PHP File Manager

Editing File: awstats042021.kentishfootball.co.uk.txt

AWSTATS DATA FILE 7.7 (build 20180105) # If you remove this file, all statistics for date 202104 will be lost/reset. # Last config file used to build this data file was /home/kentishfootball/tmp/awstats/awstats.kentishfootball.co.uk.conf. # Position (offset in bytes) in this file for beginning of each section for # direct I/O access. If you made changes somewhere in this file, you should # also remove completely the MAP section (AWStats will rewrite it at next # update). BEGIN_MAP 28 POS_GENERAL 2025 POS_TIME 2715 POS_VISITOR 95876 POS_DAY 270822 POS_DOMAIN 3880 POS_LOGIN 5390 POS_ROBOT 5545 POS_WORMS 7973 POS_EMAILSENDER 8104 POS_EMAILRECEIVER 8247 POS_SESSION 271859 POS_SIDER 272080 POS_FILETYPES 8382 POS_DOWNLOADS 9031 POS_OS 9589 POS_BROWSER 10092 POS_SCREENSIZE 16915 POS_UNKNOWNREFERER 16989 POS_UNKNOWNREFERERBROWSER 19700 POS_ORIGIN 21456 POS_SEREFERRALS 21613 POS_PAGEREFS 22075 POS_SEARCHWORDS 24922 POS_KEYWORDS 25093 POS_MISC 2376 POS_ERRORS 25173 POS_CLUSTER 5246 POS_SIDER_404 25350 END_MAP # LastLine = Date of last record processed - Last record line number in last log - Last record offset in last log - Last record signature value # FirstTime = Date of first visit for history file # LastTime = Date of last visit for history file # LastUpdate = Date of last update - Nb of parsed records - Nb of parsed old records - Nb of parsed new records - Nb of parsed corrupted - Nb of parsed dropped # TotalVisits = Number of visits # TotalUnique = Number of unique visitors # MonthHostsKnown = Number of hosts known # MonthHostsUnKnown = Number of hosts unknown BEGIN_GENERAL 8 LastLine 20210501000002 5298 1270755 16734747414997 FirstTime 20210401000133 LastTime 20210430234108 LastUpdate 20210501130139 5298 0 5297 0 0 TotalVisits 11548 TotalUnique 4174 MonthHostsKnown 0 MonthHostsUnknown 4404 END_GENERAL # Misc ID - Pages - Hits - Bandwidth BEGIN_MISC 10 JavaEnabled 0 0 0 TotalMisc 0 0 0 DirectorSupport 0 0 0 PDFSupport 0 0 0 WindowsMediaPlayerSupport 0 0 0 FlashSupport 0 0 0 QuickTimeSupport 0 0 0 RealPlayerSupport 0 0 0 JavascriptDisabled 0 0 0 AddToFavourites 0 2681 0 END_MISC # Hour - Pages - Hits - Bandwidth - Not viewed Pages - Not viewed Hits - Not viewed Bandwidth BEGIN_TIME 24 0 1765 2895 300568520 5685 6383 120119654 1 2003 2703 185586002 5785 6475 183017045 2 2028 2388 67333244 5994 6604 157435811 3 1754 1925 29634496 6649 7299 150854735 4 2420 2822 94484220 5803 6550 168394827 5 2188 2644 122491946 6404 7316 185056509 6 2899 4262 392484300 5797 6532 125860357 7 2966 5225 696069154 5590 6417 142943056 8 2385 5871 1110019971 5524 6475 113954049 9 2905 6690 1075102764 4801 5803 127310412 10 3073 6622 1072649121 5178 5997 148776549 11 3275 6824 1060742354 5859 6653 160563889 12 2908 7368 1351451423 5345 6203 141628608 13 1869 5795 1187015505 5149 6108 166594293 14 2004 6305 1325173011 5122 6068 117197797 15 2315 5794 1093547408 5646 6626 140375671 16 2209 7423 1477964912 5363 6402 107816990 17 2056 6461 1373632757 7897 8963 136754487 18 2805 8711 1799797599 13129 14218 188912590 19 3029 6489 1182536721 11803 12908 168281505 20 2378 6209 1244853730 7533 8569 110001395 21 3239 8040 1436701274 6557 7600 139177524 22 2943 7771 1334062627 6236 7235 140297461 23 1613 3494 598028110 6570 7415 122874685 END_TIME # Domain - Pages - Hits - Bandwidth # The 25 first Pages must be first (order not required for others) BEGIN_DOMAIN 83 us 35958 39836 567445541 gb 14893 80118 20309549687 ca 2394 2643 58136771 de 1581 1730 54424435 ua 757 784 6067343 ir 745 789 7061698 in 741 798 16527582 ru 459 583 33837705 cn 315 436 13029838 kr 134 241 22889063 il 118 495 101091152 th 109 109 758353 id 83 83 471586 fr 77 272 55230530 au 76 245 44979373 br 75 101 5547567 nl 60 298 94015809 ro 33 119 24835687 it 21 21 143046 ar 21 21 134144 pl 20 37 5128760 pt 19 73 19999145 ch 16 33 5036196 vn 16 16 121722 tr 15 15 119469 mu 2 2 7406 ph 13 59 24626834 ee 6 6 67378 ae 2 24 5106867 bo 2 2 12203 sc 12 12 63066 sg 1 21 4955663 gt 2 2 12203 co 13 13 108169 bz 2 2 6672 dk 4 4 24989 bg 4 23 4935969 hk 7 24 4974159 np 14 14 68672 za 5 5 40407 hr 5 5 38158 gh 2 2 12203 cz 9 32 5102552 vg 4 59 660868 kz 3 3 25253 cl 10 10 99662 es 7 61 14836331 am 1 1 12126 ec 3 3 24329 zz 10 10 86745 no 4 76 19685054 bd 5 5 36526 ie 8 102 39258941 eg 1 1 13314 tn 1 1 3278 al 2 2 12203 hu 5 6 4871760 sk 5 5 36532 md 3 3 19234 se 9 9 103213 mx 6 6 36603 pk 6 6 36609 rs 3 3 24329 ma 3 3 27570 lb 1 1 13324 ng 6 6 36609 at 11 28 5006425 be 2 19 4932740 nz 6 6 51055 tw 5 5 36532 pa 5 5 36532 fi 1 1 12126 ps 3 3 21972 ye 2 2 12203 cw 10 10 71384 sa 11 11 98740 ve 3 3 24329 qa 1 18 4924522 ge 2 2 12203 jp 5 8 220751 my 2 2 12203 eu 8 73 19700388 gr 5 5 50879 END_DOMAIN # Cluster ID - Pages - Hits - Bandwidth BEGIN_CLUSTER 0 END_CLUSTER # Login - Pages - Hits - Bandwidth - Last visit # The 10 first Pages must be first (order not required for others) BEGIN_LOGIN 0 END_LOGIN # Robot ID - Hits - Bandwidth - Last visit - Hits on robots.txt # The 25 first Hits must be first (order not required for others) BEGIN_ROBOT 57 crawl 35786 160810744 20210430213905 240 bingbot/ 32817 251141374 20210430235651 3402 SemrushBot/ 24410 112854123 20210430235858 940 MegaIndex\.ru/ 18728 80312414 20210403042638 1 bot[\s_+:,\.\;\/\\-] 10612 138625531 20210430235416 772 MJ12bot/ 7320 28882526 20210430213723 277 DotBot/ 5422 74056389 20210430234523 567 Googlebot/ 2604 50434778 20210430231120 49 AhrefsBot/ 2138 12030123 20210430234729 58 oBot/ 2045 5694782 20210430032414 872 BLEXBot/ 1973 9094339 20210430172508 60 Applebot/ 1600 8886669 20210430231634 29 no_user_agent 1495 2037420819 20210430233525 1 nbot 1041 4774423 20210430235956 7 (firefox/)([0-9]\.|[0-1][0]\.) 824 2855486 20210430193824 0 bingpreview 620 16246636 20210429222452 0 CFNetwork 579 19647252 20210430224950 0 baidu 462 105553678 20210429122720 1 unknown 377 8294 20210430234018 377 scanner 376 2388719 20210427172943 6 CCBot/ 280 1245121 20210421222804 7 robot 188 691399 20210427140943 4 Apache\-HttpClient/ 170 813039 20210428163743 0 java 124 1710383 20210405184618 0 facebookexternalhit/ 93 25372859 20210430071353 0 Yahoo![\x20]Slurp 19 200404 20210426052454 7 linkdexbot/ 39 137752 20210427133000 5 DuckDuckGo\-Favicons\-Bot/ 43 149261 20210430204709 0 YisouSpider 34 198847 20210430181952 4 Googlebot\-Image/ 47 10225581 20210428185252 0 semanticbot 24 87864 20210429174908 7 Mail\.RU_Bot/ 30 4141 20210427201251 29 LinkedInBot/ 5 737594 20210429061923 0 SafeDNSBot 2 3340 20210408114218 1 Dalvik/ 53 683729 20210429223222 0 MojeekBot/ 10 23718 20210430122255 5 Sogou[\x20]web[\x20]spider/ 2 4573 20210429114624 1 TweetmemeBot/ 57 307878 20210430154719 0 Wget/ 1 18112 20210418115716 0 SeznamBot/ 14 252972 20210429092313 6 spider 34 281644 20210430160214 11 YandexBot/ 24 31691 20210428023003 15 curl 14 36930 20210425143458 0 Baiduspider/ 24 107081 20210427172901 0 KomodiaBot/ 1 12803 20210407044949 0 GrapeshotCrawler/ 4 7165 20210419202011 2 YandexImages/ 1 29325 20210404225101 0 DomainStatsBot/ 54 14288 20210411054319 52 ng/1\. 18 2163930 20210429152510 0 link 39 149270 20210429180925 10 360Spider 22 75713 20210430130102 0 Mediatoolkitbot 80 466737 20210430104940 18 php 3 11699 20210414055510 0 perl 24 2035342 20210429174714 0 MixrankBot 1 3487 20210428150424 0 PhantomJS 10 54763 20210406144159 0 2345Explorer/ 5 16317 20210416111531 0 END_ROBOT # Worm ID - Hits - Bandwidth - Last visit # The 5 first Hits must be first (order not required for others) BEGIN_WORMS 0 END_WORMS # EMail - Hits - Bandwidth - Last visit # The 20 first Hits must be first (order not required for others) BEGIN_EMAILSENDER 0 END_EMAILSENDER # EMail - Hits - Bandwidth - Last visit # The 20 first hits must be first (order not required for others) BEGIN_EMAILRECEIVER 0 END_EMAILRECEIVER # Files type - Hits - Bandwidth - Bandwidth without compression - Bandwidth after compression BEGIN_FILETYPES 34 svg 2 159387 0 0 css 10912 82557590 0 0 scss 4 2518 0 0 md 7 162882 0 0 com 8 0 0 0 htm 12 207020 0 0 eot 2 53742 0 0 cgi 1 6959 0 0 net 2 0 0 0 uk 45 0 0 0 jpeg 10 421885 0 0 webp 1 67136 0 0 js 14120 74330138 0 0 woff2 1 30276 0 0 json 23 53925 0 0 jar 3 1905739 0 0 tv 1 0 0 0 xml 46 424971 0 0 txt 4 13031 0 0 html 13935 43802146 0 0 info 2 0 0 0 bmp 1 0 0 0 env 4 14236 0 0 gz 2 94438 0 0 db 17 2453504 0 0 mvc 1 2750 0 0 org 2 0 0 0 png 38152 21011449059 0 0 jnlp 1 1938 0 0 ttf 2 112228 0 0 Unknown 44880 247874260 0 0 woff 2 60804 0 0 php 30 131931 0 0 jpg 8496 145536676 0 0 END_FILETYPES # Downloads - Hits - Bandwidth BEGIN_DOWNLOADS 10 /assets/smartmenus/libs/demo-assets/readme.txt 2 0 316 /assets/qz-print/lib/pdf-renderer_qz.jar 2 0 3274906 /assets/datetimepicker/MIT-LICENSE.txt 2 0 1284 /sitemap/news.xml.gz 2 0 94438 /assets/qz-print/lib/jssc_qz.jar 2 0 313032 /assets/fileman/third-party.txt 2 0 188 /assets/fileman/LICENSE.txt 2 0 24274 /assets/qz-print/qz-print.jar 2 0 223540 /assets/ckeditor/plugins/a11yhelp/dialogs/lang/_translationstatus.txt 1 0 278 /assets/ckeditor/plugins/specialchar/dialogs/lang/_translationstatus.txt 1 0 260 END_DOWNLOADS # OS ID - Hits BEGIN_OS ID - Hits - Pages 28 unix 108 12 win8 68 38 winphone 89 33 macosx11 1060 775 winnt 1 1 win10 28251 8117 win7 5000 1450 bsdopenbsd 1 1 linuxcentos 1 1 linuxubuntu 19 19 macosx9 10 10 win8.1 3510 654 linuxgentoo 1 1 linuxfedora 1 1 winlong 1696 180 macosx6 2 2 macosx10 37 14 macosx8 1 1 Unknown 24855 24579 macosx5 1 1 macosx12 79 60 linux 2022 794 winvista 1 1 linuxandroid 12599 2788 winxp 186 38 macosx 21888 14831 ios_iphone 23350 3509 ios_ipad 5894 1118 END_OS # Browser ID - Hits - Pages BEGIN_BROWSER 309 chrome48.0.2564.116 21 1 chrome65.0.3325.146 3 3 chrome75.0.3770.142 1 1 icab 1 1 firefox40.0 1 1 chrome90.0.4430.66 769 127 firefox63.0 322 17 chrome72.0.3626.109 25 25 chrome57.0.2987.132 1 0 safari13.0.1 7 7 chrome41.0.2227.1 1 1 chrome83.0.4103.34 146 146 chrome89.0.4389.128 3976 909 chrome66.0.3359.181 6 6 chrome29.0.1547.2 2 2 firefox77.0 34 15 firefox19.0 2 2 chrome73.0.3683.86 12 6 netscape5.0 29 21 chrome90.0.4430.82 1622 267 opera53.0.2907.68 5 5 firefox54.0 2 2 chrome70.0.3538.102 332 31 chrome83.0.4096.0 58 58 safari13.5 1 1 safari14.0.3 24942 3735 chrome83.0.4103.24 86 86 safari12.1 15 15 chrome83.0.4103.106 2296 607 chrome79.0.3945.0 54 3 chrome86.0.4240.99 9 1 chrome56.0.2896.3 1 1 chrome36.0.1985.125 3 3 chrome83.0.4103.0 45 45 chrome89.0.4389.95 22 3 chrome71.0.3578.98 4 4 firefox87.0 3518 422 firefox47.0.1 1 1 chrome53.0.2785.101 2 2 chrome61.0.3163.100 1 1 safari14.4 44 6 chrome53.0.2785.104 2 2 chrome89.0.4389.90 1704 441 firefox68.0 30 30 mozilla 378 194 opera75.0.3969.171 27 1 opera52.0.2871.99 2 2 chrome48.0.2564.82 1 1 chrome41.0.2224.3 1 1 edge13 1 1 firefox33.0 3 3 chrome40.0.2214.93 1 1 chrome87.0.4280.66 43 43 opera66.0.3515.115 11 11 chrome42.0.2311.90 1 1 chrome80.0.3987.122 129 129 chrome56.0.2978.91 2 2 safari13.0.4 36 15 safari9.0 761 548 firefox84.0 65 65 firefox85.0 1 1 chrome79.0.3945.116 18 1 chrome83.0.4103.116 154 154 safari14.0 171 61 chrome30.0.3013.71 1 1 chrome77.0.3835.0 8 1 chrome63.0.3239.132 19 19 firefox57.0 2 2 chrome83.0.4102.0 53 53 safari7.0 45 7 chrome75.0.3770.100 36 36 chrome39.0.0.0 18 1 chrome83.0.4086.0 111 111 firefox74.0 89 89 firefox75.0 16 16 edge15 22 1 opera72.0.3815.400 24 24 chrome60.0.3112.113 122 122 chrome30.0.1599.17 1 1 chrome83.0.4098.0 65 65 firefox52.5.0 1 1 chrome88.0.4324.182 137 9 firefox38.0 1 0 chrome91.0.4469.0 8 1 chrome83.0.4099.2 63 63 firefox52.4.1 2 2 opera75.0.3969.149 2 0 firefox52.0.1 1 1 chrome45.0.2453.0 44 2 chrome70.0.3538.67 18 18 chrome5.0.375.99 2 2 chrome92.0.4475.0 22 1 chrome79.0.3945.79 1 1 safari13.0.5 287 78 msie7.0 18 6 safari10.1 21 21 chrome88.0.4324.155 62 9 chrome66.0.3359.130 2 2 chrome59.0.3071.125 34 12 iphone 101 7 chrome81.0.4044.138 98 30 safari14.0.1 368 79 opera75.0.3969.218 25 1 chrome88.0.4324.93 18 1 chrome67.0.3396.87 77 15 chrome79.0.3945.136 65 8 firefox56.0 11 11 chrome53.0.2785.116 3 3 chrome68.0.3440.25 2 2 firefox52.4.0 2 2 chrome89.0.4389.105 3943 933 chrome67.0.3396.99 7 7 chrome78.0.3904.97 4 4 firefox79.0 1 1 chrome80.0.3987.116 71 71 chrome53.0.2785.92 1 1 chrome80.0.3987.162 1 1 firefox89.0 670 44 safari13.0.3 17 17 opera72.0.3815.320 15 15 opera75.0.3969.243 2 0 opera55.0.2994.44 1 1 chrome78.0.3904.87 4 4 chrome52.0.2743.116 16 16 chrome27.0.1453.93 1 0 chrome89.0.4389.72 245 32 chrome88.0.4240.193 36 36 safari 1462 245 chrome46.0.2490.86 1 1 safari13.1.2 602 60 chrome35.0.1916.47 5 5 msie8.0 4 4 msie10.0 3 2 chrome87.0.4280.101 59 15 chrome76.0.3809.87 1 1 firefox60.0 335 34 chrome79.0 8 8 chrome91.0.4466.0 20 1 chrome83.0.4089.0 59 59 firefox41.0 2 2 firefox24.0 1 1 firefox86.0 1 1 opera62.0.3331.99 2 2 firefox62.0 1 1 chrome76.0.3809.132 6 6 chrome45.0.2454.94 1 1 chrome24.0.1312.27 1 0 chrome49.0.2623.75 55 55 chrome77.0.3865.116 57 4 chrome80.0.3987.106 14 14 netscape 1 1 chrome47.0.2526.111 1 1 firefox59.0 4 4 firefox48.0 4 4 chrome68.0.3423.2 3 3 chrome83.0.4087.0 51 51 chrome29.0.1547.0 1 1 chrome58.0.3029.81 11 11 chrome83.0.4103.101 17 1 chrome88.0.4324.152 157 89 firefox52.7.4 1 1 chrome79.0.3945.130 119 119 chrome80.0.3987.87 40 40 chrome81.0.4044.129 25 25 chrome88.0.4324.96 32 4 chrome49.0.2623.112 888 83 chrome88.0.4324.186 43 4 chrome87.0.4280.67 135 135 chrome78.0.3904.108 72 72 safari4.0.4 2 2 chrome41.0.2227.0 2 2 