weregeareduptomeetourexpectationsinsistswarrilow 1 17226 0 0 /news/lordswood1-2erithbelvedere-refcartergetshisknickersinatwist 1 14809 0 0 /news/resultsaprilmay2013 1 61743 0 0 /news/hernebay071018 2 33098 0 0 /news/horleytown1-3greenwichborough-wewillgetstrongerastheseasongoesonsayspaulblade 2 61365 0 1 /news/kentleague/sladegreen/sladevrams200304.html 1 0 0 0 /news/ksports200821 4 52378 0 0 /news/kentleague/deal/Sampson18.html 1 0 0 0 /news/elmslewi110919 1 31200 0 0 /news/humewaryofangelscostlyfirepower 1 19565 0 0 /news/551a931e38fb2 1 11316 0 0 /news/wardtargetsthreeorfournewplayersfornextseason 1 13283 0 0 /news/kentleague/thamesmead/10thdec04.html 1 0 0 0 /news/croydon240918 1 10548 0 0 /news/wellgotherewiththerightattitudeandworkoursocksoffsaystommywarrilow 1 14045 0 0 /news/wehavetobementallyrightforhorshamymcasaysjustinluchford 1 16507 0 0 /news/7thjune05A.html 1 0 0 0 /news/551a96788acc7 3 51104 0 0 /news/notmanypeopleexpectedustobewherewearesaysmcmahon 1 18445 0 0 /news/wemustknuckledownforfavasetieathernebaysaysproudporter 1 16712 0 0 /news/favershamsshowdownwithsheernessputbacktwodays 2 17696 0 0 /news/carpenterverballyagreestore-signforwings-exclusive 1 11339 0 0 /news/551bc99dbe7a4/nationwide/gillingham/conference/margate/margatevfarnborough250803.html 2 15653 0 0 /news/hythtilb150717 2 49664 0 0 /news/chathamtown2-1whyteleafe-jacksdoublesnapssixgamelosingstreak 1 19311 0 0 /news/551a979b0f766 1 5174 0 0 /news/weneedtoshowabitmoreenthusiasmandabitmoreenergysaysbromleycoachneilsmith 1 15777 0 0 /news/erithtown021015 1 14027 0 0 /news/chatavel030115 2 57187 0 0 /news/scoringisabigproblemforusadmitslewishamboroughbossdarrellqueeley 1 13154 0 0 /news/wedidntfeardoveradmitsformerstrikersmissen-exclusive 1 14121 0 0 /news/iwanttobethemanthatbringsglorytohernebaysayssimonhalsey 1 14527 0 0 /news/beckenham020420 1 16694 0 0 /fisher-2003-2006/www.heineken.co.uk/ 1 3154 0 0 /news/lordswood010219 1 13460 0 0 /news/551a9718d4996 3 28081 0 0 /news/dulwichhamlet1-2craywanderers-dolbymaintainswandspushforthetitle 1 15775 0 0 /news/wemustconcentrateongettingawinandkeepourfingerscrossedthathastingslose-saunders 1 14990 0 0 /news/windsor050804.html 1 0 0 0 /news/551a95b437fc8 2 23525 0 0 /news/rymanleaguecupdrawholdersramsgatehandedsecondderbydraw 1 13094 0 0 /news/werekeepingacertainlevelofperformanceeveryweeksaysdulwichhamletbossgavinrose 1 14301 0 0 /news/waltonhersham3-0ashfordtown-markmywordswewillgetitrightinsistslangton 1 29988 0 0 /news/551bc99dbe7a4/kentleague/hernebay/conference/margate/25thjuly03.html 2 15653 0 0 /news/foleyiamhappiertobeinrymanonenorth 1 23014 0 0 /news/bearsted301023 2 26560 0 0 /news/sevenoaks130818 2 31385 0 0 /news/ifeelthatihavegivenitagoodshotsaysex-bearstedbosstonycornwell 2 17958 0 0 /news/isthmianleague150619 3 28531 0 0 /news/551bc99dbe7a4/kentleague/cray/kentleague/sevenoaks/21stjuly03.html 2 15653 0 0 /news/crayvsudb210204.html 1 0 0 0 /news/551a96dbd3bc5 2 17602 0 0 /news/gillinghamwomen281022 3 43651 0 0 /news/vcd160717 2 27280 0 0 /news/snodlandtown251118 9 40356 7 0 /news/maidstone130618 2 16500 0 0 /news/saturdaysreportsmarshallimhappyatwhitstable 1 34217 0 0 /news/wewillreturnbackhometomaidstoneinsistsbowden-brown 1 21980 0 0 /news/doverathleticunveilnathaneldersigning 1 12372 0 0 /news/soccershortslordswoodputinsurprisebidtolandmuch-travelleddimmock 1 46062 0 0 /news/stonessettounveilnewfaceaheadofvisittobromley 1 15141 0 0 /news/weareenteringacriticalstageinfishershistorysayssecretarydanyork 1 14978 0 0 /news/punjab111019 1 12274 0 0 /news/iwanttogetachairmantoputsomemoneyintotheclubsaysbeckenhamtownbossjasonhuntley 1 16869 0 0 /news/ramsgatewillbeatoughgamewarnsstonesbossjaysaunders 1 12485 0 0 /news/dartford1-0wellingunited-wellendeavourtocatchwellingsaysdartsbosstonyburman 1 17758 0 0 /news/youvegottogivecredittoeveryonebehindthescenesfortheireffortssaysluchford 1 15844 0 0 /news/ashfordplayersontrial-exclusive 1 15024 0 0 /news/cugleywewanttobemoreprofessional 1 17190 0 0 /cray-2003-2006/3 3 32165 0 0 /news/ourleaguewilloffermore18-21yearoldstheopportunitytoremaininthegamesaysjohndarcy 1 15088 0 0 /news/afewwinswilldoeveryoneaworldofgoodsaystonbridgeangelsbosstommywarrilow 1 14094 0 0 /news/551bc5e4844b3 1 10422 0 0 /news/18thsept03.html 1 0 0 0 /news/551a967845624 2 21703 0 0 /news/themagicwandsaregoingupwerereadyforthepremierinsistshillman 1 20844 0 0 /news/whitstabletown2-1sittingbourne-lanepraiseforrookiekeepershaunsmith 1 17937 0 0 /news/drmartens/eastern/chatham/ChatvSitt010104a.html 1 0 0 0 /news/folkestoneoncoursetocompletereserveteamdouble 1 16961 0 0 /news/bromley090520 2 14211 0 0 /news/hopefullywecandoourselvesjusticeatwokingsayswellingunitedplayer-managerjamieday 1 14608 0 0 /news/sutton161004.html 1 0 0 0 /news/551bc5e4324c2 1 2888 0 0 /news/beingafootballmanagerisallaboutresultsandthetabledoesntlie-formerstonesbossford 1 14654 0 0 /news/dulwtonb040915 2 24058 0 0 /news/dulwichhamlet1-1favershamtown-itwasimportanttocarryonourunbeatenrunsaysrayturner 1 24306 0 0 /news/551a97980c4a7 2 24097 0 0 /news/hythe270517 3 35823 0 0 /drmartens/eastern/folkestone/cray091104.html 1 9955 0 0 /news/bringinginthreenewplayersisamotivationaltoolforotherstoclimbthetablesaysmarklane 1 19092 0 0 /news/gillingham200615 1 21381 0 0 /news/kentfansraiseover14000forhughes 1 16769 0 0 /news/strikerlovellsettomakehiscomebackfrominjury 1 15485 0 0 /news/kentleague/tunbridgewells/31staug04A.html 1 0 0 0 /news/fisher1-1crayvalley-wedontwantteamstogettoofaraheadofussaysstevechapman 1 28947 0 0 /news/hytheheroesweregoinguptheretopulloffashockinsistsbossscottporter 1 17033 0 0 /news/folkestoneinvicta1-1hythetown-takingchanceshasbeenourproblemadmitsscottporter 1 31243 0 0 /news/551bc5e3d988b 1 17245 0 0 /news/31stjuly05A.html 2 0 0 0 /news/551a99e5076aa 1 17588 0 0 /news/rustwick120818 2 36349 1 1 /news/551a97b11f014 1 13591 0 0 /news/itsinourhandssayserithbelvederebossmickycollins 1 13483 0 0 /news/551a9c91caea1 2 18303 0 0 /news/vcdwalt230719 2 52658 0 0 /news/cablebrothersaimtobebrightsparksfortitlechasingwells 1 17392 0 0 /news/bridon210417 2 16215 0 0 /news/welling171116 1 11769 0 0 /news/sittingbourne291216 2 25287 0 0 /news/walesvengland-telluswhatyouthink 1 10038 0 0 /erith-belvedere-2003-2006/2 3 32440 0 0 /news/sportwell281218 1 32675 0 0 /news/551a97981e6b0 1 3433 0 0 /news/burgesshilltown3-2whitstabletown-seagerharpsonaboutpoordefending-exclusive 1 19067 0 0 /news/551a96dc50199 3 45183 0 0 /news/551a97b061dd0 2 32314 0 0 /news/551bc99dbe7a4/drmartens/eastern/tonbridge/ryman/bromley/27thoct03.html 2 15653 0 0 /news/551bc5ddd0ae8 2 24617 0 0 /news/551bc99b3ac2d 2 15599 0 0 /news/lordswood020818 1 12968 0 0 /news/maidstoneunitedbossjaysaunderssendsjackharrisandorlandosmithoutonloan 1 13473 0 0 /news/wevegottobewellpreparedfortheplay-offsaswecansaysproudbromleybossmarkgoldberg 1 14919 0 0 /news/isthmianleaguestatement171220 2 23659 0 0 /news/551a95b3bcc1a 2 16176 0 0 /news/25thapr05.html 