chrome85.0.4183.83 24 3 opera54.0.2952.54 3 3 firefox82.0 61 60 edge18 454 87 chrome73.0.3683.90 2 2 chrome87.0.4280.88 161 144 firefox47.0 3 3 chrome52.0.1500.95 2 2 safari13.1 388 53 chrome36.0.2512.87 1 1 chrome53.0.2785.89 2 2 chrome65.0.3325.183 2 2 firefox72.0 39 39 chrome85.0.4183.121 74 73 chrome79.0.3945.88 17 17 chrome84.0.4147.135 2 2 firefox66.0 1 1 chrome80.0.3987.132 217 198 msie11.0 2308 373 opera62.3.3146.57763 24 4 chrome86.0.4240.75 45 15 chrome89.0.4389.86 24 3 chrome89.0.4389.114 8885 2930 chrome80.0.3987.149 88 88 chrome54.0 20 20 opera53.0.2907.99 4 4 chrome83.0.4103.61 595 534 chrome90.0.4430.93 1145 218 chrome89.0.4389.130 19 1 chrome76.0.3809.100 23 23 chrome86.0.4240.193 7 7 safari14.2 19 1 chrome60.0.3112.107 1 1 safari10.0 1433 317 chrome54.0.2840.99 1 0 chrome85.0.4183.102 2 2 chrome92.0.4480.0 22 1 firefox11.0 7 0 firefox52.0 570 545 chrome53.0.2785.143 17 17 opera54.0.2952.64 9 9 safari13.1.3 33 3 chrome11.0.696.68 1 1 msie6.0 2 2 chrome56.0.2960.59 1 1 opera69.0.3686.7 45 45 firefox44.0 1 1 firefox45.0 5 0 firefox50.0 2 2 chrome44.0.2403.157 22 1 chrome83.0.4100.3 55 55 chrome86.0.4240.111 12763 12763 chrome60.0.3112.90 2 2 chrome90.0.4430.72 1361 315 safari12.1.2 5918 665 chrome62.0.3202.84 78 6 firefox50.0.2 1 1 chrome58.0.3029.96 15 15 edge17 433 32 chrome86.0.4240.183 60 43 chrome90.0.4420.0 5 1 chrome90.0.4430.91 183 44 msie9.0 2036 256 chrome46.0.2490.80 1 0 chrome57.0.2987.108 1 0 lynx 10 10 chrome39.0.2171.95 5 5 chrome84.0.4147.105 29 9 chrome30.0.0.0 20 2 chrome41.0.2226.0 1 1 firefox49.0 23 14 safari14.1 79 23 safari8.0 1 1 opera67.0.3575.79 11 11 chrome26.0.1410.65 1 1 firefox65.0 2 2 firefox51.0 4 4 safari5.1 2 2 chrome63.0.3239.0 40 0 chrome88.0.4324.190 18 1 edge12 43 5 chrome72.0.3626.121 2 2 chrome35.0.2309.372 1 1 chrome75.0.3770.90 200 9 chrome55.0.2883.87 1 1 chrome74.0.3729.169 25 25 chrome62.0.3202.94 31 31 opera54.0.2952.71 4 4 chrome66.0.3359.117 2 2 firefox53.0 36 36 firefox40.1 25 25 chrome57.0.2987.133 96 96 safari11.1.2 22 1 chrome87.0.4280.141 1508 318 chrome78.0.3904.70 15 1 chrome83.0.4093.3 127 127 chrome74.0.3729.157 1 1 chrome50.0.2661.102 18 18 chrome75.0.3770.143 16 2 msie11 2 2 safari10.3.3.3216 114 93 chrome67.0.3396.79 48 48 firefox73.0 110 110 chrome79.0.3945.117 461 0 chrome35.0.2117.157 1 1 chrome83.0.4103.14 53 53 chrome83.0.4103.44 30 30 firefox88.0 2785 266 chrome85.0.4183.81 130 31 chrome41.0.2225.0 3 3 chrome37.0.2049.0 1 1 safari13.1.1 363 51 chrome86.0.4240.198 136 136 chrome90.0.4430.85 3614 674 chrome89.0.4389.82 74 13 safari11.0 194 30 chrome88.0.4324.181 976 228 chrome41.0.2228.0 17 1 safari9.0.2 1 1 safari12.0 24 5 firefox46.0 3 3 opera66.0.3515.103 12 12 chrome88.0.4324.150 249 76 chrome36.0.1985.67 1 1 chrome89.0.4389.116 21 1 firefox81.0 22 22 opera67.0.3575.53 17 17 opera74.0.3911.218 3 0 firefox35.0 1 1 chrome83.0.4103.97 32 32 firefox78.0 583 143 opera75.0.3969.93 1 0 firefox52.7.0 2 2 chrome68.0.3440.106 14 14 Unknown 24331 24267 firefox83.0 113 113 chrome78.0.3904.62 44 10 safari14.0.2 545 95 END_BROWSER # Screen size - Hits BEGIN_SCREENSIZE 0 END_SCREENSIZE # Unknown referer OS - Last visit date BEGIN_UNKNOWNREFERER 50 WordPress/4.9.17;_http://opal3.shinraebc.com 20210421105204 Anthill 20210412192925 Mozilla/5.0_(compatible;_Domains_Project/1.3.2;__https://domainsproject.org) 20210424212611 https://www.nominet.uk/privacy-notice 20210408163125 Go_http_package 20210424051641 Mozilla/5.0_(compatible;_Yeti/1.1;__http://naver.me/spd) 20210430171617 akka-http/10.2.1 20210402180546 python-requests/2.18.1 20210424110939 Grammarly/1.0_(http://www.grammarly.com) 20210415224412 Mozilla/5.0_(iodc;_odysseus_2085-134-010421044040-085;__https://iodc.co.uk) 20210401044930 WordPress/5.7.1;_https://www.brixtonbuzz.com 20210425132721 Mozilla/5.0_(compatible;_seolyt/1.1;__https://seolyt.com) 20210416230428 Mozilla/5.0_(BB10;_Touch)_AppleWebKit/537.35__(KHTML,_like_Gecko)_Version/10.3.3.3216_Mobile_Safari/537.35_ 20210430165033 Photon/1.0 20210429101838 AHC/2.1 20210420015340 Request-Promise 20210427081320 cortex/1.0 20210427082546 omgili/0.5__http://omgili.com 20210429224119 SEMrushBot 20210423041857 Ruby 20210419030900 OnalyticaBot 20210425132005 python-requests/2.20.0 20210425204354 Go-http-client/1.1 20210429181244 Mozilla/5.0 20210430074350 IDBTE4M_CODE87 20210401190658 python-requests/2.22.0 20210415140829 XenForo/2.x_(https://nonleaguematters.co.uk/forums) 20210425175301 dBpoweramp 20210427020758 WordPress/4.9.16;_http://opal5.shinraebc.com 20210406085023 User-Agent\ 20210430115353 Mozilla/4.0_(compatible;) 20210430103814 okhttp/4.9.1 20210429174658 Mozilla/5.0_(compatible) 20210422181241 XenForo/2.x_(https://www.thefootballforum.net) 20210426075401 whisper/8.30.2_(sh.whisper.whisperapp;_build:1;_iOS_12.5.2)_Alamofire/4.7.3 20210410215023 Mozilla/5.0_(compatible;_Dataprovider.com) 20210430161132 The_Knowledge_AI 20210429002528 Lynx/2.9.0dev.5_libwww-FM/2.14_SSL-MM/1.4.1_GNUTLS/3.6.13 20210406131410 Scoop.it 20210424101202 WhatsApp/2.21.7.14_A 20210426103437 Mozilla/5.0_Firefox/35.0 20210408051041 Mozilla/5.0_(compatible;_Daum/4.1;__http://cs.daum.net/faq/15/4118.html?faqId=28966) 20210430234108 WhatsApp/2.21.6.17_A 20210424233058 adreview/1.0 20210426051126 Mozilla/5.0_(iodc;_odysseus_31697-135-030421172243-197;__https://iodc.co.uk) 20210403172308 Scrapy/2.4.1_(_https://scrapy.org) 20210410113454 YahooCacheSystem;_YahooWebServiceClient 20210408052710 python-requests/2.25.1 20210430061546 python-requests/2.24.0 20210428135050 Expanse,_a_Palo_Alto_Networks_company,_searches_across_the_global_IPv4_space_multiple_times_per_day_to_identify_customers'_presences_on_the_Internet._If_you_would_like_to_be_excluded_from_our_scans,_please_send_IP_addresses/domains_to:_scaninfo@paloaltonetworks.com 20210430181037 END_UNKNOWNREFERER # Unknown referer Browser - Last visit date BEGIN_UNKNOWNREFERERBROWSER 36 WordPress/4.9.17;_http://opal3.shinraebc.com 20210421105204 Anthill 20210412192925 Go-http-client/1.1 20210429181244 https://www.nominet.uk/privacy-notice 20210408163125 IDBTE4M_CODE87 20210401190658 Go_http_package 20210424051641 python-requests/2.22.0 20210415140829 XenForo/2.x_(https://nonleaguematters.co.uk/forums) 20210425175301 dBpoweramp 20210427020758 akka-http/10.2.1 20210402180546 Grammarly/1.0_(http://www.grammarly.com) 20210415224412 WordPress/4.9.16;_http://opal5.shinraebc.com 20210406085023 python-requests/2.18.1 20210424110939 User-Agent\ 20210430115353 okhttp/4.9.1 20210429174658 WordPress/5.7.1;_https://www.brixtonbuzz.com 20210425132721 whisper/8.30.2_(sh.whisper.whisperapp;_build:1;_iOS_12.5.2)_Alamofire/4.7.3 20210410215023 XenForo/2.x_(https://www.thefootballforum.net) 20210426075401 WhatsApp/2.21.7.14_A 20210426103437 The_Knowledge_AI 20210429002528 Scoop.it 20210424101202 Photon/1.0 20210429101838 AHC/2.1 20210420015340 cortex/1.0 20210427082546 adreview/1.0 20210426051126 Request-Promise 20210427081320 WhatsApp/2.21.6.17_A 20210424233058 SEMrushBot 20210423041857 omgili/0.5__http://omgili.com 20210429224119 Scrapy/2.4.1_(_https://scrapy.org) 20210410113454 Ruby 20210419030900 python-requests/2.20.0 20210425204354 YahooCacheSystem;_YahooWebServiceClient 20210408052710 Expanse,_a_Palo_Alto_Networks_company,_searches_across_the_global_IPv4_space_multiple_times_per_day_to_identify_customers'_presences_on_the_Internet._If_you_would_like_to_be_excluded_from_our_scans,_please_send_IP_addresses/domains_to:_scaninfo@paloaltonetworks.com 20210430181037 python-requests/2.24.0 20210428135050 python-requests/2.25.1 20210430061546 END_UNKNOWNREFERERBROWSER # Origin - Pages - Hits BEGIN_ORIGIN 6 From0 48617 49532 From1 1 1 From2 1806 1810 From3 1866 1876 From4 6739 77512 From5 0 0 END_ORIGIN # Search engine referers ID - Pages - Hits BEGIN_SEREFERRALS 16 aoluk 4 4 www_google_pl 1 1 r_search_yahoo_com 11 11 images_search_yahoo_com 0 1 www_google_ca 1 1 www_google_de 2 2 www_google_com 1458 1461 ecosia 2 2 www_google_nl 1 1 search_yahoo_com 2 2 duckduckgo 14 14 bing 140 140 www_google_co_uk 115 115 www_google_com_hk 2 2 www_google_com_au 2 2 uk_search_yahoo_com 51 51 END_SEREFERRALS # External page referers - Pages - Hits # The 25 first Pages must be first (order not required for others) BEGIN_PAGEREFS 82 https://t.co/2YashzUiFQ 215 215 https://t.co 183 183 https://t.co/gc10z3fWsT 153 153 https://t.co/u2VEDXk0SI 151 151 https://t.co/mAxHOxpase 142 142 https://t.co/aGKtx8NDGX 119 119 https://t.co/2vOZwkqXmu 95 95 https://t.co/1CFcl7ttxy 94 94 https://t.co/6ZbyrHFv78 92 92 https://t.co/DGNpJliyG6 86 86 https://t.co/wPmXLsVKQX 85 85 http://www.folkestoneinvictafc.co.uk/league-sites 60 60 https://t.co/lYABaxIw5N 51 51 https://t.co/ur3siKqcho 50 50 https://t.co/lZ9equTinW 42 42 https://t.co/t5wkKd4IJn 30 30 https://t.co/VHc8I0VnJp 29 29 https://t.co/Ju3HIESFfH 23 23 https://t.co/OkFywkexdD 16 16 https://t.co/usRIiTuNN8 16 16 https://t.co/dAtRXb4TyV 13 13 http://m.facebook.com 9 9 https://m.facebook.com 9 9 https://t.co/PRCCBPC8N4 6 6 https://t.co/8zHwpNJFXh 6 6 https://t.co/uEg3AiG19X 1 1 https://t.co/fgz5p8vvYq 1 1 https://t.co/VGRzVn1xmT 1 1 https://t.co/hsRN4g7DCQ 1 1 https://t.co/VocPNRCmcv 1 1 https://t.co/nZHQcc8NBk 1 1 https://t.co/C1jO97Dixr 2 2 http://www.thedarts.eu 2 2 https://t.co/HBDPsr6RdB 1 1 http://161.35.224.71 2 2 https://t.co/wfOJoBZkTt 1 1 https://t.co/uioUfjBK4K 4 4 https://t.co/Fo6ePxqHq0 3 3 http://www.rightrelevance.com 0 5 https://t.co/xzLx4jD340 2 2 https://54-PANASONIC.RU 1 1 https://mydreamdl.me/au-nom-de-ma-fille-2016-576p-brrip-x265-din-154979-magnet 1 1 https://t.co/QczEC2CYvc 3 3 http://ldud.boyddoherty.top/blog/23053293/view/ 0 1 https://LENOVO-REMONT52.RU 1 1 https://t.co/LC0ZA9CYnx 1 1 http://rhvmp.apttrace.com/post/23053293/view/ 0 1 https://t.co/S0b5zQ1Hjb 1 1 https://t.co/Ud8I60qTOh 3 3 https://t.co/KpU4GIyfFV 2 2 http://erkiss.site 1 1 https://t.co/Rt8VhBJ6NJ 1 1 http://thedarts.eu 3 3 https://yarkonveer.ru 2 2 https://en.wikipedia.org 3 3 http://www.webwiki.co.uk/www.kentishfootball.co.uk 2 2 https://en.m.wikipedia.org 2 2 https://t.co/jvRcyVmygP 4 4 http://www.folkestoneinvictafc.co.uk 3 3 https://t.co/2NFkXixjjd 3 3 https://t.co/yovzIuZhxq 2 2 http://www.primoblog.xyz 1 1 http://www.yasni.co.uk/darren+paul+piggott/check+people 0 2 https://t.co/ACJDivlnnz 1 1 https://l.facebook.com 1 1 https://t.co/BojH2eB7yq 4 4 https://t.co/nsMgzkSn2h 1 1 http://213.175.211.17:80 2 2 http://rhvmp.apttrace.com 1 1 http://www.tunbridgewellsfc.com 1 1 https://mydreamdl.me/easeus-partition-master-12-00-pro-edition-key-cracksnow-472163-magnet 1 1 http://ldud.boyddoherty.top 1 1 https://t.co/SL1x8kv3Km 1 1 https://t.co 2 2 https://t.co/EvRKPBhvKx 1 1 https://t.co/gH0lraPcOU 5 5 https://mydreamdl.me/mp3-new-releases-37 1 1 http://www.tunbridgewellsfc.com/node/518 2 2 http://www.primoblog.xyz/blog/23053293/view/ 0 1 https://t.co/od9auNkdko 1 1 https://t.co/T1Bn2Mjr1Q 1 1 https://mydreamdl.me/empire-earth-art-of-supremacy-spolszczenie 1 1 END_PAGEREFS # Search keyphrases - Number of search # The 10 first number of search must be first (order not required for others) BEGIN_SEARCHWORDS 1 kentish+football 5 END_SEARCHWORDS # Search keywords - Number of search # The 25 first number of search must be first (order not required for others) BEGIN_KEYWORDS 2 kentish 5 football 5 END_KEYWORDS # Errors - Hits - Bandwidth BEGIN_ERRORS 7 400 101 1004950 206 250 278123314 500 3 7059 307 2 0 404 11128 9343674 508 61 17568 301 9646 2598666 END_ERRORS # URL with 404 errors - Hits - Last URL referrer BEGIN_SIDER_404 1725 /content/common/js/index.php 1 - /kentleague/sladegreen/2ndoct05.html 1 - /mambo/images/stories/paul%20doswell%20lashes%20out%20at%20anthony%20storey.jpg 4 - /Public/Mobile/ecshe_css/wapmain.css 1 - /mambo/index.php-option=com_content&task=view&id=2199&Itemid=38 1 - /sittingbourne/dartvsitt160304.html 4 - /base/.env 1 - /wap/trading/get_newallorder_ajax 1 - /kentleague/ramsgate/bromley230705.html 4 - /wines/263/fabiano-amarone-della-valpolicella-2009 1 - /post-sitemap.xml 2 https://www.google.com/ /sevenoaks/ramsgate050205.html 5 - /test/wp-includes/wlwmanifest.xml 37 - /assets/admin/plugins/plupload/examples/upload.php 1 http://www.google.com/ /sittingbourne/24thmar05.html 7 - /assets/uploads/content/Greenwich_Borough_Kent_Senior_Tr.jpg 1 - /library/.env 1 - /wp-config.php.swo 1 https://www.google.com/search /../ryman/bromley/cray090405.html 2 - /wines/71/laurent-miquel-cinsault-syrah-ros-2013 2 - /app-ads.txt 1 - /erithtown/vcd090405.html 7 - /kentleague/cray/folkestone061104.html 7 - /kentleague/sladegreen/sladevlord170104.html 1 - /sevenoaks/thamesmead181204.html 8 - /ramsgate/greenwich020405.html 5 - /wines/57/domaine-langlois-chateau-2012-rouge 1 - /assets/uploads/content/Glebe_Chislehurst_Ground.jpg 1 - /css/view/main/style.css 1 - /../ryman/bromley/cray130805.html 2 - /new/xmlrpc.php 1 - /sittingbourne/erithandbelvedere080105.html 4 - /data/cache/index.htm 1 - /assets/uploads/content/Fixture_Board_Christmas_2017.png 1 - /kentleague/sladegreen/bowey301sevenoaks250105.html 1 - /wines/119/franschhoek-cellar-la-cotte-mill-chenin-blanc-2014 1 - /cray/crayvmaid100504.html 6 - /new-site/ 1 - /kentleague/thamesmead/12thjuly05.html 1 - /kentleague/deal/26thsept04.html 1 - /opensearch.xml 2 - /kentleague/ramsgate/25thjan04.html 2 - /tunbridgewells/sladegreen041005.html 7 - /wines/268/templars-hill-pinot-noir-2012 2 - /ryman/bromley/bromvashfordfac160903.html 3 - /wines/46/les-hauts-du-village-rasteau-2009 2 - /wines/96/emiliana-cabernet-sauvignon-2013 2 - /plugins/elfinder/connectors/php/connector.php 1 http://www.google.com/ /_controls/responsive/Telerik.Web.UI.DialogHandler.aspx 2 - /kentleague/hernebay/hernevafcwimfav181003.html 1 - /folkestone/folkvdart130304.html 5 - /wines/282/sacred-london-dry-vodka-70cl 3 - /../ryman/bromley/margate200905.html 2 - /ramsgate/ramsvlords270903.html 6 - /kentleague/cray/greenwichvcray060903.html 1 - /othernews/FIXJanuary2006.html 1 - /csjs/bankCheck.js 2 - /DesktopModules/Rad%20EditorProvider/DialogHandler.aspx 1 - /rss.xml 3 - /wines/288/beni-di-batasiolo-grappa-di-moscato-70cl 2 - /../../kentleague/maidstone/5thnov04.html 3 - /mambots/editors/fckeditor/editor/filemanager/upload/php/upload.php 1 - /kentleague/deal/Sampson10.html 1 - /kentleague/cray/AFCWimbeldon041204.html 1 - /includes/fckeditor/editor/filemanager/browser/default/connectors/php/connector.php 1 - /kentleague/deal/1stjuly03.html 1 - /kentleague/lordswood/erith&amp 1 - /sittingbourne/dartford240804.html 6 - /sevenoaks/11thfeb05.html 8 - /conference/gravesend/7thmar05.html 12 - /wines/213/philip-shaws-the-idiot-shiraz-2011 3 - /kentleague/sladegreen/vcd110904.html 1 - /wp%E2%80%94admin/admin%E2%80%94ajax.php 1 https://www.google.com/search /kentleague/lordswood/lordsvcray251003.html 1 - /conference/margate/12thjuly04.html 3 - /wines/281/terre-di-montelusa-primitivo-2013 2 - /editor/filemanager/browser/default/connectors/php/connector.php 1 - /includes/fckeditor/editor/filemanager/upload/php/upload.php 1 - /wp-config.php.6 1 https://www.google.com/search /apple-touch-icon-120x120-precomposed.png 351 - /kentleague/hythe/folkestone300705.html 4 - /post-sitemap.xml.gz 2 https://www.google.com/ /kentleague/tunbridgewells/27thmar05.html 1 - /common/admin/Calendar/Telerik.Web.UI.DialogHandler.aspx 2 - /ryman/bromley/fisherfacupreplay210904.html 3 - /hashtag/1908Challenge 2 - /wp-config-sample.php 1 https://www.google.com/search /wp/wp-admin/ 2 http://kentishfootball.co.uk/ /KentishFootie/lists 2 - /room/1002 2 - /assets/uploads/content/Adam_Flanagan_Brentwood.png 1 http://kentishfootball.co.uk/news/thambren030215 /hashtag/FisherFC 2 - /thamesmead/cray070804.html 5 - /apple-touch-icon-precomposed.png 309 - /wp-config.php.swn 1 https://www.google.com/search /../../kentleague/ramsgate/tonbridge290805.html 3 - /sladegreen/dealvslade030404.html 7 - /wines/204/campbells-rutherglen-topaque-half-bottle 1 - /wp-license.php 1 https://www.google.com/search /VCD/27thfeb04.html 8 - /kentleague/sladegreen/thamesmead161004.html 1 - /assets/uploads/content/Adrian_Stone_Sevenoaks_v_Seven_A.jpg 3 - /lordswood/lordswoodvvcd160803.html 7 - /beckenham/hythe020405.html 7 - /ryman/bromley/fisheru18vbromu18070304.html 8 - /content.html 3 - /css/dafa.css 2 - /FisherFC/status/605453637880561666 2 - /sladegreen/hythe030905.html 6 - /kentleague/maidstone/21stjan05.html 1 - /kentleague/maidstone/24thfeb04.html 4 - /wines/159/burlesque-zinfandel-2012 2 - /beckenham/vcd050305.html 7 - /wines/237/chateau-haut-bernasse-monbazillac-2003-50cl-bottle 1 - /wines/180/brunello-di-montalcino-2009-castello-romitorio 2 - /apple-touch-icon-152x152.png 400 - /mambo/images/banners/Gilmoresupport.jpg 1 - /kentleague/deal/dealvcrayfav181003.html 1 - /api/currency/quotation_new 1 - /skin/default/js/tabs.js 1 - /template/920ka/css/lsy.css 1 - /hythe/7thnov04.html 9 - /erithtown/4thjune05.html 5 - /editor/editor/filemanager/connectors/php/connector.php 1 - /backup/wp-admin/ 1 http://kentishfootball.co.uk/ /ramsgate/24thjune05.html 7 - /kentleague/VCD/19thaug04.html 1 - /2018/wp-includes/wlwmanifest.xml 22 - /lordswood/erith050205.html 7 - /static/css/index.css 1 - /style.css 1 - /Recruit/download_url 2 - /tonbridge/7thsept04.html 9 - /kentleague/tunbridgewells/sladegreen041005.html 1 - /wines/86/brouilly-2013-vieilles-vignes-domaine-dubost 2 - /mambo/images/stories/paul 1 - /wp-config.php~ 1 https://www.google.com/search /lordswood/lordvbeng130304.html 7 - /ryman/bromley/10thjuly03.html 3 - /sittingbourne/sittvchat261203.html 6 - /index.php/Index/register.html 1 - /2015/wp-includes/wlwmanifest.xml 7 - /conference/gravesend/14thnov05G.html 1 - /rotherhithetour 2 - /mambo/index.php-option=com_content&task=view&id=1332&Itemid=38 5 - /wines/106/tabali-reserva-sauvignon-blanc-2013 2 - /My%20Pictures/Danny%20Harwood%20pic.jpg 3 - /public/web/js/add/com.js 2 - /database/.env 1 - /kentleague/greenwich/7thjuly03.html 1 - /kentleague/sladegreen/thamesmead261105.html 1 - /mambo/mambots// 1 - /kentleague/maidstone/23rdsept05.html 1 - /mambo/index.php-option=com_content&task=view&id=5965&Itemid=38 2 - /kentleague/erithtown/10thsept04.html 1 - /wines/203/cranswick-sarus-shiraz-2010 2 - /data/admin/allowurl.txt 14 - /fisher/fishvfolk201203.html 5 - /kentleague/sladegreen/lordswood021004.html 1 - /wines/3/mont-rocher-viognier-2013 2 - /assets/select2/docs/_includes/community.html 1 - /wines/143/vina-pomal-crianza-2011 1 - /homes/ 2 - /../../ryman/bromley/bromvashfordfac160903.html 2 - /app/.env 1 - /wines/53/chateau-du-coing-de-st-fiace-muscadet-sur-lie-2011 1 - /editor/editor/filemanager/browser/default/connectors/php/connector.php 1 - /kentleague/thamesmead/18thnov04.html 1 - /kentleague/hythe/30thsept05.html 1 - /assets/plugins/plupload/examples/upload.php 1 http://www.google.com/ /folkestone/folkve&amp 1 - /sittingbourne/dartford240905.html 6 - /wines/87/maison-de-vigneron-pays-du-vaucluse-rouge-2013 1 - /TrevorWAllman 2 - /stephen@kentishfootball.co.uk 17 - /kentleague/beckenham/4thdec05.html 1 - /m/ticker/usdtqc 1 - /wines/273/monteagrelo-bressia-malbec-2011 2 - /wines/136/the-pavillion-shiraz-cabernet-2013 1 - /wines/64/antech-cremant-de-limoux-emotion-ros-2012 3 - /wines/92/chateau-trillol-2008 1 - /kentleague/tunbridgewells/grays210705.html 1 - /wines/147/ramon-bilbao-crianza-2011 1 - /myConfig.js 1 - /web/api/getBanner 2 - /sittingbourne/dartford201104.html 5 - /apple-touch-icon-120x120.png 350 - /kentleague/maidstone/23thjan04.html 2 - /conference/margate/25thnov05.html 1 - /kentleague/VCD/27thfeb04.html 1 - /../../kentleague/sladegreen/19thsept05.html 2 - /kentleague/lordswood/7thjuly03.html 1 - /web/xmlrpc.php 1 - /othernews/crayvalley050205.html 1 - /sladegreen/vcd110904.html 9 - /xianyu/index/setp1.html 2 - /kentleague/sladegreen/14thjan04.html 7 - /assets/global/plugins/plupload/examples/upload.php 1 http://www.google.com/ /../../ryman/bromley/ashford151105.html 2 - /conference/gravesend/26thjan05.html 5 - /assets/plugins/jQuery-File-Upload/server/php/index.php 1 http://www.google.com/ /kentleague/thamesmead/3rdaug04.html 1 - /ramsgate/whitstable041204.html 9 - /assets/uploads/content/Fixture_Board_7_11_November_2017.png 1 - /site/ 1 - /ashford/folkestone110805.html 7 - /../../kentleague/whitstable/5thsept05.html 2 - /cray/crayvtunw310304.html 4 - /vendor/.env 3 - /static/common/js/common.js 1 - /wines/174/fertuna-lodai-2008 3 - /wines/114/the-crossings-marlborough-pinot-noir-2013 2 - /premier/dover/tonbridge301004.html 3 - /api/site/getPayInfo.do 1 - /tunbridgewells/4thfeb05.html 7 - /kentleague/ramsgate/24thjune05.html 3 - /wines/184/conviviale-montepulciano-dabruzzo-2012 1 - /wines/228/chateau-cluzan-grand-vin-de-bordeaux-2010-150cl 2 - /images/login/logo.gif 1 - /wines/181/nuovo-quadro-la-battistina-gavi-di-gavi-2013 2 - /kentleague/maidstone/31stmay05.html 1 - /kentleague/whitstable/5thsept05.html 3 - /sladegreen/erith050305.html 5 - /maidstone/maidvwhit170204.html 6 - /old/ 1 - /assets/uploads/content/Whitstable_Town_chairman_Gary_Jo.png 1 - /kentleague/lordswood/lordsvgreen280204.html 1 - /wines/144/vina-pomal-reserva-rioja-2009 1 - /section/google-news-sitemap 2 https://www.google.com/ /tncms/sitemap/news.xml 2 https://www.google.com/ /tos 2 - /premier/welling/dartford091104.html 4 - /wines/82/domaine-de-la-pellehaut-ampelomeryx-2012 1 - /blog.php 1 - /kentleague/sladegreen/thamesmead300805.html 1 - /kentleague/sladegreen/didcotvsladefac060903.html 1 - /sladegreen/beckvslad070204.html 7 - /wines/216/geoff-merrill-cilento-sangiovese-2010 1 - /wines/167/miopasso-primitivo-2013 1 - /wines/173/miopasso-fiano-2012 1 - /kentleague/hythe/13thnov05.html 1 - /sladegreen/maidstone140804.html 5 - /DunningDay19.aspx 1 - /beckenham/KSTSF030305.html 6 - /kentleague/deal/Sampson12.html 1 - /old/.env 1 - /lordswood/erithtown130805.html 7 - /erithtown/1stdec05.html 8 - /sites/all/libraries/mailchimp/.env 1 - /ryman/bromley/21stnov05.html 3 - /lordswood/dealvlord230304.html 5 - /kentleague/maidstone/2ndaug05.html 1 - /wp-config.php.2 1 https://www.google.com/search /kentleague/maidstone/maidvlord271203.html 1 - /template/css/login.css 1 - /lordswood/lordvramsfav181003.html 6 - /kentleague/deal/Sampson6.html 1 - /premier/dover/22jan04.html 3 - /assets/uploads/content/Bearsted_2014_15_team_pic.jpg 1 - /js/dianzan.js 1 - /beckenham/3rdjune05.html 4 - /temp/ 1 - /sevenoaks/hernebay201104.html 7 - /wines/83/maison-de-vigneron-pays-des-cotes-de-gascogne-sec-white-2013 3 - /beckenham/deal050205.html 7 - /Public/home/js/check.js 1 - /folkestone/tonbridge060805.html 7 - /templates/default/js/loadimage.js 2 http://www.kentishfootball.co.uk//templates/default/js/loadimage.js /erithtown/10thsept04.html 5 - /include/data/vdcode.jpg 1 - /section/feed 1 https://www.google.com/ /Templates/user/js/global.js 1 - /conference/gravesend/bstortford120305.html 1 - /sevenoaks/erith150105.html 5 - /assets/backend/plugins/plupload/examples/upload.php 1 http://www.google.com/ /mambo/index.php-option=com_content&task=view&id=9980&Itemid=38 1 - /KentishFootie 2 - /public/assets/global/plugins/plupload/examples/upload.php 1 http://www.google.com/ /laravel/.env 2 - /assets/uploads/content/Fisher_Squad_Pic_April_2015.jpg 2 - /sladegreen/sladevcray100204.html 3 - /Public/css/_pk10.css 1 - /wines/139/raimat-abadia-cabernet-sauvignon-tempranillo-2010 3 - /ashford/ashfvfolk270104.html 5 - /kentleague/cray/kingstonian100905.html 1 - /kentleague/lordswood/erith&belvedere031205.html 2 - /s_api/basic/config_js 2 - /class-wp-defaults.php 1 - /wines/28/puligny-montrachet-2011-jean-louis-chavy 1 - /wines/4/le-paradou-grenache-2012 1 - /kentleague/sladegreen/8thaug04.html 1 - /whitstable/30thnov05.html 8 - /wp-config.php.5 1 https://www.google.com/search /Public/home/js/fukuang.js 1 - /sladegreen/thamesmead120205.html 9 - /wines/171/miopasso-nero-davola-2012 2 - /VCD/22ndsept05.html 8 - /fckeditor/editor/filemanager/connectors/php/connector.php 1 - /dartford/28thapr04.html 5 - /phpmyadmin/themes/original/img/logo_right.png 1 - /ryman/bromley/metpolice030504.html 3 - /lordswood/vcd260305.html 6 - /wines/2/chateau-pineraie-cahors-2010 3 - /phpmyadmin/docs.css 1 - /assets/uploads/content/Hollands_Blair_Kent_Senior_Tro.jpg 2 - /wines/262/fertuna-pactio-2011 1 - /kentleague/sladegreen/ashford270805.html 5 - /anquan/qgga.asp 1 - /assets/uploads/content/Chris_Hollyoak_Rusthall.jpg 1 - /files/pub_reset.css 1 - /sittingbourne/ashford091104.html 6 - /public/h5static/js/main.js 1 - /assets/uploads/content/Folkestone_Invicta_squad_pic_201.jpg 1 - /wines/266/westwell-barrel-ferment-2013 1 - /apple-touch-icon-76x76.png 1 - /cgi-bin/.env 1 - /test_404_page/ 1 - /sevenoaks/erithtown261004.html 9 - /ryman/bromley/erithtown160705.html 5 - /fckeditor.js 1 - /kentleague/lordswood/29thnov04.html 1 - /../premier/dover/9thnov05.html 2 - /Adminer.php 2 - /sittingbourne/14thoct05.html 5 - /wordpress/wp-login.php 11 - /ramsgate/erith070205.html 9 - /static/data/configjs.js 1 - /asset/plugins/elfinder/connectors/php/connector.php 1 http://www.google.com/ /whiteboy1234 2 - /kentleague/sladegreen/sladegreen.html 1 - /conference/margate/19thoct05.html 1 - /wines/146/ramon-bilbao-ros-2013 2 - /kentleague/hernebay/20thjan05.html 1 - /blog/ 1 - /kentleague/beckenham/20thjuly03.html 1 - /DesktopModules/dnnWerk.RadEditorProvider/DialogHandler.aspx 2 - /../../kentleague/maidstone/24thfeb04.html 2 - /apple-touch-icon-76x76-precomposed.png 1 - /kentleague/deal/dealtown250904.html 2 - /beckenham/greenwich090205.html 5 - /kentleague/deal/Martin1.html 1 - /beckenham/hernebay231004.html 6 - /wines/54/domaine-les-grands-presbyteres-2013-muscadet-sevre-maine-sur-lie 2 - /kentleague/VCD/20thjuly03.html 1 - /kentleague/maidstone/16thsept05.html 1 - /wines/278/mas-fleurey-cotes-de-provence-ros-2013 2 - /2018/ 1 - /kentleague/lordswood/9thapr04.html 1 - /dartford/22ndoct04.html 4 - /kentleague/thamesmead/thamvslad210204.html 1 - /406.php 1 - /components/com_jbusinessdirectory/assets/upload.php 1 http://www.google.com/ /kentleague/maidstone/12thaug05.html 1 - /assets/select2/docs/_includes/options.html 1 - /assets/uploads/content/Joshua_Donnelly_Dover_Academy.jpg 1 - /erithtown/29thjan05.html 6 - /wines/225/chateau-du-coing-de-st-fiacre-muscadet-sevre-et-maine-sur-lie-2010-375cl-bottle 1 - /admin/elfinder/connectors/php/connector.php 1 http://www.google.com/ /portal/channels/fa/Cms_HtmlText_Manage/Telerik.Web.UI.DialogHandler.aspx 2 - /theme/assets/jquery-file-upload/server/php/index.php 1 http://www.google.com/ /install/ 1 - /sladegreen/15thsept04.html 7 - /wines/161/il-cascinone-rive-barbera-2012 2 - /wines/76/laurent-miquel-prive-syrah-2013 1 - /js/fckeditor/editor/filemanager/connectors/php/connector.php 1 - /class-ftsp.php 2 - /lordswood/erith131104.html 11 - /Modules/CMS/Telerik.Web.UI.DialogHandler.aspx 2 - /kentleague/sevenoaks/lewes250705.html 1 - /api/stock/getSingleStock.do 1 - /api/config-init 1 - /.git/HEAD 2 - /wines/182/la-battistina-gavi-2013 1 - /wines/202/cranswick-estate-shiraz-2012 1 - /assets/select2/docs/_includes/examples.html 1 - /kentleague/VCD/19thapr05.html 1 - /lordswood/hernebay160205.html 8 - /wines/101/emiliana-sauvignon-blanc-2013 2 - /m/allticker/1 1 - /../../kentleague/lordswood/erith&belvedere031205.html 2 - /wines/264/ferghettina-franciacorta-brut 2 - /wp-config.php.0 1 https://www.google.com/search /static/home/js/rooms.js 1 - /assets/admin/plugins/elfinder/connectors/php/connector.php 1 http://www.google.com/ /section/google-recent-sitemap.gz 2 https://www.google.com/ /kentleague/hythe/7thjuly03.html 1 - /beckenham/maidstone031205.html 5 - /kentleague/maidstone/15thdec03.html 1 - /2017/wp-includes/wlwmanifest.xml 7 - /admin_user/m_tixian.php 2 - /wp-content/plugins/adaptive-images/adaptive-images-script.php 1 https://www.google.com/search /tunbridgewells/maidstone211205.html 4 - /FCKeditor/editor/filemanager/upload/php/upload.php 1 - /images/login/eyoumail.gif 1 - /wines/29/saint-aubin-1er-cru-vieilles-vignes-2011 1 - /config.php 2 - /wines/294/joseph-perrier-la-cuve-royal-demi-sec 2 - /ramsgate/3rdfeb05.html 8 - /ryman/bromley/4thjuly04.html 2 - /h5/ 4 - /user/login 2 - /conf/.env 1 - /wines/207/geoff-merrill-reserve-shiraz-2006 2 - /cray/crayvsevenoaks200903.html 9 - /BlueAnWhiteArmy 2 - /erithtown/erithvlords081103.html 5 - /controls/events/v2/Telerik.Web.UI.DialogHandler.aspx 1 - /kentleague/sladegreen/26thjune03.html 6 - /vanarama-conference/5 1 - /kentleague/maidstone/guildford110904.html 1 - /static/data/thirdgames.json 2 - /js/config20181225.js 3 - /wp-config.php.orig 1 https://www.google.com/search /css/app.css 2 - /wp2/wp-includes/wlwmanifest.xml 37 - /system/providers/htmleditor/Telerik.Web.UI.DialogHandler.aspx 1 - /cms/portlets/Telerik.Web.UI.DialogHandler.aspx 2 - /maidstone/31stmay05.html 7 - /cray/crayvhern121103.html 6 - /kentleague/maidstone/1stmar05.html 1 - /kentleague/lordswood/beckvlord270304.html 1 - /othernews/MUSHSept04.html 1 - /kentleague/cray/ashford061205.html 9 - /premier/welling/4thjan05.html 5 - /sporting/sportvslade181003.html 8 - /mambo/index.php-option=com_content&task=view&id=6597&Itemid=38 1 - /cray/kentleaguecupfinalreport080504A.html 7 - /includes/FCKeditor/editor/filemanager/upload/php/upload.php 1 - /kentleague/ramsgate/ashfordu18vramsgateu18.html 2 - /cms/wp-includes/wlwmanifest.xml 38 - /kentleague/hythe/25thjuly05.html 1 - /wines/270/longbend-sauvignon-blanc-2013 2 - /folkestone/folkvfishlgecup111103.html 6 - /kentleague/hernebay/ramsgate170804.html 1 - /wines/24/chablis-1er-cru-vosgros-2011-gilbert-picq 3 - /kentleague/beckenham/19thsept04.html 1 - /kentleague/sladegreen/hythe030905.html 1 - /2163/Library/cms/portlets/Telerik.Web.UI.DialogHandler.aspx 1 - /includes/FCKeditor/editor/filemanager/browser/default/connectors/php/connector.php 1 - /../ryman/bromley/beck220703.html 2 - /othernews/FAVase2RPreview161105.html 4 - /wp-config.php.7 1 https://www.google.com/search /premier/dover/19thoct05.html 8 - /post_google_news.xml.gz 2 https://www.google.com/ /tunbridgewells/7thnov04.html 8 - /static/index/css/all.css 1 - /fckeditor/editor/js/fckeditorcode_ie.js 1 - /conference/gravesend/2ndaug05.html 1 - /othernews/conffixtures0506.html 3 - /contact-us/ 1 http://kentishfootball.co.uk /kentleague/sladegreen/6thaug04.html 1 - /premier/dover/dartford151005.html 7 - /wines/215/frankin-tate-semillon-sauvignon-blanc-2012 2 - /ramsgate/31stmar05.html 9 - /wines/153/campo-azafran-tempranillo-syrah-2013 1 - /wines/35/domaine-faiveley-rully-les-villeranges-2011 1 - /Promotions/list.mvc 1 - /JS/loginstatus.js 2 - /kentleague/thamesmead/3rdjune05.html 1 - /css/skin/ymPrompt.css 1 - /othernews/crayvalley290105.html 1 - /vanarama-conference 1 - /mambo/images/stories/birken%20road%20tunbridge%20wells%203%20feb%202009.jpg 3 - /kentleague/lordswood/lordsvbeckfavase200903.html 1 - /wp/wp-login.php 11 - /assets/uploads/content/Alan_Julian_Hugo_Langton_and_Rob.jpg 2 - /RadControls/Spell/telerik.web.ui.dialoghandler.aspx 1 - /../../kentleague/hernebay/ashford230705.html 2 - /wines/90/cotes-dauvergne-gamay-2013 1 - /../ryman/bromley/4thjuly04.html 2 - /leftDao.php 2 - /src/.env 1 - /wines/149/anna-de-codorniu-brut-nv 2 - /member/images/member.gif 1 - /DanFisherFC 2 - /js/fckeditor/editor/filemanager/upload/php/upload.php 1 - /Content/css/wzwstylel.css 1 - /wines/232/canard-duchene-brut-nv-magnums 2 - /wines/120/franschhoek-cellar-baker-station-shiraz-2012 2 - /wines/94/casas-del-bosque-reserva-cabernet-sauvignon-2012 1 - /kentleague/tunbridgewells/burytown111204.html 1 - /sittingbourne/erith&belvedere111204.html 4 - /kentleague/beckenham/waltoncasuals180105.html 1 - /kentleague/sladegreen/beckvslad070204.html 1 - /mambots/editors/fckeditor/editor/filemanager/browser/default/connectors/php/connector.php 1 - /kentleague/sevenoaks/maidstone301004.html 1 - /thamesmead/15thaug05.html 8 - /kentleague/lordswood/hillingdon231004.html 1 - /assets/uploads/content/Pom.jpg 1 - /mambo/images/banners/GlebeBex.jpg 1 - /wines/47/chateau-pesquie-ventoux-2012 1 - /wp-admin/admin-ajax.php 4 - /premier/dover/10thdec05.html 8 - /assets/uploads/content/Cray_Valley_v_VCD_Athletic.jpg 4 - /assets/admin/plugins/file-uploader/server/php/index.php 1 http://www.google.com/ /elliotmbyrne 2 - /kentleague/deal/12thjune05.html 1 - /main/ 1 - /kentleague/lordswood/tunwells191105.html 1 - /wines/88/m-chapoutier-la-ciboise-blanc-2013 2 - /kentleague/beckenham/whitres040904.html 1 - /kentleague/sevenoaks/18thapr05.html 1 - /beckenham/greenwich071204.html 4 - /newssitemap.xml.gz 2 https://www.google.com/ /folkestone/fisher291005.html 6 - /WorgInfo 2 - /kentleague/tunbridgewells/4thfeb05.html 1 - /ajax 2 - /wines/196/chapel-down-brut-vintage-reserve 2 - /AsiCommon/Controls/ContentManagement/ContentDesigner/Telerik.Web.UI.DialogHandler.aspx 2 - /tonbridge/16thfeb04.html 4 - /ryman/bromley/7thapr05.html 3 - /sevenoaks/whitstable190205.html 8 - /kentleague/sevenoaks/17thfeb05.html 1 - /wines/52/philippe-girard-sancerre-silex-2013 1 - /wines/245/patrizi-barolo-2010 1 - /ff/css/cssy.css 2 - /wines/78/domaine-de-pellehaut-chardonnay-fruit-2013 2 - /theme/assets/plugins/jquery-file-upload/server/php/index.php 1 http://www.google.com/ /kentleague/thamesmead/cray070804.html 2 - /DesktopModules/Admin/RadEditorProvider/telerik.web.ui.dialoghandler.aspx 1 - /VCD/1staug05.html 8 - /member/space/person/common/css/css.css 2 - /vanarama-conference/2 7 - /wines/118/crossroads-merlot-2012 2 - /kentleague/lordswood/7thsept05.html 1 - /cms/ 1 - /2020/ 1 - /kentleague/maidstone/18thmay05.html 1 - /premier/dover/11thfeb05.html 8 - /getLocale 1 - /data/admin/quickmenu.txt 2 - /ryman/bromley/25thsept03.html 7 - /folkestone/folkve&B120404.html 3 - /../../kentleague/cray/folkestone061104.html 3 - /sladegreen/hernebay091004.html 8 - /apps/.env 1 - /DesktopModules/Base/EditControls/Telerik.Web.UI.DialogHandler.aspx 2 - /../../kentleague/VCD/31stjan04.html 2 - /_wpresources/RadEditorSharePoint/6.4.0.0__1f131a624888eeed/Resources/Telerik.Web.UI.DialogHandler.aspx 1 - /123.php 1 - /kentleague/beckenham/vcd220305.html 2 - /hashtag/BringFisherFCHome 2 - /assets/uploads/content/Bromley_AGM_Award.jpg 2 - /assets/room/css/room_mobile.css 2 - /DesktopModule/UIYKienCuTri/Telerik.Web.UI.DialogHandler.aspx 1 - /sladegreen/sladevsport170404.html 7 - /ryman/bromley/bromvtonb270104.html 3 - /kentleague/sladegreen/sladeverit100404.html 1 - /../ryman/bromley/21stnov05.html 2 - /wines/68/joseph-perrier-la-cuvee-royale-brut-magnums 3 - /Public/Home/js/cls.js 1 - /wines/41/les-cerisers-cotes-du-rhone-ros-2013 2 - /../premier/dover/dartford151005.html 2 - /../../conference/margate/22nddec05.html 3 - /otc/ 1 - /kentleague/ramsgate/10thfeb05.html 1 - /kentleague/cray/francis060804.html 1 - /admin/index 3 - /kentleague/lordswood/22ndaug04A.html 1 - /wines/5/le-paradou-viognier-2012 2 - /wines/79/domaine-de-pellehaut-harmonie-de-gascogne-ros-2013 2 - /includes/fckeditor/editor/filemanager/connectors/php/connector.php 1 - /wines/125/percheron-chenin-blanc-viognier-2013 2 - /admin/assets/file-uploader/server/php/index.php 1 http://www.google.com/ /common/template/lottery/lecai/css/style.css 1 - /kentleague/hythe/27thapr04.html 1 - /wines/185/fazi-battaglia-verdicchio-2011 1 - /wp1/wp-includes/wlwmanifest.xml 37 - /api/site/getInfo.do 2 - /wines/170/canapi-nero-davola-2012 1 - /../../conference/margate/12thjuly04.html 3 - /wines/201/cranswick-estate-merlot-2012 1 - /wines/39/montagny-1er-cru-2012-vignerons-de-buxy 1 - /wines/109/nostros-reserva-pinot-noir-2013 2 - /wines/220/calusari-pinot-grigio-2013 1 - /feed/ 1 https://www.google.com/ /wines/287/anno-elderflower-vodka-70cl 1 - /sladegreen/sladevrams200304.html 5 - /vanarama-conference/20 1 - /../premier/welling/13thmay05.html 3 - /wines/7/chateau-perron-lalande-de-pomerol-2010 3 - /kentleague/beckenham/whitstable301004.html 1 - /newsite/.env 1 - /ramsgate/20thdec04.html 6 - /locale/Goex/zh/common.js 1 - /mambo/index2.php 108 - /sladegreen/deal061104.html 5 - /wines/248/nocturno-colheita-nocturna-2013 1 - /kentleague/lordswood/lordsvrams310304.html 1 - /../../kentleague/ramsgate/ashfordu18vramsgateu18.html 2 - /plus/carbuyaction.php 2 - /fckeditor/editor/dtd/fck_dtd_test.html 1 - /wines/221/calusari-pinot-noir-2013 1 - /sladegreen/beckenham121105.html 8 - /js/tvConfig.js 2 - /member/templets/images/login_logo.gif 1 - /ckeditor/ckeditor.js 1 - /ryman/bromley/margate221105.html 4 - /folkestone/dartford180105.html 5 - /wines/183/bottega-vinai-pinot-grigio-2013 2 - /public/assets/plugins/plupload/examples/upload.php 1 http://www.google.com/ /wp/xmlrpc.php 1 - /kentleague/deal/27thjune05.html 1 - /old/wp-admin/ 2 http://kentishfootball.co.uk/ /tonbridge/ashford170905.html 7 - /api/.env 2 - /../kentleague/cray/23rdmar05.html 2 - /adm.php 2 - /../../ryman/bromley/folkestone290805.html 3 - /../../kentleague/maidstone/9thsept04.html 3 - /wp-config.php_ 1 https://www.google.com/search /kentleague/sevenoaks/bromley020805.html 7 - /wines/72/laurent-miquel-cabernet-syrah-2013 2 - /hernebay/ramsgate170804.html 5 - /assets/jQuery-File-Upload/server/php/index.php 1 http://www.google.com/ /wines/212/philip-shaws-the-architect-chardonnay-2012 2 - /assets/uploads/content/Sean_Francis_signs_for_Bromley.jpg 1 - /kentleague/lordswood/eastbournevlordsfac230803.html 1 - /tunbridgewells/18thnov04.html 6 - /kentleague/tunbridgewells/7thoct05.html 1 - /kentleague/tunbridgewells/pagham040904.html 1 - /kentleague/lordswood/AFCtotton100905.html 1 - /beckenham/deal030905.html 6 - /whitstable/16thjune05.html 8 - /lordswood/beckenham220105.html 6 - /ryman/bromley/21stapr05.html 4 - /folkestone/tonbridge070904.html 6 - /wp-content/ 3 - /kentleague/tunbridgewells/tunverith111003.html 1 - /m 9 - /readme.txt 1 - /bostik-league/14 1 - /lordswood/lordsvrams310304.html 6 - /../../kentleague/sladegreen/ashford270805.html 2 - /conference/margate/23rdmar05.html 1 - /../premier/dover/12jan04.html 2 - /wines/127/boschendal-the-rose-garden-ros-2014 1 - /wines/222/argosy-pinot-noir-2009-375cl-bottle 1 - /api/mobile/checkStrategyHistory 1 - /othernews/AEI080205.html 1 - /DesktopModules/TCModules/TCCategory/telerik.web.ui.dialoghandler.aspx 1 - /wines/293/joseph-perrier-la-cuve-royale-blanc-de-blancs 2 - /STANDfanzine 2 - /thamesmead/thamesmeadvramsgate160803.html 6 - /kentleague/deal/Sampson8.html 1 - /hernebay/tunwells220105.html 8 - /thamesmead/9thsept04.html 5 - /wines/115/the-crossings-sauvignon-blanc-marlborough-2013 3 - /admin/assets/plugins/plupload/examples/upload.php 1 http://www.google.com/ /skin/js/common.js 2 - /kentleague/deal/7thjuly03.html 1 - /App_Master/Telerik.Web.UI.DialogHandler.aspx/DesktopModules/TelerikWebUI/RadEditorProvider/Telerik.Web.UI.DialogHandler.aspx 1 - /getConfig/listPopFrame.do 1 - /hythe/erith210804.html 11 - /wines/59/turckheim-reserve-pinot-blanc-2012 1 - /_wpeprivate/config.json 1 https://www.google.com/search /dave_adkins/status/915318527443300357 2 - /admin/fckeditor/editor/filemanager/connectors/php/connector.php 1 - /../../conference/gravesend/17thjan05.html 3 - /wp-config.php.b 1 https://www.google.com/search /wines/56/domaine-langlois-chateau-2013-blanc 2 - /ramsgate/27thjan05.html 5 - /assets/uploads/content/2015_Women_s_Cup_3_final_620_x_3.jpg 4 - /kentleague/ramsgate/1stjan06.html 3 - /assets/uploads/content/Laura_Bassett_World_Cup_Heartbre.png 2 - /kentleague/VCD/28thsept05.html 1 - /sitemap_news.xml.gz 2 https://www.google.com/ /wp-config.php.4 1 https://www.google.com/search /el/Providers/HtmlEditorProviders/Telerik/Telerik.Web.UI.DialogHandler.aspx 2 - /editor/editor/filemanager/upload/php/upload.php 1 - /conference/margate/17thjuly03.html 1 - /wines/150/algareiro-albarino-2013 3 - /wines/166/latium-morini-soave-2013 2 - /editor/filemanager/upload/php/upload.php 1 - /nyyh/chkjs.js 2 - /settings/account 2 - /kentleague/maidstone/10thjuly05.html 1 - /crm/.env 1 - /admin/FCKeditor/editor/filemanager/connectors/php/connector.php 1 - /ryman/bromley/1stmay05.html 2 - /mambo/images/banners/NextHoliday.gif 4 - /mambo/images/banners/CWenfieldtown.jpg 3 - /adminer.php 2 - /kentcounty/21stoct03.html 1 - /beckenham/whitstable290105.html 7 - /admin/fckeditor/editor/filemanager/upload/php/upload.php 1 - /wp-config.php.txt 1 https://www.google.com/search /oldsite/xmlrpc.php 1 - /demo/ 1 - /erith&belvedere/fisher190205.html 4 - /_wpresources/RadEditorSharePoint/6.9.0.0__1f131a624888eeed/Resources/telerik.web.ui.dialoghandler.aspx 1 - /auth.php 1 - /vanarama-conference/16 2 - /wines/25/domaine-bernard-moreau-et-filschassagne-montrachet-2012 3 - /wordpress/xmlrpc.php 1 - /user/Login 2 - /gravesend/24thjune03.html 6 - /assets/uploads/content/Cray_Wanderers_pull_off_The_Grea.jpg 2 - /kentleague/lordswood/sportingbengal041204.html 1 - /wp-config.php.1 1 https://www.google.com/search /kentleague/deal/Sampson4.html 1 - /ramsgate/bengal140804.html 5 - /conference/margate/11thjuly03.html 1 - /../premier/welling/chatham071205.html 2 - /admin/fckeditor/editor/filemanager/browser/default/connectors/php/connector.php 1 - /images/login/icon-up.gif 1 - /vendor/laravel/.env 1 - /mambo/images/stories/hessenthaler%20presents%20faversham%20town%20dover%20athletic%20shirt.jpg 5 - /web/wp-includes/wlwmanifest.xml 37 - /wines/253/chateau-moulin-des-richards-2011 2 - /wp-config.bak 1 https://www.google.com/search /api/api.php 1 - /assets/uploads/content/Greenwich_Borough_Paul_Vines_mar.jpg 3 - /sladegreen/deal020405.html 6 - /assets/uploads/content/Merstham_celebrate_promotion_at_.jpg 1 - /kentleague/sladegreen/23rdoct05.html 4 - /../../kentleague/cray/5thnov04.html 3 - /maidstone/tunbridgewells301105.html 7 - /googlesitemap.xml.gz 2 https://www.google.com/ /wp-config-backup.txt 1 https://www.google.com/search /wines/284/sacred-gin-70cl 1 - /kentleague/hernebay/ashford230705.html 8 - /kentleague/deal/Sampson7.html 1 - /news.html 7 - /api/web/user/getIndexData.php 1 - /views/commData/commonSite.js 1 - /sittingbourne/6thjan05.html 4 - /cache/doc.php 1 - /.env 37 - /Cleckseagull 2 - /getConfig/getArticle.do 1 - /kentleague/beckenham/erithtown191004.html 1 - /sittingbourne/sittvdart141003.html 5 - /folkestone/folkevsitt230903.html 7 - /wines/177/fertuna-dropello-2012 1 - /chatham/dartford200905.html 10 - /fckeditor/fckconfig.js 1 - /hythe/hythevslade081103.html 7 - /mambo/index.php-option=com_content&task=view&id=4305&Itemid=38 3 - /mambo/index.php-option=com_content&task=view&id=3051&Itemid=38 1 - /common/admin/Jobs2/Telerik.Web.UI.DialogHandler.aspx 2 - /wp-admin/.env 1 - /lanren/css/global.css 2 - /wines/65/antech-cremant-de-limoux-brut-cuvee-eugene-2011 2 - /wines/251/faurar-alb-de-ceptura-2013 3 - /../premier/dover/10thdec05.html 3 - /greenwich/whitstable141204.html 5 - /lordswood/tunwells191105.html 8 - /kentleague/deal/20thjan05.html 1 - /rss 2 - /nyyh/game.css 1 - /kentleague/hythe/8thaug04.html 1 - /tunbridgewells/tunvseven240404A.html 4 - /sladegreen/ramsgate260205.html 6 - /kentleague/beckenham/KSTSF030305.html 1 - /maidstone/2ndaug05.html 10 - /vanarama-conference/3 1 - /sitemap_news.xml 2 https://www.google.com/ /2019/wp-includes/wlwmanifest.xml 28 - /wines/279/amuata-absoluto-torrontes-2013 2 - /info.php 2 - /lordswood/sevenoaks291005.html 5 - /backup/ 1 - /conference/margate/16thoct.html 1 - /wines/250/faurar-rosu-de-ceptura-2012 2 - /tunbridgewells/thamesmead011204.html 6 - /sladegreen/hythe220105.html 6 - /kentleague/deal/Sampson13.html 1 - /member/space/person/header.htm 1 - /wines/49/sebastien-treuillet-pouilly-fume-2013 1 - /wines/116/the-crossings-pinot-gris-2013 2 - /kentleague/maidstone/tunbridgewells301105.html 1 - /wines/93/casas-del-bosque-sauvignon-blanc-2014 2 - /deal/lordswood150305.html 6 - /wines/219/geoff-merrill-henley-shiraz-2004 1 - /wp-content/.env 1 - /ryman/bromley/metpolice291204.html 1 - /kentleague/greenwich/Greevlord130104.html 1 - /ryman/bromley/eghamvbrom060404.html 1 - /fckeditor/editor/filemanager/browser/default/connectors/php/connector.php 1 - /wines/291/ch-de-pellehaut-10yo-armagnac-70cl 2 - /deal/FAV3rewview121204.html 6 - /tunbridgewells/tunvslade130903.html 7 - /beckenham/tunwells120205.html 6 - /kentleague/whitstable/4thjuly04.html 2 - /ramsgate/ramsvtham060404.html 8 - /googlesitemap.xml 2 https://www.google.com/ /assets/uploads/content/Gills_celebrations_4.jpg 1 - /loan 2 - /sladegreen/8thaug05.html 9 - /kentleague/deal/17thoctZ.html 1 - /assets/uploads/content/Gary_Alexander_free_kick_againt_.jpg 4 - /Telerik.Web.UI.WebResource.axd 1 - /wines/121/franschhoek-cellar-the-churchyard-cabernet-sauvignon-2012 3 - /sevenoaks/hythe231004.html 5 - /vendor/phpunit/phpunit/src/Util/PHP/eval-stdin.php 6 - /controls/cms/Telerik.Web.UI.DialogHandler.aspx 1 - /wines/286/anno-sloe-gin-70cl 1 - /wp-config.php_Old 2 https://www.google.com/search /wp-config.php 1 https://www.google.com/search /FCK/editor/js/fckeditorcode_ie.js 1 - /../othernews/fatrophy4thround.html 2 - /kentleague/ramsgate/20thjuly05.html 1 - /lordswood/deal161004.html 6 - /test/ 1 - /mambo/index.php-option=com_content&task=view&id=3288&Itemid=38 4 - /wines/126/franschhoek-cellar-the-old-museum-merlot-2013 1 - /lordswood/sevenoaks071204.html 4 - /wines/259/poderi-colla-campo-romano-2011 3 - /sites/.env 1 - /wines/81/maison-de-vigneron-pays-des-cotes-de-gascogne-ros-2013 1 - /lordswood/22ndaug04.html 5 - /wines/31/macon-rouge-terres-secretes-2012 1 - /othernews/London220105.html 1 - /wp/ 1 - /section/googlenews.gz 2 https://www.google.com/ /wp-login.php 155 - /OLD/wp-admin/ 1 http://kentishfootball.co.uk/ /market/market-ws/iframe.html 2 - /wines/97/emiliana-syrah-2012 2 - /kentleague/ramsgate/31stmar05.html 1 - /media/wp-includes/wlwmanifest.xml 22 - /thamesmead/3rdjune05.html 8 - /../premier/welling/4thjan05.html 2 - /rss/ 1 https://www.google.com/ /wines/197/chapel-down-brut-ros-nv 1 - /manager/js/left.js 1 - /assets/uploads/content/Charlton_Athletic_win_the_Capita.jpg 2 - /cray/vcdvcray240404.html 9 - /mambo/images/stories/ashfordtownkit2.jpg 2 - /wines/103/emiliana-carmenere-2012 1 - /sittingbourne/dartford020106.html 6 - /../../kentleague/ramsgate/1stjan06.html 3 - /kentleague/VCD/27thaug04.html 1 - /../ryman.html 3 - /app/config/.env 1 - /wines/51/sancerre-michel-girard-2013 2 - /api/v/index/queryOfficePage 2 - /wp1/ 1 - /ryman/bromley/15thnov05.html 3 - /beckenham/thamesmead171205.html 6 - /kentleague/tunbridgewells/littlehampton310805.html 5 - /kentleague/lordswood/sevenoaks030905.html 1 - /conference/margate/22nddec05.html 3 - /../../kentleague/ramsgate/15thjuly05.html 3 - /assets/uploads/content/Bromley_future.jpg 1 - /script/public.js 1 - /erithtown/hernebay131204.html 6 - /wp-config.php_bak 1 https://www.google.com/search /wines/205/geoff-merrill-shiraz-grenache-mourvedre-2010 1 - /wines/140/raimat-abadia-blanc-de-blanc-2012 1 - /wines/272/triuno-cabernet-sauvignon-2012 2 - /othernews/27thjune03.html 8 - /beckenham/thamesmead260405.html 6 - /wp-config.php_new 1 https://www.google.com/search /mambo/mambots/editors/tinymce/www.valsportuk.com/shop 5 - /DesktopModules/Admin/RadEditorProvider/DialogHandler.aspx 2 - /kentleague/maidstone/16thdec05.html 1 - /kentleague/tunbridgewells/18thnov04.html 1 - /dartford/tingley030504.html 7 - /kentleague/maidstone/20thdec04.html 2 - /lordswood/beckvlord270304.html 8 - /dartford/erith231004.html 4 - /ramsgate/10thfeb05.html 6 - /kentleague/deal/dealvcray011103.html 1 - /kentleague/sladegreen/30thdec05.html 1 - /wines/74/laurent-miquel-syrah-grenache-2013 1 - /wp-admin/ 2 http://kentishfootball.co.uk/ /sittingbourne/chatham271205.html 6 - /public/assets/plugins/fileuploader/examples/one-button/php/form_upload.php 1 http://www.google.com/ /wap/trading/lastKlineParameter 2 - /../ryman/bromley/1stmay05.html 2 - /wines/223/argosy-sauvignon-blanc-2011-375cl-bottle 1 - /public/.env 3 - /folkestone/folkvash261203.html 4 - /wines/234/san-felice-chianti-classico-magnum-2009 1 - /kentleague/sevenoaks/sladegreen221105.html 1 - /Public/home/wap/css/qdgame.css 2 - /plus/img/df_dedetitle.gif 1 - /../../ryman/bromley/fisheru18vbromu18070304.html 2 - /kentleague/maidstone/11thdec03.html 1 - /sladegreen/beckenham041204.html 7 - /manifest.json 2 - /../ryman/bromley/7thapr05.html 2 - /wp-config.php.8 1 https://www.google.com/search /sql.php 2 - /sevenoaks/dealtown250904.html 7 - /kentleague/whitstable/30thnov05.html 1 - /beckenham/tunwells101205.html 5 - /kentleague/whitstable/plaayacupfinal04.html 3 - /common/member/js/user.util.js 1 - /wines/122/percheron-grenache-gris-ros-2013 2 - /premier/dover/2ndjan06.html 6 - /wp-config.php.3 1 https://www.google.com/search /kentleague/erithtown/28thjune05.html 1 - /kentleague/sladegreen/maidstone140804.html 1 - /wines/60/turckheim-reserve-riesling-2012 1 - /kentleague/sevenoaks/sporting061104.html 1 - /wines/91/puy-de-dome-pinot-noir-2012 1 - /changelog.txt 1 - /tunbridgewells/maidstone181204.html 5 - /../../ryman/bromley/bromvdartksc071003.html 2 - /mambo/index.php-option=com_content&task=view&id=8431&Itemid=40 4 - /wp-config.php_1 1 https://www.google.com/search /post_google_news.xml 2 https://www.google.com/ /xxxss 4 - /css/all.css 2 - /assets/uploads/content/Richard_Dimmock_Lordswood.png 4 - /Telerik.Web.UI.DialogHandler.aspx 2 - /ramsgate/ramsgatevdeal071003.html 9 - /kentleague/ramsgate/kingstonian221105.html 1 - /beckenham/maidstone190205.html 4 - /kentleague/ramsgate/greenwich020405.html 1 - /check.php 1 - /mambo/index.php-option=com_content&task=view&id=6214&Itemid=42 1 - /../../othernews/SL%20Review%20140805.html 2 - /VCD/28thjan04.html 6 - /uploads/userup/index.html 1 - /wines/210/the-googly-chardonnay-2013 1 - /blog/xmlrpc.php 1 - /e/data/js/ajax.js 4 - /bostik-league/2 1 - /kentleague/tunbridgewells/camberley110904.html 1 - /kentleague/sevenoaks/22ndaug04.html 1 - /kentleague/sladegreen/15thsept04.html 1 - /sladegreen/maidstone200805.html 5 - /wines/110/signos-de-origen-syrah-2010 1 - /../../ryman/bromley/fisher270704.html 2 - /wines/165/mirabello-pinot-grigio-ros-2013 2 - /kentleague/deal/Sampson5.html 1 - /DesktopModules/RadEditorProvider/telerik.web.ui.dialoghandler.aspx 1 - /assets/uploads/content/Courtney_Shanley_Gillingham_keep.jpg 4 - /sittingbourne/chatham260305.html 5 - /sevenoaks/maidstone190305.html 6 - /assets/uploads/content/Charlton_Athletic_women_2015.jpg 1 - /mambo/mambots/ 7 - /class-wp-inc.php 1 - /cray/20thapr04A.html 8 - /wines/160/araldica-barolo-2010 1 - /sladegreen/13thoct04.html 9 - /thamesmead/greenwich170804.html 6 - /wines/193/chapel-down-flint-dry-2013 2 - /new/.env 1 - /admin/.env 2 - /../../kentleague/cray/ashford061205.html 2 - /lordswood/hythe060905.html 9 - /../othernews/FAVase2RPreview161105.html 2 - /assets/uploads/content/Vanarama_Conference_South_trophy.jpg 4 - /categories.php 1 - /member/js/lang_zh_CN.js 2 - /apple-touch-icon-152x152-precomposed.png 400 - /magento_version 1 - /folkestone/tonbridge151105.html 8 - /maidstone/21stjan05.html 10 - /new/ 1 - /action.php 1 - /includes/FCKeditor/editor/filemanager/connectors/php/connector.php 1 - /premier/dover/16thjan05A.html 2 - /ryman/bromley/beck220703.html 3 - /../../kentleague/sladegreen/14thjan04.html 2 - /kentleague/maidstone/15thaug03.html 1 - /ryman/bromley/margate200905.html 4 - /wines/145/la-vicalanda-rioja-reserva-2009 2 - /sittingbourne/chatham080205.html 5 - /administrator/index.php 16 - /maidstone/18thaug05.html 8 - /beckenham/whitstable130805.html 6 - /v2/ 1 - /sladegreen/greenwich130805.html 5 - /kentleague/sladegreen/ramsgate260205.html 1 - /wines/244/ramon-bilbao-limited-edition-2011 2 - /images/Back_butt.gif 1 - /../../kentleague/ramsgate/tonbridge020106.html 3 - /kentleague/deal/19thjuly05.html 1 - /drmartens.html 4 - /step1.asp 3 - /mambo/index.php-option=com_content&task=view&id=1675&Itemid=38 1 - /tpl/login/user/images/login_bg_1.jpg 1 - /class-wp-maint.php 1 - /mambo/images/stories/BadgersFlood.jpg 3 - /static/home/css/css.css 1 - /kentleague/hythe/9thmay04.html 1 - /wines/102/signos-de-origen-carmenere-2010 2 - /erith&belvedere/26thoct04.html 3 - /wp-config.php.bk 1 https://www.google.com/search /assets/uploads/content/Laurence_Harvey_Hythe_Town.jpg 1 - /wines/156/cartlidge-and-browne-sauvignon-blanc-2012 1 - /storage/.env 2 - /assets/uploads/content/Stuart_Zanone_equals_Ashford_Uni.jpg 5 - /ryman/bromley/8thdec05.html 1 - /googleNews.xml.gz 2 https://www.google.com/ /common/admin/PhotoGallery2/Telerik.Web.UI.DialogHandler.aspx 2 - /blog/wp-login.php 11 - /assets/uploads/content/Stuart_Zanone_breaks_Ashford_Uni.jpg 4 - /deal/13thmar05.html 5 - /Res/font/font.css 2 - /sladegreen/tunwells150105.html 8 - /static/local/img/userCenter/hourlyPrivilege.svg 1 - /hythe/sevenoaks140804.html 5 - /kentleague/thamesmead/winchester111204.html 1 - /sittingbourne/sittvtonb221103.html 6 - /thamesmead/10thjune05.html 7 - /fckeditor/license.txt 1 - /sittingbourne/erith&amp 1 - /sladegreen/thamesmead050205.html 8 - /Css/index.css 2 - /issmall/ 1 - /wines/292/saliza-amaretto-veneziano-70cl 2 - /sladegreen/thamesmead300805.html 6 - /wines/43/ortas-les-viguiers-2013-blanc 1 - /wines/238/chateau-dorignac-pineau-des-charentes 2 - /util/login.aspx 1 - /dave_adkins 2 - /conference/margate/fisher241005.html 4 - /kentleague/sladegreen/31stjuly04.html 1 - /statics/js/API.js 2 - /wines/117/rua-pinot-noir-2012 2 - /gravesend/12thmay04.html 6 - /zz2/address.php 1 - /folkestone/ashford240704.html 6 - /hernebay/hernvlords111003.html 5 - /wines/258/campbells-bobbie-burns-durif-2010 2 - /Providers/HtmlEditorProviders/Telerik/Telerik.Web.UI.DialogHandler.aspx 2 - /wp-config.php-bak 2 https://www.google.com/search /web/ 1 - /SiteTemplates/Telerik.Web.UI.DialogHandler.aspx 1 - /FCKeditor/editor/filemanager/browser/default/connectors/php/connector.php 1 - /Fav080905A.html 1 - /class-wp-feed.php 1 - /../../kentleague/sladegreen/23rdoct05.html 2 - /sladegreen/sladevseven090304.html 5 - /DesktopModules/News/Telerik.Web.UI.DialogHandler.aspx 2 - /Public/mobile/js/config.js 1 - /wines/30/la-chablisienne-petit-chablis-2013 2 - /mambo/images/stories/westbourne_photo3.jpg 4 - /thamesmead/11thfeb05.html 5 - /tunbridgewells/hythe090305.html 8 - /wines/107/tabali-reserva-late-harvest-muscat-2011-375cl-bottle 2 - /wines/260/dominio-de-cair-anada-2010 3 - /wines/138/raimat-albarino-2012 1 - /static/common/js/global.js 2 - /kentleague/VCD/24thaug05.html 1 - /folkestone/folkvtonb160304.html 6 - /brabantwallon/app_master/telerik.web.ui.dialoghandler.aspx 1 - /sladegreen/bowey301sevenoaks250105.html 7 - /cray/crayvhyth260404.html 5 - /tunbridgewells/lordswoodu18050904.html 8 - /403.php 1 - /wines/141/raimat-castell-de-raimat-tempranillo-2010 2 - /kentleague/sevenoaks/tunwells170804.html 1 - /wines/124/franschhoek-statue-de-femme-sauvingon-blanc-2014 2 - /kentleague/ramsgate/horsham041005.html 1 - /kefu.php 1 - /kentleague/hythe/27thoct05.html 1 - /assets/uploads/content/Hollands_Blair_Kent_Invicta_Le.jpg 5 - /kentleague/VCD/26thoct04.html 1 - /desktopmodules/dnnwerk.radeditorprovider/telerik.web.ui.dialoghandler.aspx 1 - /wines/277/michel-girard-sancerre-ros-2013 2 - /wines/188/ita-prosecco-spumante-brut-nv 2 - /sittingbourne/sittverit181103.html 4 - /wines/131/bellingham-ancient-earth-pinotage 1 - /api/v1/invest 1 - /conference/margate/19thapr05.html 11 - /kentleague/maidstone/17thnov03.html 1 - /api/message/webInfo 2 - /ryman/bromley/fisher270704.html 4 - /wp-config.php.save 1 https://www.google.com/search /Front/FctPage/Start.aspx 1 - /VCD/tunbridgewells071204.html 6 - /assets/xpdo.idx.php 1 - /../../ryman/bromley/ashford151005.html 2 - /wp-config.php.bak 1 https://www.google.com/search /sladegreen/greenwich131104.html 4 - /sladegreen/thamesmead161004.html 8 - /wines/50/les-coteaux-tufiers-vouvray-2013 2 - /../../drmartens.html 2 - /administrator/manifests/files/joomla.xml 1 - /shop/wp-includes/wlwmanifest.xml 35 - /wines/269/templars-hill-pinot-gris-2013 2 - /erith&belvedere/folkestone301104.html 5 - /DesktopModules/RadEditorProvider/DialogHandler.aspx 1 - /sladegreen/vcd190205.html 7 - /wines/255/chateau-de-blissa-2011 1 - /images/loadinglit.gif 1 - /wines/164/mirabello-pinot-grigio-2013 1 - /aspnet-ajax/editor/examples/overview/telerik.web.ui.dialoghandler.aspx 1 - /sladegreen/sevenoaks031205.html 7 - /wines/14/chateau-cardinal-villemaurine-2009-saint-emilion-grand-cru 1 - /css/view/main/goin.css 1 - /beckenham/whitstable301004.html 7 - /kentleague/lordswood/lordswood.html 1 - /sittingbourne/sittvchat281003.html 9 - /DesktopModules/TelerikWebUI/RadEditorProvider/Telerik.Web.UI.DialogHandler.aspx 1 - /wines/280/pallio-di-san-floriano-verdicchio-classico-superiore-2012 1 - /lordswood/sevenoaks030905.html 8 - /kentleague/hernebay/1stjuly03.html 1 - /kentleague/ramsgate/nuneaton051105.html 1 - /kentleague/maidstone/16feb04.html 1 - /banner.do 1 - /wines/175/baroncini-orveito-classico 2 - /2020/wp-includes/wlwmanifest.xml 13 - /kentleague/lordswood/15thaug04.html 1 - /premier/welling/chatham071205.html 9 - /premier/dover/9thnov05.html 4 - /Public/Wchat/css/index.css 1 - /kentleague/sladegreen/reading280804A.html 1 - /lordswood/deal111005.html 6 - /premier/dover/12jan04.html 5 - /wordpress/ 1 - /wines/186/raboso-ros-borgo-del-col-alto-nv 1 - /sitemap-news.xml 2 https://www.google.com/ /wines/179/chianti-volpetto-2012 2 - /fckeditor/fckeditor.js 1 - /../../conference/gravesend/26thjan05.html 2 - /beckenham/whitres040904.html 8 - /Admin/ServerSide/Telerik.Web.UI.DialogHandler.aspx 2 - /section/google-recent-sitemap 2 https://www.google.com/ /../../ryman/bromley/fisherfacupreplay210904.html 2 - /i/moments 2 - /kentleague/erithtown/8thsept05.html 1 - /wp-includes/wlwmanifest.xml 38 - /kentleague/sladegreen/beckenham121105.html 1 - /js/chat/chat.js 1 - /../ryman/bromley/erithtown160705.html 2 - /plugins/plupload/examples/upload.php 1 http://www.google.com/ /mobile/config.js 1 - /wines/265/westwell-special-cuvee-2010 1 - /kentleague/ramsgate/bashley011005.html 1 - /cray/KSTSF080304.html 7 - /ashford/28thapr04.html 6 - /tonbridge/folkestone150205.html 6 - /mambots/editors/fckeditor/editor/filemanager/connectors/php/connector.php 1 - /site/xmlrpc.php 1 - /bostik-league/19 8 - /../othernews/conffixtures0506.html 3 - /member/images/dzh_logo.gif 1 - /hernebay/greenwich140804.html 4 - /tunbridgewells/27thmar05.html 7 - /sitemap-news.xml.gz 2 https://www.google.com/ /premier/dover/folkestone280305.html 7 - /sladegreen/sladevwhitstable111003.html 5 - /ramsgate/ramsgatevhythe120803.html 5 - /wines/105/tabali-reserva-viognier-2013 1 - /old-site/ 1 - /plugins/jQuery-File-Upload/server/php/index.php 1 http://www.google.com/ /lordswood/lordsvcray251003.html 9 - /FCKeditor/editor/filemanager/connectors/php/connector.php 1 - /wines/73/laurent-miquel-chardonnay-viognier-2013 1 - /wines/85/morgon-la-ballofiere-2012-jean-paul-dubost 2 - /assets/uploads/content/Gary_Lockyer_Glebe_Elmstead_30_O.jpg 1 - /mambo/images/banners/buildingplastics.png 1 - /../../ryman/bromley/15thnov05.html 2 - /blank.html 2 - /api/Index/getLottery 1 - /wines/257/chateau-du-glana-saint-julien-2011 1 - /kentleague/deal/Sampson15.html 1 - /tunbridgewells/tunvlordswood130803.html 5 - /assets/uploads/content/Lauren_Williams_Gillingham_Ladie.jpg 3 - /bostik-league 2 - /readme.html 1 - /old/xmlrpc.php 1 - /../premier/welling/dartford091104.html 2 - /static/wap/css/index.css 1 - /editor/js/fckeditorcode_ie.js 1 - /kentleague/greenwich/23rdnov03.html 1 - /portal/index/protocol.html 1 - /premier/welling/13thmay05.html 4 - /kentleague/deal/Sampson1.html 1 - /kentleague/hernebay/hernvlords111003.html 1 - /wp/wp-includes/wlwmanifest.xml 38 - /wines/168/canapi-grillo-2013 1 - /othernews/SL%20Review%20140805.html 8 - /beckenham/sevenoaks260305.html 5 - /legal/currency/set 2 - /blog 1 https://www.google.com/ /lordswood/hythe200405.html 6 - /FisherFC 2 - /wines/98/adobe-reserva-gewurztraminer-2013 2 - /wines/8/domaine-de-ricaud-entre-deux-mers-2011 2 - /kentleague/greenwich/greenvslade281003.html 2 - /sittingbourne/sittvfolk030404.html 5 - /kentleague/VCD/28thjan04.html 1 - /oldindex.html 1 - /mambo/index.php-option=com_content&task=view&id=763&Itemid=39 1 - /wp2/ 1 - /wines/155/cartlidge-and-browne-pinot-noir-2012 1 - /test/.env 1 - /kentleague/thamesmead/ramsgate190205.html 1 - /mtja.html 1 - /../kentleague/whitstable/4thjuly04.html 2 - /../drmartens.html 3 - /&lang=en 3 - /resources/css/headernav.css 1 - /kentleague/sladegreen/19thsept05.html 4 - /conference/gravesend/17thjan05.html 2 - /kentleague/maidstone/5thnov04.html 3 - /kentleague/beckenham/stansfield080105.html 2 - /deal/dealvcrayfav181003.html 7 - /assets/plugins/file-uploader/server/php/index.php 1 http://www.google.com/ /assets/uploads/content/Bredhurst_Juniors_Bourne_Park_2.jpg 1 - /cache.php 1 - /files/pub_rem.js 2 - /tonbridge/tonbvfolk131203.html 5 - /../kentleague/sevenoaks/bromley020805.html 2 - /vanarama-conference/18 1 - /static/index/js/lk/order.js 2 - /ramsgate/ramsvbeck030404.html 10 - /tonbridge/3rdmar04.html 7 - /../../ryman/bromley/bromvtonb270104.html 3 - /tunbridgewells/deal090205.html 6 - /kentleague/sladegreen/abingdon231004.html 1 - /conference/gravesend/northwich250305.html 1 - /base/exchange_index/changepwdfirst 1 - /../../ryman/bromley/25thsept03.html 2 - /kentleague/sladegreen/29thnov04.html 1 - /plus/bookfeedback.php 1 - /wines/246/montresor-bardolino-2013 1 - /kentleague/lordswood/whitstable120205.html 1 - /VCD/vcdvwhitstable120803.html 6 - /folkestone/folkvchat211003.html 10 - /mambo/index.php-option=com_content&task=view&id=9312&Itemid=38 1 - /dartford/18thsept05.html 9 - /wines/192/septimo-obra-septima-malbec-2012 1 - /kentleague/hernebay/7thsept05.html 1 - /wines/95/emiliana-reserva-riesling-2012 1 - /kentleague/ramsgate/tonbridge290805.html 3 - /apple-touch-icon.png 607 - /othernews/garyjohnson040106.html 1 - /mambo/images/stories/staines%20town's%20pitch%202pm%20tonbridge%20angels.jpg 2 - /kentleague/tunbridgewells/7thnov04.html 1 - /ryman/bromley/cray090405.html 2 - /assets/uploads/content/Bredhurst_Juniors_Bourne_Park_1.jpg 1 - /sladegreen/sladevlord170104.html 6 - /assets/plugins/fileuploader/examples/one-button/php/form_upload.php 1 http://www.google.com/ /../premier/dover/19thoct05.html 2 - /tunbridgewells/erithtown240105.html 8 - /maidstone/whitstable241004.html 8 - /kentleague/maidstone/12thsept05.html 1 - /jiaoyimao/default.css 2 - /shop/.env 1 - /js/app.ling.js 1 - /wines/11/chateau-de-la-nauve-st-emilion-2012 3 - /wines/206/geoff-merrill-mclaren-vale-shiraz-2009-jackos-blend 2 - /kentleague/whitstable/16thjune05.html 1 - /ryman/bromley/ashford151005.html 3 - /wp-config.php.old 1 https://www.google.com/search /wines/224/sancerre-2012-michel-girard-et-fils-375cl-bottle 1 - /erith&belvedere/dartford050205.html 4 - /wines/45/ortas-les-viguiers-ros-2013 1 - /public/web/css/add//index.css 1 - /wp-content/plugins/ioptimizations/IOptimizes.php 2 - /dede/img/admin_top_logo.gif 1 - /erith&belvedere/21stjune05.html 7 - /kentleague/cray/kentleaguecupfinalreport080504A.html 1 - /wines/283/sacred-organic-vodka-70cl 2 - /thamesmead/thamvslad210204.html 11 - /public/wap/js/basis.js 1 - /conference/gravesend/histon050205.html 1 - /kentleague/cray/chatham081204.html 5 - /cray/hbayvcray270304.html 7 - /beckenham/21stnov04.html 6 - /wp-config.php.cust 2 https://www.google.com/search /wp-config.php.9 1 https://www.google.com/search /erith&amp 8 - /kentleague/tunbridgewells/21stjuly04.html 1 - /wines/218/geoff-merrill-reserve-cabernet-sauvignon-2007 2 - /wordpress/wp-includes/wlwmanifest.xml 38 - /admin/jQuery-File-Upload/server/php/index.php 1 http://www.google.com/ /admin/FCKeditor/editor/filemanager/upload/php/upload.php 1 - /../../ryman/bromley/bromvfolk230304.html 3 - /../../kentleague/ramsgate/24thjune05.html 3 - /wines/152/campo-azafran-airen-sauvignon-blanc-2013 1 - /assets/uploads/content/The_FA_Vase_Silverware_2015.png 1 - /kentleague/sladegreen/thamesmead120205.html 1 - /../premier/dover/11thfeb05.html 3 - /DesktopModules/dnnWerk.RadEditorProvider/DialogHandler.aspx/dashboard/UserControl/CMS/Page/Telerik.Web.UI.DialogHandler.aspx 1 - /templets/default/images/logo.gif 2 - /sito/wp-includes/wlwmanifest.xml 37 - /VCD/hythe261105.html 10 - /com_weblinks/models/conhost.php 1 - /assets/uploads/content/Dave_Smith_Lydd_Town.jpg 3 - /assets/uploads/content/Tonbridge_Ladies_2015.jpg 5 - /%20index.php 1 - /wines/80/domaine-de-pellehaut-harmonie-de-gascogne-rouge-2014 2 - /kentleague/thamesmead/15thaug05.html 1 - /wines/271/longbend-pinot-noir-2010 1 - /mambo/ 2 - /wines/32/macon-blanc-terres-secretes-2011 1 - /kentleague/sladegreen/sladevgreen140204.html 1 - /wines/187/domenico-de-bertiol-prosecco 1 - /wordpress/wp-admin/ 2 http://kentishfootball.co.uk/ /cray/crayvtham291003.html 8 - /cscpLoginWeb/scripts/public.js 2 - /...d=6115&Itemid=40 5 - /kentleague/lordswood/sevenoaks291005.html 1 - /kentleague/lordswood/erithtown130805.html 1 - /assets/uploads/content/2015_Women_s_Cup_final_620_x_349.jpg 2 - /sladegreen/tunwells191004A.html 5 - /site/get-hq 2 - /../../kentleague/maidstone/maidvfolk171203.html 3 - /cscpLoginWeb/app/home 1 - /lordswood/lordsvgreen280204.html 5 - /greenwich/ramsgate231104A.html 5 - /kentleague/deal/Sampson19.html 1 - /wines/194/chapel-down-bacchus-2013 1 - /wines/137/de-wetshof-estate-bon-vallon-chardonnay-sur-lie-2013 1 - /kentleague/whitstable/9thjune04.html 1 - /cray/30thapr04.html 8 - /sevenoaks/hernebay161004.html 7 - /js/common.js 2 - /App_Master/Telerik.Web.UI.DialogHandler.aspx 1 - /local/.env 1 - /kentleague/sevenoaks/erithtown261004.html 1 - /wines/276/villa-wolf-riesling-dry-2013 2 - /Template/Mobile/js/main.js 2 - /sporting/sportvlord131203.html 5 - /../../kentleague/hythe/folkestone300705.html 3 - /wines/275/villa-wolf-pinot-gris-2013 1 - /wines/135/the-pavillion-chenin-blanc-viognier-2013 1 - /whitstable/19thaug05.html 7 - /hythe/beckenham110904.html 9 - /sporting/sportvtun081103.html 4 - /kentleague/deal/13thmar05.html 2 - /wines/123/percheron-old-vine-cinsault-2013 2 - /../premier/dover/folkestone280305.html 3 - /whitstable/whitvtham251003.html 12 - /bostik-league/13 1 - /wines/99/montevista-chardonnay-2013 1 - /data/admin/ver.txt 6 - /maidstone/maidvlord271203.html 5 - /wines/62/joseph-perrier-la-cuvee-royale-brut-nv 1 - /dede/templets/article_coonepage_rule.htm 1 - /back/xmlrpc.php 1 - /erith&belvedere/e&bvfolk010104.html 4 - /wines/261/dominio-de-cair-cuvee-2011 1 - /section/google-news-sitemap.gz 2 https://www.google.com/ /folkestone/5thmay05.html 5 - /wines/130/the-bernard-series-mmm-barrel-selection-2012 1 - /api/content_bottom 1 - /wines/112/montevista-sauvignon-blanc-ros-2013 1 - /othernews/fatrophy4thround.html 2 - /cray/crayvtunb271203.html 5 - /sladegreen/lordswood111204.html 6 - /sladegreen/thamesmead261105.html 6 - /kentleague/maidstone/22nddec05.html 1 - /privacy 2 - /api/product/topRank 1 - /kentleague/greenwich/26thaug03.html 1 - /kentleague/deal/Sampson9A.html 5 - /kentleague/greenwich/2nddec04.html 1 - /editor/filemanager/connectors/php/connector.php 1 - /ryman/bromley/cray130805.html 2 - /kentleague/cray/crayvsudb210204.html 2 - /lordswood/15thaug04.html 6 - /kentleague/sevenoaks/dealtown250904.html 1 - /conference/margate/17thaug05.html 1 - /wines/23/chassagne-montrachet-rouge-vieilles-vignes-bernard-moreau-2010 