2 0 0 0 /news/billericaytown2bromley1billericaywin4-3onaggregate 2 17144 0 0 /news/whitstablegunningforreserveteamglory 1 11857 0 0 /news/shorts270515 2 34213 0 0 /news/ebbsfleetunited2-1staffordrangers-daishpraisesenergyshownbyhisten-men 1 21601 0 0 /news/hernebay300323 2 28655 0 0 /news/tunbridgewells290721 1 12406 0 0 /news/fansgetguidedtourofprincespark 1 10690 0 0 /news/soccershorts260523 3 65410 0 0 /news/551bc99dbe7a4/kentleague/maidstone/conference/margate/11thjuly03.html 2 15653 0 0 /news/wehavetodigintoourpocketstokeeptheclubgoingsaysfirkins 1 18349 0 0 /news/tonbridgeangels150522 1 13054 0 0 /news/corinthian190821 3 35185 0 0 /news/wereundertheimpressiontakeoverdealisgettingsortedaroundthistimenowrevealsjamieday 1 19475 0 0 /news/tofinishintheplay-offswouldbeanunbelievableachievementsaysmcmahon 1 18061 0 0 /news/refereehatzidakisimadeamistaketosendoffnathanpaul 1 12696 0 0 /news/ebbsfleetunited020623 4 34622 1 0 /news/551bc99ae2f4c 2 15187 0 0 /news/551bc5e05c171 2 23476 0 0 /news/sladegreenpulloffmajortransfercoup 2 15107 0 0 /news/hernebay2-3vcdathletic-wehaventbecomeabadsidealloffasuddensayssimonhalsey 1 26096 0 0 /news/551a9c93339b8 3 45094 0 0 /news/wellingunited210920 3 21337 1 1 /news/cafcwomen140717 3 27245 0 0 /news/kentleague/thamesmead/18thnov03.html 1 0 0 0 /news/itsbeenarealstruggletokeepholdofmyplayerssayslewishamboroughbossdarrellqueeley 1 15484 0 0 /news/erithbelvedere4-1cobham 1 15732 0 0 /news/lovellpleasedwithimpressiveperformancesaheadofvitalfestiveperiod 1 15697 0 0 /news/drmartens/premier/dover/30thsept04.html 2 0 0 0 /news/551bc99da9ac9 2 23654 0 0 /news/ashfordtown2-1chathamtown-wevegotourjustrewardsbystayingintheleague-lovell 1 36292 0 0 /news/favasesecondrounddrawhernebaygoingintotheunknown-sayschairman 1 20301 0 0 /news/sheppey050517 1 14287 0 0 /news/drmartens/eastern/folkestone/18thjuly04.html 1 0 0 0 /news/andyhessenthalerstepsdownasgillinghammanager 1 12374 0 0 /news/551bc99dbe7a4/drmartens/eastern/chatham/kentleague/tunbridgewells/tunverith111003.html 2 15653 1 0 /news/othernews/15thsept03.html 1 0 0 0 /news/beckenhamsufferingfrompitchdisease 2 13470 0 0 /news/551bc5e60c4af 1 12725 0 0 /news/clubdoesnotgenerateenoughmoneytopayplayersrevealsangelschief 1 13837 0 0 /news/playofffinallivekentishfootballwishcraywanderersallthebestoflucktoday 1 9861 0 0 /news/backingthefleettowembleyglorywereinagreatposition-daish 1 16804 0 0 /news/thamesjersey010815 2 61222 0 0 /news/glebe210122 4 68130 0 0 /ryman-2003-2006/ 1 2598 0 0 /news/millwall080718 3 31656 0 0 /news/wp-content/plugins/wp-file-manager/lib/files/xo.php 1 0 0 0 /news/551bc5d9e8ffd 4 31612 0 0 /news/NationalLeague020720 2 14435 0 0 /news/weneedtobeontopofourgamefromthefirstwhistlesayswellingunitedbossjamieday 1 16772 0 0 /news/chatham220719 1 13584 0 0 /news/551a95b389c04 2 21443 0 0 /news/thefacupalwaysmakesmytummyrumbleinexcitementrevealslordswoodbossjasonlillis 1 13947 0 0 /news/itsamassiveprivilegetobehostinggillinghamsayserithbelvederebossmickycollins 1 12692 0 0 /news/weretakingtonbridgeangelstoanotherlevelsaysambitiouschairman-exclusive 1 17439 0 0 /news/troubledfishergranted21dayreprieve 1 13523 0 0 /news/dealegha060822 4 121994 0 0 /news/551bc5e040f59 1 20248 0 0 /news/sittingbourne2greatwakeringrovers1 1 13883 0 0 /news/soccershorts280616 2 31116 0 0 /news/551bc5e8391bc 2 20369 0 1 /news/wedontwanthernebaytowalkawaywithitsaystunbridgewellsbossmartinlarkin 1 17200 0 0 /news/sevenoakstown300921 2 29283 0 0 /news/wingerwattsreturnstohayeslane 1 11517 0 0 /news/werenowherenearwhereiwantusintermsofperformancessaysmattlonghurst 1 12826 0 0 /news/wellingtown301020 1 13730 0 0 /news/551bc5dd60a39 2 17744 0 0 /news/folkestoneinvictastatement250221 2 26583 0 0 /news/thebigkickoffwalkerhandssevenplayerstheirashforddebuts-exclusive 1 12556 0 0 /news/ourhomeformisgoingtochangesaysdoverathleticbosschriskinnear 1 19943 0 0 /news/dealtown010819 1 12163 0 0 /news/theprizeishugesayswembleywinnertommysampson 1 22273 0 0 /news/ithinkwecouldhavedoneabitbetteradmitsbeckenhamtownbossjasonhuntley 1 13886 0 0 /news/lewisham180118 1 13627 0 0 /news/allweregoingtodoisgiveitourbestshotsayscroydonbossdicksongill 2 20119 0 0 /news/imdelightedstillwithhowtheclubisprogressingsayssammacneil 1 13499 0 0 /news/werehopingforagoodcrowdagainstmaidstoneunitedsaysbearstedbosstonycornwell 1 11804 0 0 /news/kentleague/ramsgate/30thjune03.html 1 0 0 0 /news/28thaug05.html 1 0 0 0 /news/otford180617 1 14035 0 0 /news/metcalfweshowedthehearttowinourfirstgame 1 14313 0 0 /news/facarlsbergvasesecondrounddraw 1 13216 0 0 /cray-2003-2006 15 177064 2 2 /news/chips250515 3 22743 0 0 /news/551bc99dbe7a4/kentleague/cray/kentleague/cray/greenwichvcray060903.html 2 15653 0 0 /news/thefavasefinal2013theresonlyonewaytoenjoyitbybringingthetrophyhomesaysbourne 1 22053 0 0 /news/braintree191105.html 1 0 0 0 /news/ashfordtown1folkestoneinvicta1 1 12971 0 0 /news/tunbridgewells4-1hollandsblair-farniesomeofourfootballwasexcellent-exclusive 1 16275 0 0 /news/fisher2-2tunbridgewells-wevedroppedtoomanypointstowintitlesaysmartinlarkin 1 34064 0 0 /news/hughespartscompanywithbeckenham 1 14773 0 0 /news/longhurstpartscompanywithderesafterjusteighteendays 1 16898 0 0 /news/25thmar05.html 1 0 0 0 /news/itwillbeagreatachievementtoreachthekentseniortrophyfinalsaysholmesdalecoachmitchell 1 16132 0 0 /news/itsuptomyplayerstoplaythemselvesintomycupfinalplanssaysjones 1 19749 0 0 /news/sevecobh110821 5 140225 0 0 /news/dartford3-2wellingunited-dartsshininglightsstunwings 1 21802 0 0 /news/spurswerejusttoohotforusadmitsproudsawyer-exclusive 1 14913 0 0 /news/rusthall200422 4 49878 0 0 /news/maidstoneunited2-0hernebay-ithoughtweweredisapointingtodayadmitsjaysaunders 1 29811 0 0 /news/crawforditstimeweshowedsomeheart-exclusiveinterviews 2 27263 0 0 /news/imconfidentthativelefttheclubinasafepairofhandssaysterrynaden 1 19698 0 0 /news/idontwanttoriptheheartoutofglebesaysnewmanagersimoncopley 1 19072 0 0 /news/therealdeal-wembleymanuscriptchapters1-10 1 65695 0 0 /news/corby051105.html 1 0 0 0 /news/erithphoe110418 1 33171 0 0 /news/551a92509cc62 4 33635 0 0 /news/551bc5e2a6e61 1 15156 0 0 /news/craysev110417 1 32522 0 0 /news/patientcugleynetslong-termtargetblackman 1 14398 0 0 /news/ebbsfleet150218 1 11519 0 0 /news/6thnov05.html 1 0 0 0 /news/wereshowingsignsoffatigueadmitshessenthaler 1 14158 0 0 /news/histon050205.html 1 0 0 0 /news/551a9798419f2 1 3391 0 0 /news/sporroch041119 1 24499 0 0 /news/hythrams311023 9 302616 1 1 /news/ashford020417 1 13548 0 0 /news/soccershortsimstillbuildingmysideadmitssevenoakstownbosskeithlevett 1 49451 0 0 /news/wemusttakeourchancessaysfirkins 1 13943 0 0 /news/kentleague/sladegreen/didcotvsladefac060903.html 1 0 0 0 /news/551a96db5f2e4 2 19241 0 0 /news/chathamhopingitsthirdtimelucky-exclusive 1 12930 0 0 /news/wellingunited1-1dartford-wevehadarealdisasterousrunadmitsdartsbosstonyburman 1 30919 0 0 /news/thechallengenowistoproducethenecessarilyfundingtomaintaintheclubsstatus-moules 1 13235 0 0 /news/glebe240921 1 12094 0 0 /news/ramsplaylocalsideforten-year-oldroadaccidentvictim 1 11753 0 0 /news/glebtunb120320 1 35612 0 0 /news/thamhorn081017 2 56890 0 0 /news/collier120615 2 18000 0 0 /news/551bc5e87cffb 1 13568 0 0 /news/kentleague/tunbridgewells/29thjune03.html 1 0 0 0 /isthmian-league/47 3 45450 0 0 /news/iwillnotputnewmanagementtriounderpressuresayscroydonchief 1 15604 0 0 /news/wecouldntcompetewithtonbridgesofferforharwoodsaysbutler 1 21307 0 0 /news/resultsfornovember2008 1 22592 0 0 /news/daishcelebratesoneyearatfleetwithvictory 2 15186 0 0 /news/stonesshowdownisnotamust-wingameinsistswarrilow-exclusive 1 17141 0 0 /news/shamefullondonriotsforcecancellationofthreegamesoversafetyreasons 1 13588 0 0 /news/osborniswelcomebackanytimesaysfrancis 1 15589 0 0 /archive-2006-2014/www.heineken.co.uk/www.heineken.co.uk/www.heineken.co.uk/ 1 4997 0 0 /news/burmanhasnointentionofleaving 2 17856 0 0 /news/lydd271115 1 11756 0 0 /news/drmartens/eastern/dartford/11thaug03.html 1 0 0 0 /news/wardilltakeramsgateuptotheconferenceexclusive-segregationdetailsforthebiggame 1 20258 0 0 /news/551a97b19cb95 1 19033 0 0 /news/phoenix210918 2 25080 0 0 /news/werenotinasituationtowintheleaguesayscugley 1 21313 0 0 /news/leicester281018 2 32651 0 0 /news/ryman/bromley/erithandbelvedere070804.html 1 0 0 0 /news/wearenotgoingintotherymanpremiertosimplymakeupthenumberssaysterrycasey 1 12359 0 0 /news/551bc5d9cf63d 2 18052 0 0 /news/551a9799a1d75 1 4870 0 0 /news/551bc99dced39 2 22175 0 0 /news/chathamtown4-1fleettown-wegotalittlebitoftherubofthegreenadmitspaulfoley 1 18139 0 0 /news/holmesdale030921 1 11569 0 0 /news/corinthiandefenderdanbentearnstrialatdagenhamredbridge 1 14449 0 0 /news/551a931e122c6 1 10684 0 0 /news/newfavershambosscopleymakesdoubletransferswoop 1 13293 0 0 /news/551a931e0ad7c 3 32677 0 0 /news/wehavetomakesurewerehardtobeatsaysbromleybossmarkgoldberg 1 14050 0 0 /news/maidstoneunited1-4tonbridgeangels-mainsmashesclubrecord 1 28795 0 0 /news/burmantellshisteamtoshowtheirquality 1 13127 0 0 /news/wevegotnothingtoloseatwokingsaysdartfordbosstonyburman 1 15456 0 0 /news/millwallpavey090515 1 12647 0 0 /news/wegotolordswoodingoodspiritsdespitefirstlossinelevengames-luchford 1 13753 0 0 /news/millwallstatement081220 1 13490 0 0 /news/551a9678b76f2 3 41702 0 0 /news/hytheheroeswereallwillingjustthisoncetospendthefridaynightin-skipperdavecook 1 25879 0 0 /news/soccershorts270617/folkestoneinvictafc.com. 2 5416 0 0 /news/HythHast010115 2 58321 0 0 /news/bullardreturnstostonebridgeroad 1 11266 0 0 /news/soccershortshernebaychairmancondemnsnortonsalehousetactics 1 45770 0 0 /news/folkestone300705.html 1 0 0 0 /news/folkestoneinvictaonvergeofgoingintoadministration 1 22573 0 0 /news/itsimportantwegiveeverythingtogetintotheplay-offssaysdoverathleticskippershanehuke 1 14034 0 0 /news/werelookingforwardtoputtinglastseasonbehindussayscrockenhillbosscraigclark 1 15480 0 0 /news/drmartens/eastern/sittingbourne/26thjune2003.html 1 0 0 0 /national-league/25 2 25135 0 0 /news/wewontgivethistrophyuplightlyinsistshythetownbossscottporter 1 14025 0 0 /news/sevenoaks220715 1 15624 0 0 /news/crayphoe051021 3 68254 0 0 /news/chathamtown300919 2 14931 0 0 /news/20thoct04A.html 1 0 0 0 /news/kingstonian0-4dartford-idlovetostayinthisforaslongaswecansaystonyburman 1 24708 0 0 /news/gravesendnorthfleet4-1tamworth-daishdebollasfreekickswerefrightening 1 17508 0 0 /news/porterandcox030316 2 30177 0 0 /news/551bc99b4b44c 2 19587 0 0 /news/551a931e7ac7f 2 21524 0 0 /news/stainestown030120 2 22945 0 0 /news/thamesmead290116 2 26487 0 0 /news/551a931dbfda3 2 26052 0 0 /news/stansfield080105.html 1 0 0 0 /news/werenotgoingtomakethenumbersupintheleaguesaysholmesdalecoachrossmitchell 1 14537 0 0 /news/isthmianleaguestatement101220 2 31437 0 0 /news/551bc5e7594be 2 18534 0 0 /news/mynextgoalistoputsimonhalseyonacontractsayshernebaychairman 1 13235 0 0 /news/551a97998123d 1 4736 0 0 /news/551a9718e63c3 3 35590 0 0 /news/sittingbourne1-1ashfordtown-abbottcondemstrebelsioverallegedspittingincident 1 30347 0 0 /news/iamcommittedtothestonessaysbosspeternott 1 20700 0 0 /news/craywandererschairmangaryhillmantoanswerquestionsaboutnewstadiumatbooklaunch 1 12645 0 0 /news/sittingbournep-pburgesshilltown 1 10561 0 0 /news/vcdathletic230918 2 25820 0 0 /news/returningtostoneswasano-brainersaysroyston 1 13823 0 0 /news/drmartens/premier/dover/17thsept04.html 1 0 0 0 /news/pleaseconsidermakingadonationtohelpwithrunningcosts 1 10049 0 0 /news/elmstead031117 1 13405 0 0 /news/FAStatement031120 3 32565 0 0 /news/chathamdraftingoalkeepingcoachforyoungsters 1 11305 0 0 /news/seagerhailsteammorale 1 11966 0 0 /news/leatherhead3-3ashfordtown 1 14624 0 0 /news/glebe140122 1 14329 0 0 /news/551a99e475e8e 2 30170 0 0 /news/soccershortsfleetsettohanddaishanewcontract 1 28490 0 0 /news/snodland031117 1 12676 0 0 /news/hythe021015 5 41130 2 2 /news/thecommiteearemakingthesameoldmistakesagainsaysformerhernebaychairmantrevorkennett 2 24114 0 0 /news/othernews/1staug04goals.html 1 0 0 0 /news/vickersbeatthebigfreezetokeepinshape 1 12682 0 0 /news/soccershortsfisherathleticunveilplansfornew35mstadium 1 31515 0 0 /news/PeterboroughStatement 2 15908 0 0 /news/drmartens/eastern/folkestone/windsor300804.html 2 0 0 0 /news/551bc5e5e7388 1 13583 0 0 /news/angelsappointblewdenasnewreserveteamboss 1 12781 0 0 /news/swanseastarjonjoshelveysignsuptogeorgehowardsbenefitmatch 1 17054 0 0 /greenwich-2003-2006 15 191333 2 2 /news/nowsthetimetotoughenupandhavearun-obrientellschats 1 13771 0 0 /news/afccroydonathletic270623 2 16719 0 0 /news/wemustretainourfitnessduringthewintermonthssayshessenthaler 1 18702 0 0 /news/eritchic191123 13 329147 4 3 /news/southallscoachingisafillipforourpromotionbidsaysward-exclusive 1 17114 0 0 /news/icantcommittorymanleaguefootballadmitsherobutton 1 12659 0 0 /news/greeniesfridaypreview-3 1 20110 0 0 /news/bromleyneilsmith190518 1 22046 0 0 /news/hopefullyladyluckwillshineonusalittlebitmoresaystonbridgeangelsbosstommywarrilow 1 16175 0 0 /news/rusthall281016 1 12396 0 0 /news/551a931d8fa3d 1 15288 0 0 /news/highly-ratedgoalkeeperstayswithmargate 1 11149 0 0 /news/remyhailsthebestgoalthativescored 1 14022 0 0 /news/haritmead050416 2 57111 0 0 /news/551a979935d41 1 6685 0 0 /news/kentfootballunited010819 1 12342 0 0 /news/drmartens/premier/dover/4thfeb04.html 1 0 0 0 /news/551a956cecccb 2 10252 1 0 /news/kentleague/sladegreen/24thjuly04.html 1 0 0 0 /news/551bc99dbe7a4/kentleague/hernebay/drmartens/eastern/folkestone/folkvsali030104.html 2 15653 0 0 /news/folkestoneinvicta3waltonhersham1 1 15402 0 0 /news/551a9baff02a1 3 27353 0 0 /news/itsabouteverybodybelievingwecanwinthisgameandithinkwecansaysjoefrancis 1 14960 0 0 /news/wevegottowinourownmini-leaguetosurvivesaysyorath 1 12993 0 0 /news/nodoubtthefanswanttobeathernebaysayswhitstabletownbossjimward 1 14429 0 0 /news/551a9cf51605e 3 41604 0 0 /news/therewasnomaliceinwattspushinsistsburman-exclusiveinterview 1 14678 0 0 /news/greentonb081215 3 100369 0 0 /archive-2006-2014/246 1 19067 0 0 /news/erithdartfordtownunveilnewmanagementteamfornextseason 1 15609 0 0 /news/551a956bf199b 3 21696 0 1 /news/cugleyfindsshort-termkessellreplacement 1 11060 0 0 /news/corinthian040823 1 15659 0 0 /news/ijusthopewecankeepthefavasedreamgoingsayshernebaybosssimonhalsey 1 17748 0 0 /news/redhill0-1doverathletic-carruthersitsgoodtoputadovershirtonagain-exclusive 1 17928 0 0 /news/wedofeelpeoplearenotgivingusachancesaysdartfordbosstonyburman 1 14411 0 0 /news/sevenelms231116 3 51441 1 1 /news/551a97b1a2f33 1 15273 0 0 /news/lovellillgivelocalplayersachance-iftheyregoodenough-exclusive 1 18379 0 0 /news/punjgreen020517 1 30250 0 0 /news/crayvalley150619 3 28188 0 0 /news/crayphoe041017 3 71587 0 0 /news/itsabouttimewerewritetheclubshistorysaysbromleycoachneilsmith 1 22641 0 0 /news/ashfordunited260918 3 30573 0 0 /news/redhill0-1folkestoneinvicta-hopefullywecanmakefolkestoneabiggerclubagain-neilcugley 1 22292 0 0 /news/soccershortsweareableforthefirsttimetoatttractplayerslikeademolasaysbromleyboss 2 26914 0 0 /news/ineedtonaildowntheplayersiwanttostaysaysebbsfleetunitedbossjamieday 1 14526 0 0 /news/margate151215 1 12847 0 0 /news/551bc99b7cfe8 2 18666 0 0 /news/551bc99a80bee 2 22912 0 0 /news/551a979adb766 1 4924 0 0 /news/deresappointnewbackroomstaff 2 13258 0 0 /news/doverathletic251120 1 10647 0 0 /news/kentrivalsrelishcupclash 1 20238 0 0 /news/letsfinishtheseasononahighsaysbaker-exclusiveinterview 1 13940 0 0 /news/iwantedafreshchallengeadmitsgoodwin 1 16321 0 0 /news/dulwichhamlethalf-priceboxingdayofferforfansofeaglesandlions 1 16512 0 0 /news/x-3 1 9696 0 0 /archive-2006-2014/204 1 20103 0 0 /news/folkestone220218 2 35021 0 0 /news/hastings200905.html 1 0 0 0 /news/551bc5e411041 1 16591 0 0 /news/hessenthalerwarnsstarnamesthattheymustperform 1 18280 0 0 /news/crowholl210117 1 37348 0 0 /news/weregettingbetterinsistsfarnie-exclusiveinterview 1 13882 0 0 /news/briggsleavesashfordthroughfitnessconcerns 1 13391 0 0 /news/tootingvsittfat041003.html 1 0 0 0 /news/ksports030417 1 12950 0 0 /news/werenottakingthisgamelightlysayswhitstabletownbossnickysouthall 1 14234 0 0 /news/beckchat030419 2 45320 0 0 /news/wehavetomakesurewegetsomethingatthemarketsaysthamesmeadbosskeithmcmahon 1 14868 0 0 /news/croydon1-3hendon 1 17877 0 0 /news/holmesdale040823 1 14560 0 0 /news/551bc5de2e087 1 11705 0 0 /news/hitfav190916 2 56370 0 0 /news/bromley170116 3 25244 1 1 /news/holmesdale110319 1 11194 0 0 /news/sevenacre260715 1 13361 0 0 /news/beckenhamtown1-5bromley-fantasticnightinrespectoftheresultandfitnesssaysneilsmith 1 23516 0 0 /news/dartford270905.html 1 0 0 0 /news/tondov031016 2 68626 0 0 /news/itsgoingtotaketimetobesuccessfuladmitscorinthiancoachdouglas 1 15542 0 0 /news/braithwaitesscanhasbearingonchasesdoverfuture 2 19730 0 0 /news/crayhast111118 4 74290 1 1 /news/folkmers020515 2 61020 0 0 /news/ksports25052021 1 11757 0 0 /news/soccershorts230515 2 40895 0 0 /news/wellingunited181019 2 15111 0 0 /news/gravesendnorthfleetvgraysathleticmatchpostponed 1 10219 0 0 /news/20thmay04.html 1 0 0 0 /news/fisher080319 1 12560 0 0 /news/craywalt010518 3 80507 0 0 /news/551bc99e4ba9f 2 23639 0 0 /news/fisher2-4maidstoneunited-webelievewecanhaveagoodruninthissaysjackparkinson 1 26537 0 0 /news/chathamtownlaunchfootballacademy 1 14716 0 0 /news/551bc99dbe7a4/kentleague/hernebay/kentleague/maidstone/maidvslade251003.html 2 15653 0 0 /news/wevegotagreatchanceofgettingthroughtothesemi-finalssayshernebaybosssimonhalsey 1 16612 0 0 /news/551a9797dc429 2 17302 0 0 /news/gillingham190620 2 22190 0 0 /news/jenkinspleasedwithstarttonewcampaign 1 14039 0 0 /news/whitstabletown150422 2 27243 0 0 /news/wererisingtothechallengesaystable-toppingbeckingham 1 13374 0 0 /news/erithtown1-0hythetown-twomanycooksspoilthebroth 1 15238 0 0 /news/551a92500d255 1 3478 0 0 /news/whitstable260519 2 24888 0 0 /news/bearsted280520 1 15029 0 0 /news/margate261222 5 63390 0 0 /news/551a97b0cfaab 2 27812 0 0 /news/551bc99dbe7a4/ryman/bromley/drmartens/premier/dover/15thaug03.html 2 15653 0 0 /news/551a931de88ca 2 27198 0 0 /news/551bc5e79db6d 1 11228 0 0 /erith-town-2003-2006 14 183940 1 2 /news/brombwood040415 2 34670 0 0 /news/leadinggoalscorers-clubbyclub 1 15194 0 0 /news/crowborough050816 1 16245 0 0 /news/bordenvillage140520 2 15752 0 0 /news/apmbrowning240515 3 25926 0 0 /news/551a967895330 3 62792 0 0 /news/everyseasonwetryandbetterwhatwevedonesaysdartfordbosstonyburman 1 17160 0 0 /news/folkestonepreparefortheirlittlecupfinal 1 17481 0 0 /news/maidstoneunitedstrikerdannyhocktonisoutforrevengeatcray 1 18060 0 0 /news/551bc99e04820 2 31714 0 0 /news/sittingbourne4stamford2 1 16269 0 0 /news/crayvsporting160803.html 2 0 0 0 /news/sctelt260816 1 31600 0 0 /news/mynewsigningsallhavepotentialsaysward-exclusive 1 12902 0 0 /news/551bc99add153 2 18025 0 0 /news/rusthall150320 1 15795 0 0 /news/greenwich121018 2 25571 0 0 /archive-2006-2014/188 1 19131 0 0 /news/551bc99a99301 2 17665 0 0 /news/walkertargetstwonewplayers-exclusive 1 11280 0 0 /isthmian-league/www.heineken.co.uk/www.heineken.co.uk/www.heineken.co.uk/ 1 5110 0 0 /news/folkestone200220 2 24475 0 0 /news/werelookingforsponsors 1 12656 0 0 /news/wortfolk190316 2 55674 0 0 /news/maidstone280818 1 12776 0 0 /news/ryman/bromley/leatvbrom181003.html 1 0 0 0 /search 51 11000568 3 7 /news/kentleaguestillunclearoverfixturelistfiasco 1 11902 0 0 /news/FAStatement070821 4 40073 0 0 /news/bromley2-4woking-wehavetoconsiderouroptionssaysbromleybossmarkgoldberg 1 21605 0 0 /news/fishcrow170417 1 37742 0 0 /news/beckbrid220917 2 20325 0 0 /news/551bc5e05f692 2 25452 0 0 /news/551a956bd5ef5 1 3296 0 0 /news/burmanfacupdefeatletdowntheclub 1 12980 0 0 /news/dartford2-1stainestown-theresagoodfeelingabouttheteamsaysdartfordbosstonyburman 1 18951 0 0 /news/wecanturnthingsaroundinsistsaris 1 18103 0 0 /news/fisher1-3tunbridgewells-itwasjustareallygoodawayperformancesaysmartinlarkin 5 117288 2 2 /news/doveraddpairtotheirpromotionchasingsquad 1 12638 0 0 /news/shorts270615 2 45394 0 0 /news/greenhythe210217 2 58502 0 0 /news/24thmay05.html 1 0 0 0 /news/bromley7-1tonbridgeangels-idlikeafirstteamsquadofexacademyplayerssaysstevebaker 2 38561 0 0 /news/sceflstatement271120 1 13962 0 0 /news/soccershortsvickersannouncelegendssquads 1 16066 0 0 /news/shorts050615 3 45125 1 1 /news/millwall211019 2 26292 0 0 /news/harlow220105.html 1 0 0 0 /news/soccershortsdartfordsuffermcclementsblow 1 20362 0 0 /news/wereconfidentofcausinganupsetinsistshume 1 18773 0 0 /news/beckgleb210819 1 26261 0 0 /news/saturdaysmatchreports-1 1 33051 0 0 /news/nottupsetoverplayerexodus 1 26829 0 0 /news/worthing271205.html 1 0 0 0 /news/551a9250030e1 2 15186 0 0 /news/551a9bafe1af2 3 25669 0 0 /news/resultsjulyaugust2021 2 87201 0 0 /news/ebbsfleet210820 1 11840 0 0 /news/fisher140716 1 14484 0 0 /news/wejustneedtoturnupandplaytoourbestsaysdoverathleticdefenderollieschulz 