1 - /../../kentleague/whitstable/1stdec05.html 2 - /kentleague/ramsgate/erith070205.html 1 - /sittingbourne/fisher160804.html 7 - /sevenoaks/maidstone301004.html 8 - /template/920ka/js/woodyapp.js 1 - /kentleague/deal/Sampson14.html 1 - /wines/69/bollinger-nv 1 - /wines/67/joseph-perrier-la-cuvee-royale-brut-375cl-bottles 1 - /chatham/ChatvSitt010104a.html 6 - /core/.env 1 - /Pc/Lang/index.html 1 - /cq/css/cssy.css 1 - /wines/148/vetiver-rioja-blanco-2012 1 - /user/allroleinfo 1 - /feed 3 - /othernews/charltonladies27thaug03.html 5 - /js/fckeditor/editor/filemanager/browser/default/connectors/php/connector.php 1 - /ashford/19thmar04.html 5 - /cray/crayvhythekstfinal170404.html 8 - /.well-known/security.txt 5 - /kentleague/deal/Sampson2.html 1 - /backup/xmlrpc.php 1 - /conference/margate/maldon200805.html 1 - /whitstable/whitstablevdeal250803.html 7 - /mambo/images/M_images/emailButton.png 2 - /Public/css/hall.css 2 - /kentleague/cray/klpdcupfinalpreview050504A.html 1 - /wines/163/gpg-delle-venezie-garganega-pinot-grigio-2013 3 - /bk/ 1 - /wines/104/tabali-reserva-especial-pinot-noir-2012 2 - /greenwich/greenvslade281003.html 5 - /views/home/home.js 1 - /erith&belvedere/8thsept04.html 5 - /cray/crayvgree061203.html 5 - /chatham/dartford270905.html 10 - /thamesmead/ramsgate190205.html 6 - /static/index/css/iindex.css 2 - /Content/common/web/CommonActivity.css 2 - /laravel/_ignition/health-check/ 1 - /../kentleague/ramsgate/bromley230705.html 2 - /kentleague/VCD/25thnov05.html 1 - /../ryman/bromley/margate221105.html 2 - /kentleague/sladegreen/sportingbengal290105.html 1 - /kentleague/sevenoaks/26thjuly05.html 1 - /mh/phone.do 1 - /template/js/comm/Confrim.js 1 - /ryman-league 1 - /VCD/19thaug04.html 7 - /wines/214/devils-corner-riesling-2013 1 - /admin/webadmin.php 1 - /Wap/JS/wap-index.js 1 - /kentleague/maidstone/15thapr05.html 1 - /wines/10/chateau-rivensan-2011 1 - /css/album.css 3 - /folkestone/fisher071105.html 6 - /assets/uploads/content/Stuart_Zanone_signs_new_Ashford_.jpg 1 - /wines/267/westwell-classic-ferment-2013 2 - /assets/uploads/content/Scott_Whibley_Phoenix_Sports.jpg 1 - /Scripts/common.js 2 - /wines/63/joseph-perrier-la-cuvee-royale-ros-nv 1 - /kentleague/cray/23rdmar05.html 6 - /%22 9 - /admin.php 1 - /_wpresources/RadEditorSharePoint/7.9.0.0__2ee8da07702253f7/Resources/Telerik.Web.UI.DialogHandler.aspx 1 - /mambo/index.php-option=com_content&task=view&id=2738&Itemid=38 2 - /blog/wp-includes/wlwmanifest.xml 38 - /cray/crayvsporting160803.html 14 - /sevenoaks/beckenham131104.html 8 - /wines/66/joseph-perrier-cuvee-royale-brut-ros-nv-375cl-bottle 1 - /lordswood/lordsvbeckfavase200903.html 7 - /wp-config.php.backup 1 https://www.google.com/search /whitstable/whitstablevlordswood130903.html 5 - /thamesmead/18thnov04.html 6 - /humans.txt 2 - /kentleague/lordswood/dealvlord230304.html 1 - /old-index.php 2 - /kentleague/erithtown/29thjan05.html 1 - /feed.xml 2 - /audio/.env 1 - /wines/200/turkey-flat-butchers-block-shiraz-grenache-mourvedre-2012 1 - /cray/crayresvwhitreskicfinal290404.html 9 - /assets/res/mods/room.js 1 - /whitstable/9thjune04.html 6 - /templets/default/style/dedecms.css 3 - /section/googlenews 2 https://www.google.com/ /assets/.cache.idx.php 1 - /wines/40/rasteau-cotes-du-rhone-villages-tradition-2012 1 - /cray/1stmay04A.html 5 - /deal/dealvcray011103.html 8 - /dartford/dartvfolk240204.html 9 - /xmlrpc.php 127 - /wines/75/duc-de-morny-2013 1 - /wp-config.php.bak1 2 https://www.google.com/search /kentleague/beckenham/whitstable130805.html 1 - /editor/fckeditor.js 1 - /wines/158/burlesque-white-zinfandel-ros-2013 2 - /static/home/static/js/login.js 1 - /sevenoaks/erithtown060905.html 10 - /hythe/KSTFinalPreview160404.html 5 - /wp-config.php_orig 1 https://www.google.com/search /tpl/user/tpl1/css/skins/blue.css 1 - /wines/189/conviviale-primitivo-2012 2 - /security.txt 5 - /sladegreen/whitstable210804A.html 7 - /wines/247/latium-morini-campo-dei-ciliegi-valpolicella-ripasso-2011 2 - /docs/ 1 - /ajax/allcoin_a/id/0 1 - /kentleague/VCD/vcdvwhitstable120803.html 1 - /sladegreen/lordswood021004.html 7 - /nasdasilva11 2 - /FCK/fckeditor.js 1 - /kentleague/tunbridgewells/8thmar05A.html 1 - /api/common/getConfig 1 - /wines/134/the-pavillion-shiraz-viognier-2013 1 - /dev/ 1 - /assets/uploads/content/Bromley_2035_against_Boreham_Woo.jpg 1 - /thamesmead/12thjuly05.html 6 - /FCKeditor/editor/filemanager/connectors/asp/connector.asp 4 http://kentishfootball.co.uk/FCKeditor/editor/filemanager/connectors/asp/connector.asp /dup-installer/main.installer.php 1 - /__connect_hash__mutation_observer__/frame/public/test 2 http://kentishfootball.co.uk/latest-fixtures /wines/195/chapel-down-english-ros-2013 1 - /site/wp-includes/wlwmanifest.xml 37 - /kentleague/ramsgate/AFCWimbledon151105.html 2 - /assets/select2/docs/_includes/announcements-4.0.html 1 - /wines/108/nostros-reserva-sauvignon-blanc-2013 2 - /wines/252/domaine-de-la-vieille-julienne-cotes-du-rhone-2006 3 - /base/exchange_article/index/classid/1/id/1 2 - /kentleague/VCD/25thjune05.html 1 - /lordswood/lordvseve061203.html 7 - /blog/images/index.php 1 - /static/wap/js/common.js 1 - /wines/6/chateau-argadens-bordeaux-superieur-2008 2 - /include/taglib/help/flink.txt 1 - /lordswood/maidstone271205.html 5 - /sladegreen/sladevbeck011103.html 4 - /leonsoloman 2 - /maidstone/18thmay05.html 9 - /cray/crayvrams081103.html 7 - /assets/uploads/content/Stanseld_s_Second_Goal_part_2.jpg 1 - /wines/274/adobe-reserva-carmenere-2013 2 - /_ignition/health-check/ 1 - /hernebay/20thjan05.html 6 - /kentleague/ramsgate/AFCWimbledon121105.html 1 - /kentleague/sladegreen/thamesmead050205.html 1 - /wines/111/signos-de-origen-chardonnay-marsanne-viognier-and-roussanne-2012 2 - /kentleague/deal/Samspon11.html 1 - http://kentishfootball.co.uk:80/mambo/index.php 2 - /kentleague/beckenham/tunwells120205.html 1 - /ElliottMcmanus 2 - /old-wp/ 1 - /ryman.html 3 - /FR_Babs 2 - /wines/151/ramon-bilbao-monte-blanco-rueda-verdejo-2013 1 - /bostik-league/32 5 - /mambo/images/stories/slatter%20and%20mccarthy%20in%20royal%20box.jpg 2 - /wines/113/dr-loosen-riesling-2013 2 - /cray/4thmar04.html 9 - /admin 1 - /wines/243/ramon-bilbao-gran-reserva-2006 2 - /kentleague/ramsgate/maidstone290105.html 1 - /kentleague/lordswood/deal111005.html 1 - /gravesend/9thmay04.html 5 - /kentleague/maidstone/7thjuly04.html 4 - /newssitemap.xml 2 https://www.google.com/ /ramsgate/maidstone290105.html 7 - /kentleague/VCD/22ndjune05.html 1 - /room/getRoomBangFans 1 - /mambo/images/banners/BrowningsRemovals.jpg 6 - /assets/uploads/content/2015_Women_s_Cup_final_2_620_x_3.jpg 1 - /news-sitemap.xml 2 https://www.google.com/ /sittingbourne/tonvsitt060304.html 7 - /tunbridgewells/ramsgate301004.html 5 - /wines/295/joseph-perrier-cuve-josphine-2004 1 - /tunbridgewells/tunverith111003.html 6 - /lordswood/lordvdeal191103.html 6 - /kentleague/sladegreen/8thaug05.html 1 - /sittingbourne/28thaug03.html 6 - /kentleague/sladegreen/maidstone200805.html 1 - /Public/initJs.php 1 - /i/notifications 2 - /v1/ 1 - /dashboard/UserControl/CMS/Page/Telerik.Web.UI.DialogHandler.aspx 2 - /2019/ 1 - /DesktopModule/UIQuestionControls/UIAskQuestion/Telerik.Web.UI.DialogHandler.aspx 2 - /cray/klpdcupfinalpreview050504A.html 9 - /bak/ 1 - /www/.env 1 - /_wpresources/RadEditorSharePoint/6.7.1.0__1f131a624888eeed/Resources/telerik.web.ui.dialoghandler.aspx 1 - /tunbridgewells/whitstable140804A.html 6 - /tmp/ 1 - /thamesmead/sladegreen080105.html 6 - /beckenham/vcd220305.html 7 - /cray/crayvdeal200304.html 7 - /../premier/dover/2ndjan06.html 2 - /api/user/ismustmobile 2 - /kentleague/beckenham/westwickham271104.html 1 - /kentleague/hythe/beckenham110904.html 1 - /news-sitemap.xml.gz 2 https://www.google.com/ /public/admin/assets/plugins/plupload/examples/upload.php 1 http://www.google.com/ /wines/26/macon-villages-vins-auvigue-2012 2 - /docs.css 1 - /base/exchange_index/googlecode 2 - /mambo/images/banners/Tradefit.jpg 2 - /wines/70/laurent-miquel-prive-viognier-2012 1 - /wines/190/collefrisio-pecorino-2012 1 - /xmlrp.php 1 www.google.com /../premier/dover/16thjan05A.html 2 - /wines/19/domaine-faiveley-echezaux-grand-cru-2008 1 - /kentleague/greenwich/20thjuly03.html 1 - /folkestone/chatvfolk200304.html 5 - /ryman/bromley/ashford151105.html 3 - /Front/User/UserLogin.html 1 - /kkrps/im_group/show_members 1 - /ryman/bromley/bromvfolk230304.html 5 - /api/user/info 2 - /../../kentleague/maidstone/7thjuly04.html 2 - /kentleague/sladegreen/2ndjuly03.html 4 - /assets/uploads/content/Sean_Francis_scores_Bromley_s_fi.jpg 1 - /test 4 - /kentleague/maidstone/maidvwhit170204.html 1 - /wines/254/chateau-bel-air-2009 1 - /plugins/file-uploader/server/php/index.php 1 http://www.google.com/ /kentleague/lordswood/winchester280804.html 1 - /wines/100/emiliana-merlot-2013 1 - /conference/gravesend/26thoct05G.html 1 - /beckenham/sladegreen180904.html 7 - /wines/77/domaine-de-pellehaut-harmonie-de-gascogne-blanc-2014 3 - /greenwich/2nddec04.html 7 - /kentleague/cray/20thapr04A.html 1 - /DesktopModules/YA.Controls/AngularMain/Telerik.Web.UI.DialogHandler.aspx 2 - /assets/uploads/content/Eastleigh_celebrate_Conference_S.png 1 - /public/assets/file-uploader/server/php/index.php 1 http://www.google.com/ /cray/greenwichvcray060903.html 5 - /Components/General/Admin/UserControl/Telerik.Web.UI.DialogHandler.aspx 2 - /protected/.env 1 - /plus/img/wbg.gif 1 - /js/home.js 2 - /maidstone/23rdsept05.html 8 - /ws/index/getTheLotteryInitList 1 - /greenlightsom 2 - /wines/37/chateau-fuisse-pouilly-fuisse-tete-de-cru-2011 1 - /kentleague/VCD/31stjan04.html 3 - /kentleague/ramsgate/tonbridge020106.html 3 - /sevenoaks/17thfeb05.html 9 - /sladegreen/hernebay090405.html 6 - /assets/uploads/content/Sevenoaks_Powerchair_Football.jpg 4 - /premier/welling/23jan04.html 4 - /system/.env 1 - /mambo/index.php 3118 http://kentishfootball.co.uk/ /tncms/sitemap/news.xml.gz 2 https://www.google.com/ /register.asp 1 - /ads.txt 34 - /api/v1/borrowxx.html 1 - /wines/154/borsao-garnacha-2013 1 - /mambo/images/stories/fleet%20fans%20at%20stevenage.jpg 2 - /data/cache/inc_catalog_base.inc 1 - /template/tmp1/js/common.js 1 - /mambo/index.php-option=com_content&task=view&id=1050&Itemid=40 2 - /ryman/bromley/folkestone290805.html 5 - /wines/44/ortas-les-viguiers-2012-rouge 1 - /blog/.env 2 - /Admin/Telerik.Web.UI.DialogHandler.aspx 2 - //news/lukerooney030421 1 http://kentishfootball.co.uk/contact/ /../kentleague/maidstone/23thjan04.html 2 - /sittingbourne/sittvfish120404.html 4 - /wines/249/quinta-do-portal-colheita-2012 2 - /wines/208/geoff-merrill-reserve-chardonnay-2011 1 - /VCD/deal101105.html 6 - /../premier/dover/tonbridge301004.html 3 - /kentleague/beckenham/18thmay05.html 1 - /sitemap.xml.gz 2 https://www.google.com/ /wines/22/la-pierrelee-chablis-2012 2 - /lordswood/Hernebay200805.html 7 - /LJconservation 2 - /config2.php 1 - /lordswood/thamesmead300305.html 5 - /404.php 1 - /../premier/dover/22jan04.html 3 - /wines/21/chablis-2012-gilbert-picq-ses-fils 2 - /kentleague/maidstone/10thjuly03.html 1 - /kentleague/deal/Sampson20.html 2 - /DesktopModules/TNComments/Telerik.Web.UI.DialogHandler.aspx 2 - /install.php 1 - /../premier/welling/23jan04.html 2 - /news_sitemap.xml.gz 2 https://www.google.com/ /../../kentleague/whitstable/plaayacupfinal04.html 3 - /kentleague/thamesmead/11thfeb05.html 1 - /GBoroughfc 2 - /wines/290/maxime-trijol-vsop-cognac-grand-champagne-70cl 1 - /wines/256/chateau-cambon-la-pelouse-2009 2 - /assets/file-uploader/server/php/index.php 1 http://www.google.com/ /about 2 - /website/wp-includes/wlwmanifest.xml 37 - /modules/shop/manage/telerik.web.ui.dialoghandler.aspx 2 - /kentleague/maidstone/9thsept04.html 4 - /sittingbourne/chatham151005.html 6 - /resources/main/common.js 1 - /wines/84/j-m-despres-la-madone-fleurie-vieilles-vignes-2011 2 - /js/base1.js 2 - /wp-config.php.a 1 https://www.google.com/search /js/base.js 2 - /greenwich/Greevlord130104.html 7 - /admin/FCKeditor/editor/filemanager/browser/default/connectors/php/connector.php 1 - /wines/133/the-pepper-pot-2013 1 - /sladegreen/30thdec05.html 8 - /lordswood/whitstable120205.html 10 - /../../conference/margate/fisher241005.html 2 - /wines/58/turckheim-reserve-gewurztraminer-2012 1 - /kentleague/maidstone/maidvfolk171203.html 5 - /hernebay/hernvslad061203.html 7 - /kentleague/tunbridgewells/thamesmead011204.html 1 - /index.php/sign 1 - /conference/gravesend/10thoct05G.html 1 - /tonbridge/18thjune05.html 5 - /chatham/chatvdart120404.html 4 - /../../kentleague/ramsgate/deres160705.html 2 - /news_sitemap.xml 2 https://www.google.com/ /sladegreen/sladevgreen140204.html 6 - /assets/uploads/content/Hollands_Blair_Rob_Denness.jpg 1 - /../../kentleague/ramsgate/25thjan04.html 2 - /ashford/ashvsitt240204.html 8 - /room/script/face.js 1 - /theme/assets/global/plugins/jquery-file-upload/server/php/index.php 1 http://www.google.com/ /kentleague/sladegreen/readingreplay310804.html 1 - /kentleague/ramsgate/lymington261105.html 1 - /ryman/bromley/bromvdartksc071003.html 5 - /greenwich/3rdsept04.html 12 - /imgres 4 - /sittingbourne/22ndsept05.html 8 - /maidstone/maidvslade251003.html 8 - /sladegreen/sladeverit100404.html 6 - /2016/wp-includes/wlwmanifest.xml 7 - /beckenham/2ndjune05.html 5 - /fckeditor/editor/filemanager/upload/php/upload.php 1 - /kentleague/sladegreen/whitstable210804A.html 1 - /sevenoaks/sladegreen221105.html 