1 13628 0 0 /news/bidforitemsinourshop 1 10365 0 0 /news/greenwich211218 2 26428 0 0 /news/hythe230915 2 25906 0 0 /news/soccershortskentcoachteamsupwithmartinallenatnottscounty 1 22232 0 0 /news/ashford281123 18 120163 1 3 /news/hayesyeading2-4doverathletic-atthisstageicantbemorehappywiththem-nickyforster 1 23317 0 0 /news/soccershortsextrawalkerreturnstomaidstoneunited 1 27724 0 0 /news/kentleague/lordswood/14thaug03.html 1 0 0 0 /news/551a96dc4c6fc 3 35327 0 0 /news/favershamtownsearchfornewreserveteammanager 1 13853 0 0 /news/imgladtobegettingbackintofootballafterbeatingthroatcancersayschrismccarthy 1 14567 0 0 /news/chathamtown170119 1 12470 0 0 /news/551a97b09c114 2 30348 0 0 /news/551a979a04703 1 5223 0 0 /news/beatingdereswasourbestperformanceoftheseasonhailscorinthianbossjamescollins 2 15371 0 0 /news/PMStatement160320 3 38117 0 0 /news/facupspecialdoverbossmartinhayestellhissidetogiveitagoandhavenoregrets 1 19438 0 0 /news/wellingunited2-2afcwimbledon-werebuildingtowardspromotion-ford 1 16347 0 0 /news/551bc5e750ccf 1 11300 0 0 /news/drmartens/eastern/sittingbourne/Harlow210804.html 1 0 0 0 /news/february2011results 1 34807 0 0 /news/dulwich161116 2 24030 0 0 /news/vcdhandedawaydrawinlast16 1 12273 0 0 /news/wewanteveryonetocomeandenjoythemselvessaysdartfordco-chairmandaveskinner 1 15375 0 0 /news/551bc5da5e7a1 4 33198 0 0 /news/greenwichvcray060903.html 1 0 0 0 /news/551bc5e5cbb0a 1 12667 0 0 /news/wevenothadmuchsuccessinthefacupadmitsdulwichhamletbossgavinrose 1 15503 0 0 /news/kentleague/ramsgate/ramsgatevhythe120803.html 1 0 0 0 /news/hythetown240523 2 29131 0 0 /news/edwardsremainspositiveoverfleetsfuture 1 20065 0 0 /news/vcdathletic2-2craywanderers-wevetoldeveryonetheyreplayingforashirtsaysjoefrancis 1 25426 0 0 /news/soccershortshocktondropsmargatetransferbombshell 1 13659 0 0 /news/15thjune04A.html 2 0 0 0 /news/thefleetatwembleydaishplottingwembleyglory 1 15650 0 0 /news/dealtown200619 1 11431 0 0 /archive-2006-2014/272 2 23259 0 0 /news/sittingbournesupportersdeserveagoodsidesaysjoint-managerjimward 1 15122 0 0 /news/3rdmay04.html 1 0 0 0 /news/resultsaugust2015 2 79105 0 0 /news/sportingclubthamesmead271020 2 19250 0 0 /news/bromley190618 5 26313 1 2 /news/whitstablekeeptheirfacupcampaignontrack 1 14106 0 0 /news/kennington251119 1 12749 0 0 /news/torquayunited4-0bromley-weregoingtotryandgetajobdoneintheleaguenowsaysgoldberg 2 57030 0 0 /news/ishouldnthavebeenbeatenatmynearpostadmitsholmesdalekeeperdarrenibrahim 1 16533 0 0 /news/othernews/SECFL220204.html 1 0 0 0 /news/kingstonian2-4craywanderers-jenkinsiknewwewouldclimbthetable-exclusiveinterviews 1 24862 0 0 /news/metrogas010519 1 13412 0 0 /news/folkestoneinvicta2-2leatherhead5-3pens-werehopefulwecangetpromoted-delo 1 21363 0 0 /news/551a92505ef16 2 17081 0 0 /news/imreallychuffedtobemadehonoraryvice-presidentofthekcfasaystommysampson 1 12839 0 0 /news/letshopewecanproduceanothergutsydisplayatwrexhamsaysnickysouthall 1 13819 0 0 /news/ramsgate180119 3 30713 0 0 /news/sittrams281215 3 78533 1 1 /news/thefacupfourthqualifyingrounddraw 1 13338 0 0 /news/6thoct03.html 1 0 0 0 /news/soccershortsifeelverypassionatelyaboutrebuildingtheclubinsistsashfordowner 1 46373 0 0 /news/dealtown221021 4 54554 0 0 /news/weresosorryrobbo 1 12155 0 0 /news/lordswood171116 1 13412 0 0 /news/mysquadwillonlygetstrongersaysglebebossrockymcmillan 1 14072 0 0 /news/ifeeliwasrighttoresignsaysformersittingbournebossmattwyatt 1 14391 0 0 /news/ivegotafewthingswrongbutillputthemrightinsistsdartsbosstonyburman 1 18447 0 0 /news/13thjan05.html 1 0 0 0 /news/thetitleisindulwichshandsnowadmitsmaidstoneunitedbossjaysaunders 1 15535 0 0 /news/kentleague/ramsgate/ramsgate.html 2 0 0 0 /news/bowersandpitsea191020 3 27912 0 0 /news/hernebay300319 2 24197 0 0 /news/ourmainobjectiveistowintheleaguesaysgreenwichboroughassistantpaulblade 1 14035 0 0 /news/faversham240619 2 23494 0 0 /news/bromvbrac270304.html 1 0 0 0 /news/551bc5e6e2e10 1 20499 0 0 /national-league/24 2 24363 0 0 /news/tunwells281016 1 13382 0 0 /news/oldbrom260118 1 16160 0 0 /news/551bc99dbe7a4/conference/gravesend/kentleague/tunbridgewells/9thnov03.html 2 15653 0 0 /news/sittingbourne171217 2 19023 0 0 /news/whitres040904.html 1 0 0 0 /news/notmanyclubswilllookforwardtotravellingtohernebaysaysbosssamdenly 1 13546 0 0 /archive-2006-2014/162 1 18831 0 0 /southern-counties-east-football-league/13 1 20992 0 0 /news/551bc5dabce8d 3 28568 0 0 /news/kentleague/erithtown/14thfeb04.html 1 0 0 0 /archive-2006-2014/39 2 25477 0 0 /news/ramswardsreturn010515 2 27226 0 0 /news/551a956b933bd 1 3774 0 0 /news/weneedasliceoflucksaysmunday 1 17287 0 0 /news/1Jan2004.html 1 0 0 0 /news/ifweturnupwithabadattitudewewilllosetoorpingtonwarnserithtownbosstonyrussell 1 16034 0 0 /news/sevenoakstown171119 2 46075 0 0 /news/thisisabigjobturningtheclubsfortunesandreputationaroundsaysmattlonghurst 2 20153 0 0 /news/551a979ae9ebf 1 5234 0 0 /news/erithtown300815 1 12552 0 0 /news/551bc99dbe7a4/kentleague/lordswood/drmartens/eastern/ashford/4thaug03.html 2 15653 0 0 /news/bromleyt150817 2 45740 0 0 /news/bromdov251016 3 56258 1 1 /news/551a99e38626a 1 13562 0 0 /news/perhapsisetmyheightsalittletoohighadmitsstrugglingfisherbossstevefirkins 1 14473 0 0 /news/corinthian-casuals2-0ramsgate-welackedabitofqualityadmitsramsgatebossjimward 4 57665 3 3 /news/beckenham220105.html 1 0 0 0 /news/ashford180216 1 18147 0 0 /news/NationalLeague260321 2 17366 0 0 /news/erithtown261004.html 1 0 0 0 /news/kentyouth/02-03finaltables.html 1 0 0 0 /news/gillingham1-1wycombewanderers-comicalowngoalgiftsleadersanundeservedpoint 1 16114 0 0 /news/maidstone181204.html 1 0 0 0 /news/wp-admin/database.php 1 0 0 0 /archive-2006-2014/23 2 26101 0 0 /news/kerrifeltsorryforthebanburygoalkeeper-exclusiveinterviews 1 18576 0 0 /archive-2006-2014/www.heineken.co.uk/www.heineken.co.uk/ 1 4997 0 0 /news/dealtown291217 1 11865 0 0 /news/stonesbossjaysaundersinnegotiationswithgoalkeepertimroberts 1 13138 0 0 /news/itshouldbeanentertaininggameatholmesdalesayswoodstocksportsassistantchriscooper 1 13224 0 0 /news/idontknowwhatimexpectingatcorinthianadmitslordswoodbossjasonlillis 1 15445 0 0 /news/551bc5dac9b6c 4 28144 0 0 /news/folkestoneinvicta1-0hillingdonborough-wemustimproveadmitscugley-exclusive 1 21091 0 0 /news/kentleague/deal/Sampson12.html 1 0 0 0 /news/fisher070819 1 13647 0 0 /news/KentFAStatement200820 3 32439 0 0 /news/theroadtowembleyasuccessfulnightforkentsidesbriefroundup 1 13716 0 0 /news/bridonropes220219 2 15395 0 0 /news/saturday21stjanuary2006fixtures 1 12555 0 0 /news/richardlawsonstepsdownafter25yearsasramsgatechairman 1 16399 0 0 /news/redcardspurredusonadmitsfleetherolong 1 12931 0 0 /news/ashfordbasedrobbinsleavesryeunitedbymutualconsent 1 13699 0 0 /news/tonbridgeangels210320 1 13901 0 0 /news/theresstillalotmoreworktodo-lovell 1 18401 0 0 /news/ksports030422A 4 54830 0 0 /news/551a931e54622 1 13934 0 0 /news/werecashstrappedandthecoffersarebare-ebbsfleetunited 1 12583 0 0 /news/exclusivestatementfromclivewalker-andreactionfromashfordtownco-owner 1 16332 0 0 /news/kentleague/deal/Sampson17.html 1 0 0 0 /news/wellsblondeambitiontochangetheirfortunes-exclusiveinterviews 1 16441 0 0 /news/drmartens/premier/dover/6thdec04.html 1 0 0 0 /news/kentleague/deal/17thoctZ.html 1 0 0 0 /news/soccershorts080722 2 31255 0 0 /news/bromtorq160416 2 37133 0 0 /news/fordkeepshisnewquartetclosetohischest 1 13214 0 0 /news/26thoct03.html 1 0 0 0 /news/canterbury291217 1 12680 0 0 /news/hernebay1-2erithbelvedere-weveshotourselvesinthefootsayssimonhalsey 1 24791 0 0 /news/icertainlyunderstandtheimportanceoffavaseprogresssaysmartinlarkin 1 17626 0 0 /news/ramsgateplayersinvolvedinaccidenten-routetohastingsgame 1 15941 0 0 /news/ksports280218 2 19950 0 0 /news/folkestone030920 2 22723 0 0 /news/conference/gravesend/8thnov03.html 1 0 0 0 /news/sittingbourne0-1folkestoneinvicta-wehaventreallygotgoingyetsaysneilcugley 1 18657 0 0 /news/kentleague/ramsgate/16thjuly03.htm 1 0 0 0 /news/kentleague/sevenoaks/sevenoaks.html 1 0 0 0 /news/551bc99cbe7db 2 20970 0 0 /news/dealtoot221022 5 158088 0 0 /news/ebbsfleetunited2-2salisburycity-daishspeaksabouthisfleetfuture 1 23093 0 0 /news/wevenotdoneourselvesjusticeathomeadmitsmargatebosschriskinnear 1 16163 0 0 /news/fadrawsannouncedthursdaylunchtime 1 13216 0 0 /news/hollands301117 2 16141 1 1 /news/551bc99dbe7a4/drmartens/eastern/folkestone/kentcounty/21stsept03.html 2 15653 0 0 /news/551a967735759 2 19745 0 0 /news/551a96db46261 3 25919 0 0 /news/concussionarticle021218 3 42666 0 0 /news/551bc5ded6593 1 17996 0 0 /news/chatham271205.html 1 0 0 0 /news/kentleaguecupfinalwinningwouldbetheicingonthecakesaysjones 1 19653 0 0 /news/margate031223 47 197763 2 16 /news/tonbridgeangels0-1chelmsfordcity-warrilowaskswheredidhegetthetimefrom 1 20993 0 0 /news/wedontfearanybodyatthemomentsaysdoverathleticbossnickyforster 1 14992 0 0 /news/bromchar120716 2 37318 0 0 /news/hythe190216 2 26541 0 0 /news/ashfordtownsearchfornewreserveteammanagerandphysio 2 14148 0 0 /news/kentleague/ramsgate/ramsu18vchat210304.html 1 0 0 0 /news/bromley100517 2 14991 0 0 /news/four-weekinjuryblowforinfluentialskipperdenly 1 21025 0 0 /news/dagebrom040919 2 36726 0 0 /news/othernews/augfix2004.html 1 0 0 0 /news/gormandoesntwanthissidetocrackovereasterperiod-exclusiveinterview 1 13341 0 0 /news/thamesmead060718 2 24422 0 0 /news/eastbourne040517 2 17031 0 0 /news/551bc5e320f32 1 15294 0 0 /news/drmartens/eastern/folkestone/tonbridge070904.html 2 0 0 0 /news/551a9250f260d/22ndaug05G.html 2 6643 0 0 /news/werenotgoingtogivethekentseniorcupthebackingitdeservessaysfavershambossluchford 1 17773 0 0 /archive-2006-2014/109 1 20452 0 0 /news/itsnotabouttheperformancebuttheresultsayssittingbournebossmattwyatt 1 12975 0 0 /news/6thjan05.html 1 0 0 0 /news/crayhast210816 1 28498 0 0 /news/sevenoaks170416 1 12839 0 0 /news/drmartens/eastern/tonbridge/20thaug04.html 1 0 0 0 /news/werestrongenoughtogetoutofrelegationbattleinsistsross 1 16622 0 0 /news/dannylye020519 3 28863 0 0 /news/vitalpointsatstakeforoursouthernleaguetrio-exclusiveinterviews 1 16505 0 0 /news/22ndjuly05.html 1 0 0 0 /news/drmartens/eastern/sittingbourne/3rdjuly03.html 2 0 0 0 /news/soccershortsdealtownsignformermanchestercityprospect 1 50533 0 0 /news/wp-content/plugins/apikey/abruzi.php4 1 0 0 0 /news/ashford061205.html 1 0 0 0 /news/doverathletichostaugustcoachingsessions 1 12368 0 0 /news/horsham0-3tonbridgeangels-warrilowbringontheleagueleaders 1 14046 0 0 /news/lyddtown281217 7 36870 6 6 /news/551bc5e33c3ce 1 15684 0 0 /news/16thapr04.html 1 0 0 0 /news/14thnov05.html 1 0 0 0 /news/551a956c4a35d 3 21853 0 0 /news/551a95b3e489d 3 35513 0 0 /news/whitstableattractbiggestcrowdforsevengamesthankstoourcoverage 1 11116 0 0 /news/ryman/bromley/croyathvbrom020304A.html 1 0 0 0 /news/hollandsandblair170422 1 14638 0 0 /news/resultsnovember2022 4 195175 0 0 /news/elmstead050815 1 21057 0 0 /news/resultsdecember2012 1 45599 0 0 /news/1staug05.html 1 0 0 0 /news/modules/mod_simplefileuploadv1.3/elements/i8HQoK6nR.php 1 0 0 0 /news/dealtown250904.html 1 0 0 0 /news/talentedstrikercassiuscanonlygetbetterwarnsoboyle 1 15402 0 0 /news/threebridges0-0ramsgate-idontwanttheseasontofinishonawhimpersaysjustinluchford 2 34482 0 0 /news/abbottfeelswoundupoveribrahimagreement 1 23597 0 0 /news/canterburycitymakeawelcomereturntofootballpyramid 1 11475 0 0 /news/fatrophyfirstqualifyingroundpreviews 1 22873 0 0 /news/chathamtown2-0folkestoneinvicta-keepersredcardovershadowschatstrophywin 1 22159 0 0 /news/longmarg120516 1 36993 0 0 /kent-invicta-league/27 2 23825 0 0 /news/soccershortsdulwichhamletbeginsearchfornewmanager 1 14460 0 0 /news/clubswillloseoutonsponsorshipmoneysayskentleaguechairdeniserichmond 1 16994 0 0 /news/corinthian040816 1 13226 0 0 /news/551bc5df0eabd 1 20259 0 0 /news/punjab031117 2 15104 0 0 /news/4thjan06.html 1 0 0 0 /news/.well-known/pki-validation/xmrlpc.php 1 0 0 0 /news/551bc5dfe04bb 3 35932 0 0 /news/dartsareflyingreportssawyer-exclusive 1 15364 0 0 /news/551bc5e898a4a 1 12055 0 0 /news/wevegottoperformathomesaysbromleybossmarkgoldberg 1 14332 0 0 /news/wewontheworldcuplastnightsaysgiantkilleroboyle 1 15290 0 0 /news/punjabunited101022 1 12891 0 0 /news/tonbridgeangels3-1chelmsfordcitymainiwanttoturnpro-exclusiveinterviews 1 25335 0 0 /news/cray050818 3 33068 0 0 /news/bridon170915 2 16010 0 0 /news/9thjune04.html 1 0 0 0 /news/isthmian150517 3 39362 0 0 /news/bromvdartksc071003.html 1 0 0 0 /news/dalersdidntmatchmyownrymanleagueambitionsrevealsbeckingham 1 14782 0 0 /news/thamesmeadtown2-2erithbelvederegormanbemoanescostlymistakes-exclusiveinterviews 1 21425 0 0 /news/werecapableofgoinginthereandmakingtheplay-offssaysmaidstoneunitedbossjaysaunders 1 15363 0 0 /news/playersletmedownfumesporter 1 15073 0 0 /news/wewanttolayamarkerdownfortherestoftheleaguesaystunbridgewellsskipperjasonbourne 1 13365 0 0 /news/ashbytellshisdefencetoshapeup 1 11313 0 0 /national-league/41 3 26710 0 0 /news/wecouldhopefullyhaveagoodseasonwithalltheproblemswevehadsaysneilcugley 1 13236 0 0 /news/bromleysgoingtobeatoughtaskbuthopefullywecanshowourtruecolourssaystonyburman 1 14409 0 0 /news/drmartens/eastern/sittingbourne/28thaug03.html 1 0 0 0 /news/551bc5dc9366f 3 33778 0 0 /news/ashfordtown2-4craywanderers 1 13980 0 0 /news/jonesbreakshissilenceandadmitshefearshytheopener 1 13983 0 0 /news/sevenoaks241116 1 13409 0 0 /news/morehelpwillbeappreciatedsaysseager 1 17079 0 0 /news/dartsbosstonyburmanrelishingfirstfleetclashfor18years 1 17928 0 0 /news/tonbridgeangels050421 1 11464 0 0 /news/18thjuly04.html 1 0 0 0 /news/kentleague/cray/favaseqfpreviewA.html 2 0 0 0 /news/camberley250905.html 1 0 0 0 /news/wellingtown170623 1 12888 0 0 /news/joebrownettstepsdownaswhitstabletownchairman 1 16643 0 0 /news/hollands080319 1 13542 0 0 /news/wehavetobeinapositiontogoupsayslyddtownbossdavesmith 1 18029 0 0 /news/551a9250ceb94 2 15544 0 0 /news/holmesdale240921 1 13321 0 0 /news/551a97b0bc1ea 2 27580 0 0 /news/defenderbenpayneleaveschathamfordockers 1 12686 0 0 /news/551bc99b2dccc 2 14970 0 0 /tier-football 15 226858 1 1 /news/551bc99dbe7a4/drmartens/eastern/folkestone/kentleague/VCD/7thjuly03.html 2 15653 0 0 /news/sheppeyunited070821 1 12855 0 0 /news/551a967913cae 2 22309 0 0 /news/angelsinheavenihadatearinmyeyeattheendadmitsproudlocalherosonnymiles 1 17730 0 0 /news/gillingham140121 1 11853 0 0 /news/sevenoakstown4-2horleytownsevenoaksdreamoffleetyouthcuptie-exclusiveinterview 1 17264 0 0 /news/famentalhealthcampaign150519 2 28416 0 0 /news/28thjune05.html 1 0 0 0 /news/551a94af410a5 3 24240 0 0 /news/erithtown200705.html 1 0 0 0 /news/erithtownbosssteveoboylewantsnomorebadshotsongoal 1 15117 0 0 /news/wemustputourchancesawaysaysgaryabbott 1 19960 0 0 /news/croydonbosstompkinssignstrio 1 14521 0 0 /news/ramsvsidleyfavase230903.html 1 0 0 0 /news/wp-content/themes/seotheme/db.php 1 0 1 0 /news/corinthian080419 1 15210 0 0 /news/whyteleafe2-0wellingunited-wingscometotermswithshockingfacupexit 1 21859 0 0 /news/thanetbasedstrikerfacesdecisiontime-dartsorrams 1 12949 0 0 /news/craywanderers2-0carshaltonathletic-therefereemadetherightdecisionadmitsjoefrancis 1 30504 0 0 /news/dealtown091118 1 11181 0 0 /news/craywanderers250321 3 30452 0 0 /news/bradleypritchard140219 3 33843 0 0 /news/concordwontlookforwardtocomingtoebbsfleetsaysstevebrown 2 18195 0 0 /news/551bc5de4a5ba 1 13003 0 0 /news/thefavasefinal2013themorepeoplewecangettowembleythebettersaysmartinlarkin 1 14523 0 0 /news/551a97b0ba987 1 10980 0 0 /news/551a92508eed0 2 15332 0 0 /news/wp-content/plugins/superstorefinder-wp/ssf-wp-admin/pages/SSF_WP_UPLOADS_PATH/csv/import/king.php 1 0 0 0 /archive-2006-2014/149 1 19767 0 0 /news/drmartens/eastern/sittingbourne/sittvtonb221103.html 1 0 0 0 /news/wedeservetobehigherupinthedivisionsayswhitstabletownjoint-bossjimward 1 15893 0 0 /news/paulmccarthy200217 1 13995 0 0 /news/crayvalley081217 1 12373 0 0 /news/ramshan190817 3 70288 0 0 /news/stonesdropstroutsbombshell 1 12778 0 0 /dartford-2003-2006/4 3 32292 0 0 /news/beckenham170920 1 13907 0 0 /news/cugleykeenonsecuringspillerdeal 1 15443 0 0 /kent-invicta-league/33 2 27367 0 0 /news/drmartens/premier/dover/billericay170804.html 1 0 0 0 /news/langtonhailsashfordsrecentarrivals 1 13450 0 0 /news/ryman/bromley/westwickvbrom290204.html 2 0 0 0 /news/katejoynes11021 5 62320 0 0 /news/551a99e4a4b04 2 40558 0 0 /news/28thjan04.html 1 0 0 0 /news/551bc5e65f1bd 1 15401 0 0 /news/kentleague/cray/crayvtunb271203.html 1 0 0 0 /news/ialwaysknewitwasgoingtobequitehardadmitssevenoakstowncoachanthonyferguson 1 14167 0 0 /news/drmartens/eastern/erith&belvedere/8thoct04.html 1 0 0 0 /news/erithbelv041215 1 12241 0 0 /news/dulwich261218 1 12757 0 0 /news/551a9cf54ada2 3 42938 0 0 /news/theicingonthecakewouldbetoreachthelondonseniorcupfinalsaysstevechapman 1 14819 0 0 /news/sheppey250416 1 12260 0 0 /news/kennsutt191220 4 142726 0 0 /news/551a99e46f22d 1 12092 0 0 /news/soccershortsteamnewsfortomorrowsfriendlies-exclusive 1 13311 0 0 /news/551bc5e6c073d 1 19681 0 0 /news/dulwich091117 2 24656 0 0 /news/trainingonmaidstoneuniteds3gpitchisfantasticforouracademyboyssayscoachjackparkinson 1 20485 0 0 /news/thisweeksfixures 1 12248 0 0 /news/rusthall130217 1 11878 0 0 /news/kingstonian1-0chathamtown 1 11897 0 0 /news/daishbringssouthafricandefendertostonebridgeroad 1 11321 0 0 /news/iwillnotthrowinthetowelsaysdefiantstonesbosspeternott 1 21931 0 0 /news/kentleague/cray/21stoct04.html 1 0 0 0 /news/facupdrawfleetlookforwardtointerestingkentderbyatbromley 1 14580 0 0 /news/551bc99dbe7a4/kentcounty/kentleague/maidstone/maidvlord271203.html 2 15653 0 0 /news/craywanderersbossianjenkinsreadytodiscusstermswithhissquad 1 16266 0 0 /news/farnborough070420 1 13923 0 0 /news/ryman/bromley/ashfvbrom250803.html 1 0 0 0 /news/itsgreatforustohaveollieschulzbackhomesaysramsgatebosstimdixon 1 14279 0 0 /news/rusthall140719 1 11643 0 0 /news/551a95b456b36 2 21710 0 0 /news/dartford2-7norwichcity-happyreturnformcdonald 1 30953 0 0 /news/kentleague/maidstone/maidstone.html 2 0 0 0 /news/whitstabletownunveilmajorsponsorshipdeal 1 12746 0 0 /news/cumberbatchfearsforhisfuture 1 23492 0 0 /news/551a925078d94 2 18745 0 0 /news/wevegottoworkhardertoaimforplay-offsadmitscugley 1 15174 0 0 /news/francis060804.html 1 0 0 0 /news/dartford101019 2 18418 0 0 /news/ashfchat240821 6 183782 0 0 /news/soccershortsstrikercarlrookquitswhitstabletownbytextmessage 1 18503 0 0 /news/margate061223/contact 1 3891 0 0 /news/humeofferstrialistsonelastchancetoimpress 1 17350 0 0 /news/resultsdecember2023 18 399614 1 8 /news/ialwayslovegoingbacktomyoldclubssaysjoefrancis 1 13253 0 0 /news/itsgoingtobehardtogetoutofrelegationnow-oconnell 1 13399 0 0 /news/burgesshilltown3-1folkestoneinvicta-thatperformancewasntgoodenoughadmitsneilcugley 3 59760 0 0 /news/falanaletsgettonbridgepromotedexclusiveinterview 1 16871 0 0 /news/warrilowdowntobarebonesdefensively 1 19589 0 0 /gravesend-2003-2006/4 3 31343 0 0 /news/bluesquarebetsouthopeningdayfixturesgivedoverathleticearlyrevengechance 1 13945 0 0 /vcd-2003-2006 15 174639 3 3 /news/vcdathletic0-0erithbelvedere-theofficialswereembarrasingsaysmickycollins 1 19292 0 0 /news/kentleague/thamesmead/19thsept04.html 1 0 0 0 /news/workcommitmentsforcemilestostepdownaschathamboss-exclusive 1 15638 0 0 /news/tunbridgewells201023 2 24830 0 0 /news/wellproduceagiant-killingifweplaythecardsright-porter 1 21712 0 0 /news/orpingtonappointseangloverastheirnewmanager 1 10955 0 0 /news/wellbedoingourhomeworkonringmersayserithtownassistantmanagerraypowell 1 14453 0 0 /news/thisisthestuffthatdreamsaremadeofsaysgarathmccleary 1 11993 0 0 /news/icouldntstandinmikelsuarezswaysaystonbridgeangelsbosstommywarrilow 1 14170 0 0 /news/hythetownlaunchinforaquidschemetoincreasegates 1 14370 0 0 /news/lordvbeng130304.html 2 0 0 0 /news/dartford2-0tonbridgeangels-iamfocusedtobringpromotiontodartford-burman 1 40252 0 0 /news/seagerremainsupbeatdespitebudgetcut-backs 1 14997 0 0 /news/soccershortslordswoodsfaganclearedofallegedrefereeassault 1 44361 0 0 /news/dulwich281016 2 25007 0 0 /news/daishsolveshisdefensiveinjurycrisis 1 12165 0 0 /news/ashford10817 3 30245 0 0 /news/loansigningapossibilityifconneallyfailsfitnesstest 1 13208 0 0 /news/greenwich020405.html 1 0 0 0 /news/boxingmightgetusonestepaheadofeveryoneelsesaysramsgatebossjimward 1 21775 0 0 /news/dartford150519 3 18966 1 1 /news/crayvalley150620 3 38863 0 0 /news/werelookingadifferentsidenowsaystonbridgeangelsbosstommywarrilow 1 15258 0 0 /news/drmartens/eastern/sittingbourne/arlesey140804.html 1 0 0 0 /news/drmartens/eastern/chatham/8thdec03.html 1 0 0 0 /southern-counties-east-football-league/55 1 19684 0 0 /news/veterangoalkeeperrogersstillplayingatsixty-exclusiveinterview 1 12561 0 0 /news/fcelmstead220219 1 13650 0 0 /news/ifeelaresponsibilitytostayandhelpgetdartsbacktowhereitbelongssayselliotbradbrook 1 14076 0 0 /news/cook101215 2 19948 0 0 /news/jonesreturnisarayofsunshineforashford 1 12910 0 0 /archive-2006-2014/182 1 18850 0 0 /news/mckimmhailsmargatescharacter 1 13445 0 0 /news/551a97b1831f3 1 12950 0 0 /news/wearegoingtobeinfinefettleforpre-seasonsayscrowboroughjoint-managerseanmuggeridge 1 12167 0 0 /news/551bc5d9203ca 2 14730 0 0 /news/551bc99d7f217 2 19673 0 0 /news/weregoingtowembleyfleetheroeswillcherishwembleyexperienceforlifesayskimble 1 17045 0 0 /news/conference/news/29thjune03.html 1 0 0 0 /news/kentleague/cray/keynvcray070204.html 1 0 0 0 /news/imnotinterestedinsomeoneplayingformoneysaysglebebossrockymcmillan 1 18782 0 0 /news/kentleague/cray/crayvpaghamfac310803.html 1 0 0 0 /news/warrilowwantstograb3000fromthepolice 1 16593 0 0 /news/craywands290915 3 38178 0 0 /news/vcdaashf070423 2 68781 0 0 /news/wemusttakeadvantageofourhomecomfortssaysmalin-exclusive 1 16354 0 0 /news/iwouldrecruitlocalplayersifiwasappointedsevenoakstownbosssayspaulmcdonagh 1 12308 0 0 /news/kentleague/cray/cray.html 1 0 0 0 /news/daishgratefulforfinancialassistance 1 19612 0 0 /news/folkestoneinvicta0braintreetown0 1 12818 0 0 /news/iwouldntcelebrateifiscoredagainsttonbridgeangelssayslewesstrikerlukeblewden 1 18062 0 0 /news/greeashf131118 2 69235 0 0 /news/sportingclubthamesmead230123 3 34983 0 0 /news/rusthallpartcompanywithmanagerpaulmcdonagh 1 12036 0 0 /news/therewillbenolapsesinconcentrationatchipsteadinsistsburman 1 15519 0 0 /news/551a979a29ec8 1 4888 0 0 /news/bromvcroy131203.html 1 0 0 0 /news/crockenhill030217 2 18146 0 0 /news/dartford3-2horsham-wehavetobestrongenoughtohandleexpectationsaysburman 1 24492 0 0 /news/erithbelvedere3sportingbengal2 1 12718 0 0 /news/wearetryingtodoasmuchaswepossiblycantoturnitaroundsayspaulblade 1 15861 0 0 /news/sevenoaksfacesterntestagainstthefleet-exclusiveinterview 1 12925 0 0 /news/8thjuneA.html 1 0 0 0 /archive-2006-2014/22 2 25661 0 0 /news/.well-known/pki-validation/atomlib.php 1 0 0 0 /news/551bc5e611a53 1 15918 0 0 /news/dovebrom141017 1 27370 0 0 /news/551bc99a93b0b 2 20554 0 0 /news/erithbelvederebossmattlonghurstsearchesforunder21managementteam 1 13734 0 0 /news/tunwells191004A.html 1 0 0 0 /news/551bc5dc48505 3 36862 0 0 /news/551bc99dbe7a4/drmartens/eastern/ashford/drmartens/eastern/sittingbourne/sittvbash061203.html 2 15653 0 0 /news/551a96db418ba 3 28600 0 0 /news/551a9c91ede44 2 22034 0 0 /news/beckcor210318 1 30239 0 0 /news/dealtown050722 4 45490 0 0 /news/october2009fixtures 1 69426 0 0 /news/rymankingsclinchtitlekingstonian2-6dartford-wedeserveeverythingthatwevegot-burman 1 38870 0 0 /news/mcmahoncapturesboropairaheadofnewadventure 1 13216 0 0 /news/24thfeb05.html 1 0 0 0 /news/bromleyontheorientibeleiveintheromanceofthefacupsaysbromleyskippertutuhenriques 1 19192 0 0 /news/551bc5e3cd5d7 1 15167 0 0 /news/kentleague/thamesmead/20thJan04.html 1 0 0 0 /news/folkestoneinvictaunveilnewdirectors 1 15975 0 0 /news/fleeetdown040517 1 13044 0 0 /news/worfav300416 2 54443 0 0 /archive-2006-2014/290 2 21985 0 0 /news/lordswood270722 1 14331 0 0 /news/10thdec04.html 1 0 0 0 /news/dartford160523 6 69404 0 0 /news/daishcomplainsaboutfixturebacklog 1 14305 0 0 /news/dealtown201218 1 11627 0 0 /news/551bc99dbe7a4/kentleague/thamesmead/kentleague/cray/kentseniortrophyqf030104.html 2 15653 0 0 /news/crayvalley100319 1 15468 0 0 /news/wp-content/plugins/ioptimization/a57bze8931.php 1 0 0 0 /news/551a925050d11 3 36913 0 0 /news/pitchero.com/clubs/whitstablebayfc 1 0 0 0 /news/551bc99cd77c6 2 22737 0 0 /news/551a979ab7095 1 17982 0 0 /news/551bc5de6a43f 1 11347 0 0 /news/ashford080716 1 13189 0 0 /news/whitstabletown2-2whyteleafe-idliketotaketheseplayersuptothepremiersaysjimward 2 60101 0 0 /archive-2006-2014/168 1 19233 0 0 /news/vickerspitchwillsuitussaystitlechasinghythebossscottporter 1 16162 0 0 /news/wp-includes/themes.php 1 0 0 0 /news/hessenthalercanstayhereforlifesaysjubiliantdoverchairman 1 16458 0 0 /news/hythetown5-3lewishamborough-wehavetodefendbetteradmitsfisk-exclusive 1 19436 0 0 /news/peckhamtown020519 1 13696 0 0 /archive-2006-2014/278 2 23558 0 0 /news/savethewingscampaignfridayisideallythelastdayfortransfers-sayssolicitor 1 16794 0 0 /news/hythetown150321 5 57020 0 0 /news/551a9c917e747 2 14149 0 0 /news/lordswood201017 1 11489 0 0 /news/bearsted020819 1 12349 0 0 /news/itsbeenthebestseasonsinceivebeenmanagersaysthamesmeadtownbosskeithmcmahon 1 14612 0 0 /news/theboysneedtobeplayingattheirbesttogetaresultagainstbristolroverssaysjamieday 1 12419 0 0 /news/igenerallythinktheabilitythatwevegotinthesquadwecandowellsayssimonaustin 1 13587 0 0 /news/cray-valley.co.uk 3 0 0 0 /southern-counties-east-football-league/65 2 34693 0 0 /news/bromley210519 2 16468 0 0 /news/theroadtowembleyfacarlsbergvasefourthrounddraw 1 13041 0 0 /news/ramsgate281119 3 29823 0 0 /news/31stmar05.html 1 0 0 0 /news/wevegiveneverythingonthatfieldsayshernebayherobyronwalker 1 15550 0 0 /news/doverathletic2-0lewes 1 17811 0 0 /news/ksports050521 1 11034 0 0 /news/551a9798b7001 1 4639 0 0 /news/551bc5e916812 1 13873 0 0 /news/whyteleafe1-2folkestoneinvicta-myplayersputashirtonwithalotofpridesaysneilcugley 1 21318 0 0 /news/hythetown090519 2 27737 0 0 /news/wewanttogetthroughandgetoneofthosebigdrawsthateveryonedreamsaboutsaysjamieday 1 14166 0 0 /news/551a931d9d7f9 1 11647 0 0 /news/billericaytown1-1maidstoneunited-humepraiseshisyoungstars 1 15204 0 0 /news/johanterhorstwantstohelpusmaketheplay-offssaysfolkestonebossneilcugley 1 14260 0 0 /news/pearcetributes170717 1 13831 0 0 /news/551a979a598f6 1 4842 0 0 /news/colemandelightedwithhismovetomargate 1 13130 0 0 /news/fiskslamsdalersbossovertitletalk 1 15506 0 0 /news/kentleague/VCD/tunbridgewells071204.html 1 0 0 0 /news/greenwichboroughbossstevefirkinswantssupportfromthebromleyareatoincreasegates 1 22157 0 0 /news/favershamtown3-1doverathletic-peoplewillhavetowaitandseewhatsurpriseswehave-joynes 1 22928 0 0 /news/551bc99bddc9a 2 20395 0 0 /news/bedfordtown2-3maidstoneunited-itwasnotaclosegameitwasmorecomfortable-jaysaunders 1 18808 0 0 /news/sevenoakstown3-2doverathletic-wevegottheexperiencenowinsistsmoore-exclusive 1 18039 0 0 /news/hythe010117 6 46543 4 4 /news/crayvalley171122 3 36641 0 0 /news/vickersenticegillstooakwoodforprestigiousfriendly-exclusive 1 11746 0 0 /news/parkjohn070519 2 32199 0 0 /news/hythetown4-0eastbournetown-porterwerescoringgoalsforfun 1 28478 0 0 /news/beckenhamtown2-1greenwichborough 1 13003 0 0 /news/14thdec05.html 1 0 0 0 /news/summertransfernews 1 10821 0 0 /news/survivoreganattractsmediaattention-exclusive 1 10978 0 0 /news/wewantcompetitionforplacessaysnewmargatecoachsmith 1 13638 0 0 /news/weshouldbewinningathomeagainsthydesayswellingunitedbossjamieday 1 16168 0 0 /southern-counties-east-football-league/38 1 20361 0 0 /news/itsamagnificienttimetobeatbromleysaysneilsmith 1 15544 0 0 /news/wfinchley120305.html 1 0 0 0 /news/craybogn120122 6 143860 0 0 /news/NationalLeagueStatement010221 2 16429 0 0 END_SIDER

Cancel