7 - /backend/.env 1 - /kentleague/cray/5thnov04.html 2 - /kentleague/sladegreen/deal061104.html 1 - /kentleague/ramsgate/deres160705.html 5 - /KentishFootie/moments 2 - /tunbridgewells/7thoct05.html 6 - /kentleague/hythe/hythevslade081103.html 1 - /kentleague/sevenoaks/23rdjune05.html 1 - /kentleague/sladegreen/21stsept05.html 1 - /wines/55/sancerre-2011-langlois-chateau 2 - /wines/289/maxime-trijol-xo-cognac-grand-champagne-70cl 2 - /googleNews.xml 2 https://www.google.com/ /erith&belvedere/chatham300804.html 3 - /assets/uploads/content/London_Corinthians_Squad.png 2 - /kentleague/ramsgate/15thjuly05.html 3 - /assets/admin/plugins/jQuery-File-Upload/server/php/index.php 1 http://www.google.com/ /kentishfootball.co.uk/.env 1 - /../../kentleague/cray/chatham081204.html 2 - /wines/169/canapi-ros-2013 2 - /beckenham/erithtown191004.html 10 - /wines/38/chablis-1er-cru-cote-de-lechet-2011 1 - /sladegreen/sladevhyth130304.html 8 - /api/user/get_user_group 2 - /mambo/index.php-option=com_content&task=view&id=3225&Itemid=38 3 - /kentleague/ramsgate/molesey170905.html 1 - /kentleague/whitstable/1stdec05.html 4 - /tunbridgewells/erithtown201104.html 6 - /wines/33/domaine-faiveley-mercurey-clos-rochette-2010 1 - /member/images/base.css 1 - /kentleague/beckenham/18thjune05.html 1 - /sevenoaks/tunwells170804.html 5 - END_SIDER_404 # Host - Pages - Hits - Bandwidth - Last visit date - [Start date of last visit] - [Last page of last visit] # [Start date of last visit] and [Last page of last visit] are saved only if session is not finished # The 25 first Hits must be first (order not required for others) BEGIN_VISITOR 4404 64.62.252.176 8787 8788 32160772 20210427154302 66.160.140.179 7934 7943 43438394 20210427120949 66.160.140.183 4684 4684 21084697 20210427091008 64.62.252.162 1306 1306 8227371 20210429002528 54.237.48.16 1251 1253 6712213 20210425224135 64.62.252.174 677 677 3282443 20210424224335 66.160.140.184 622 622 3117873 20210428072508 34.78.71.103 532 538 2351184 20210428063117 86.186.65.21 420 450 4221047 20210418210107 188.223.55.63 389 508 10085738 20210424113028 77.101.180.229 304 1665 614227038 20210430182703 157.90.240.42 259 261 1331858 20210402022457 23.100.232.233 256 2034 12831368 20210430141604 65.21.62.9 251 253 1482938 20210402020645 65.21.53.226 245 253 1541842 20210402010300 86.146.213.176 219 261 6496240 20210430230016 65.21.62.14 211 216 1718489 20210402024430 157.90.175.86 208 212 1286342 20210402004043 135.181.100.249 207 207 1001978 20210402020148 135.181.90.43 199 199 899850 20210402032553 168.119.249.195 193 198 1814925 20210401211245 135.181.90.69 191 196 1315036 20210402024250 95.216.191.72 188 188 868093 20210402025227 157.90.175.70 186 191 1191530 20210401222217 157.90.175.151 185 191 1411121 20210402014933 109.169.34.10 0 1 244872 82.132.233.52 2 5 15135 20210422190744 79.66.130.89 1 18 4920357 20210409191748 103.1.93.159 12 12 44420 20210430013446 118.172.181.147 1 1 12126 20210414153217 182.253.247.220 2 2 13013 20210424050944 217.41.52.82 1 18 4920814 20210428001823 92.40.170.184 1 2 4835440 20210420080931 176.251.25.29 2 25 5081266 20210424184750 192.0.101.218 0 1 124602 86.173.203.175 8 50 10084333 20210424083557 113.128.65.243 2 2 12203 20210404021424 5.64.58.227 1 17 4920060 20210409185612 82.26.201.82 6 27 19679682 20210412181842 85.255.233.8 1 18 4921020 20210428102535 92.40.174.17 1 1 3456 20210423153146 94.194.214.246 1 24 5076698 20210430082930 143.198.128.13 3 3 26628 20210427014952 79.73.40.213 1 18 4920659 20210424231317 35.203.142.83 2 2 0 20210412175337 201.50.47.169 2 2 13019 20210424015624 185.220.100.245 3 3 24329 20210402205558 116.203.138.16 24 24 358236 20210409025650 92.90.121.8 8 31 5190489 20210415173928 81.129.63.52 1 23 5060091 20210429193836 151.226.56.177 1 2 248442 20210416065832 2.96.168.164 2 20 200644 20210416000040 42.194.129.20 2 2 12203 20210415232931 185.79.243.153 2 2 12203 20210427104827 140.82.49.153 1 1 12126 20210402173431 90.215.252.58 4 21 4931364 20210429180206 173.252.127.31 0 4 18681 86.185.130.139 2 19 162704 20210430183655 82.129.99.122 1 18 4920659 20210424223236 213.205.240.27 1 18 4922376 20210410091452 87.117.58.76 2 2 12203 20210414195030 123.6.49.38 1 1 3600 20210422095340 184.65.204.201 19 80 15047036 20210423005806 81.153.141.148 3 22 5043629 20210411084423 86.145.190.130 1 18 4919999 20210415165227 2.120.227.29 1 18 4921096 20210413015424 84.67.80.99 2 21 4984908 20210425015012 142.4.217.87 3 3 10847 20210430150602 59.63.48.74 2 2 13019 20210424013916 90.206.89.75 7 7 24751 20210423122921 94.12.184.201 47 111 5366716 20210429065009 82.28.189.118 119 1932 440392169 20210430175123 103.76.241.214 2 2 12203 20210415173417 86.136.163.255 38 317 65577981 20210430171209 35.233.163.166 2 2 0 20210422220125 168.90.199.63 1 1 8039 20210426175723 90.205.51.66 1 1 3318 20210407193251 86.139.69.102 3 20 4916718 20210413214009 2.120.21.42 1 18 4920566 20210405182005 62.68.171.117 1 2 4835305 20210402184747 46.65.106.220 1 18 4920796 20210426133534 109.155.112.30 3 3 10954 20210422161541 2.219.158.29 1 4 119927 20210410220625 95.143.21.114 3 3 24329 20210401140602 89.201.195.205 2 2 12197 20210420193017 81.100.174.62 1 20 4973509 20210424213228 90.200.35.37 3 23 4956680 20210412181721 52.114.75.216 0 1 244872 146.199.208.108 1 17 4905604 20210416152855 181.92.34.67 2 2 12203 20210403164620 92.40.174.79 1 1 3617 20210403160915 3.89.118.32 1 1 3864 20210422142337 74.71.105.180 4 11 164906 20210412214457 103.204.109.157 2 2 16078 20210419094257 82.132.239.220 1 18 4920566 20210406072307 5.66.255.69 1 18 4921526 20210410223900 213.107.3.145 1 18 4920434 20210404152913 81.107.235.189 2 36 9841062 20210424215851 86.174.131.255 1 22 5031508 20210418114930 34.209.105.222 1 1 3570 20210416144457 92.233.78.123 1 13 106406 20210430045120 213.166.78.98 2 2 21895 20210408101844 82.132.217.136 1 1 3389 20210406164725 86.11.32.84 1 20 4945613 20210411212417 117.89.128.231 2 2 13019 20210424023031 78.86.190.231 1 4 3602 20210424082042 109.152.97.46 1 1 3660 20210418231855 213.205.240.64 3 3 18435 20210425101951 188.122.82.146 9 9 71721 20210428200902 176.248.102.43 1 1 3622 20210403121343 195.33.240.222 2 2 12203 20210402100827 104.244.74.28 2 2 12203 20210407212559 112.169.112.242 2 2 6538 20210415193223 86.170.90.138 1 18 4922157 20210427003342 138.197.171.207 2 2 12203 20210427200455 82.132.214.123 2 22 9809124 20210424233939 118.92.239.47 2 2 12203 20210401205200 90.215.169.32 3 20 4928666 20210422231936 80.192.139.250 93 138 10528565 20210427112225 86.173.204.252 2 7 4899902 20210405144215 195.224.173.162 1 18 4921797 20210419161533 3.250.154.70 1 1 3456 20210422201238 113.128.65.231 2 2 12203 20210405184112 82.132.224.12 1 1 3617 20210403160126 90.193.57.214 1 5 4844359 20210405155210 109.153.29.104 1 20 4973448 20210425133758 66.249.80.173 1 1 4039 20210413171548 23.229.90.90 0 3 21507 109.249.187.95 1 18 4920796 20210422135435 86.105.49.141 1 1 3867 20210404205622 42.236.10.91 0 1 654 151.227.48.50 1 1 3600 20210421224304 86.140.160.191 23 42 4994942 20210405223725 79.78.68.27 3 43 10033155 20210417181432 86.154.84.14 5 30 10008608 20210415210946 36.56.190.163 2 2 12203 20210405064135 193.70.81.134 2 2 12203 20210427140052 82.132.185.181 1 1 3527 20210402194351 82.132.185.158 1 4 4855925 20210426191330 90.198.255.161 1 18 4920875 20210413151911 86.18.64.183 1 19 5016304 20210407062659 109.156.61.55 4 42 9969738 20210425151005 94.8.93.105 1 18 4921526 20210409201839 180.241.31.246 2 2 12203 20210416233521 82.132.233.7 2 2 7230 20210420213128 86.180.147.74 1 18 4920357 20210409191449 92.40.200.148 1 21 5179477 20210428020924 171.97.85.15 2 2 12203 20210408221311 92.29.103.127 0 1 244872 54.36.24.226 2 2 12203 20210427174128 180.165.231.178 2 2 12203 20210417181456 185.220.100.247 1 1 12126 20210421155231 86.18.162.180 1 18 4922006 20210406232227 82.132.187.196 1 7 38147 20210429175544 51.19.8.174 2 19 4926068 20210409212630 90.193.115.26 0 17 4162824 85.255.237.203 3 13 4878213 20210406132054 2.223.56.49 1 14 3530 20210405171428 81.6.43.167 2 2 12203 20210414082645 18.236.164.8 1 1 18570 20210423192300 176.24.2.225 1 18 4920434 20210403142434 173.208.147.2 0 1 22277 157.90.240.64 48 54 701611 20210402012358 86.21.245.175 1 18 4921338 20210402191942 176.248.7.135 2 36 9840899 20210407213445 117.212.93.157 2 2 12203 20210409152608 45.120.49.209 2 2 16078 20210418092309 82.14.92.82 1 16 56630 20210425191741 185.255.96.99 1 1 12126 20210415235528 86.133.2.86 1 1 4923 20210412194031 90.193.11.6 28 256 54937847 20210429071249 198.12.229.106 1 1 13314 20210427081320 35.244.74.21 4 4 39756 20210414034120 94.6.190.13 19 148 39874859 20210429203616 86.170.172.21 1 1 3487 20210428192918 85.255.237.60 2 2 9846 20210417042025 82.132.225.179 1 18 4920796 20210422170307 77.102.176.28 1 18 4920749 20210422205433 95.148.28.8 4 27 5090916 20210430192826 89.248.174.173 5 5 17582 20210414140132 196.240.143.90 2 2 16078 20210429155409 64.62.252.163 54 54 181313 20210413061308 65.21.62.17 112 116 816671 20210401234836 86.191.211.157 1 18 4921234 20210417183111 90.251.7.4 2 19 4924726 20210422194033 213.104.127.48 5 8 4966520 20210411025842 81.141.115.158 3 32 9799661 20210425134449 54.189.230.128 1 1 3378 20210401004354 177.72.115.130 2 2 12203 20210408055430 85.255.235.143 1 18 4930081 20210402151702 90.220.250.5 1 22 5031471 20210411202140 66.249.93.219 4 4 30016 20210419031503 135.181.252.234 1 1 9295 20210428140233 109.158.211.32 4 25 5043670 20210422183339 199.34.89.7 0 1 568 13.66.139.39 0 1 1248 78.46.204.118 94 98 719630 20210402021507 188.28.84.175 1 17 4917642 20210405152256 182.52.19.159 2 2 12203 20210411173431 51.79.77.165 9 9 33286 20210423022350 92.40.179.51 2 9 4945400 20210427080117 81.154.111.4 3 59 15134174 20210425185657 177.30.63.43 2 2 12197 20210428230413 86.154.105.119 1 18 4920406 20210405213016 148.252.133.178 1 4 34139 20210420113615 34.84.247.132 1 1 17371 20210412220242 86.189.243.95 1 21 5014960 20210418194456 144.217.135.182 13 13 215553 20210430161015 80.225.23.63 1 17 4913467 20210402160443 92.40.173.208 1 18 4921816 20210418235252 173.252.127.117 0 7 112172 109.158.156.120 1 9 80820 20210425084238 2.126.58.15 4 44 9959312 20210410230142 200.5.203.58 2 2 12203 20210402113153 34.75.155.73 1 24 5076644 20210430175637 79.78.74.55 2 46 10120166 20210427083933 212.188.166.162 1 18 4920806 20210427141729 92.40.178.220 2 2 8175 20210420225634 213.205.194.36 5 16 5027311 20210430155214 90.215.245.120 6 22 4937638 20210422223102 80.229.253.184 1 18 4920349 20210425175737 110.93.150.136 0 1 7195 90.210.45.182 6 46 9974545 20210416183946 146.200.176.90 3 22 4928152 20210403092649 85.255.237.25 1 9 4988715 20210423214727 109.73.112.71 8 9 30793 20210428112750 94.15.32.155 1 20 5036805 20210411102032 2.29.246.180 6 63 14773215 20210408124853 109.150.98.110 1 1 3541 20210427232725 85.255.235.44 5 7 119331 20210424174148 80.88.201.218 3 5 9674414 20210413171217 2.97.162.191 1 18 4920509 20210406171551 86.162.116.178 1 19 5072780 20210426220936 179.108.123.210 2 2 12203 20210417025818 36.25.174.133 2 2 12203 20210408070223 86.138.82.103 32 78 10194382 20210415070615 5.70.133.253 11 53 10038080 20210425123317 90.194.235.246 3 3 10108 20210407111542 86.148.236.57 1 18 4920509 20210406131458 27.19.192.67 1 8 47461 20210417215909 85.115.53.201 3 24 5040470 20210413134552 90.203.81.84 26 53 19755470 20210427163259 54.70.53.60 1 18 4920509 20210406144216 86.182.34.129 2 2 7082 20210426234239 92.40.174.111 1 2 4835187 20210424162326 68.234.46.143 1 1 9586 20210429124311 86.128.233.244 26 241 55029233 20210418114144 178.70.76.77 2 2 12203 20210405003603 88.255.102.57 2 2 12203 20210418050232 86.146.185.32 2 23 5036380 20210419085540 86.139.173.200 1 18 4922382 20210424130506 82.37.19.165 1 19 76854 20210424214330 42.236.10.113 0 1 13806 172.96.87.2 0 1 1286 90.206.241.126 17 36 215539 20210430165916 90.251.53.17 1 18 4920289 20210402175704 217.160.175.170 1 1 3487 20210429174337 182.253.191.106 4 4 12466 20210405091959 86.171.47.93 1 8 48354 20210424225956 109.146.199.149 1 1 3627 20210416111744 87.115.40.143 1 18 4920509 20210405162848 209.159.150.78 2 2 24252 20210428022140 151.231.128.162 4 7 9770981 20210429210336 90.209.110.21 2 36 9840700 20210409200443 192.210.185.198 1 1 10627 20210405120833 95.148.69.23 2 15 4852623 20210422135458 82.3.46.99 1 18 4921350 20210409223523 49.234.43.244 0 2 17121 80.42.197.215 2 12 4916405 20210425072502 64.246.165.50 1 1 3602 20210420072949 83.30.26.251 1 18 4922351 20210428101945 164.132.177.100 1 1 3329 20210424202724 188.220.91.231 2 38 9894309 20210424234943 94.2.29.7 167 229 7072830 20210409142303 77.98.124.137 67 95 534771 20210430213413 117.204.253.100 2 2 12203 20210406084509 52.3.228.78 2 10 50090 20210419031537 122.168.110.168 1 1 3487 20210429061756 54.246.182.174 1 1 3290 20210402200729 69.4.90.19 0 1 13806 81.153.231.227 5 9 23226 20210406073306 211.249.46.113 1 1 2532 20210404034256 82.132.224.51 1 18 4920887 20210408133839 51.77.246.199 1 24 5076644 20210430161131 81.178.132.148 5 8 212408 20210412085804 2.121.92.102 1 18 4920493 20210404064213 86.162.80.92 5 37 10094857 20210427081719 168.119.163.24 102 110 1261286 20210402023457 114.111.32.21 1 1 3575 20210416192150 138.199.36.150 3 3 36081 20210422053337 138.99.7.226 2 2 12203 20210421124610 62.6.174.2 1 18 4920698 20210426084716 109.148.108.42 1 18 4920406 20210405142200 85.255.233.19 1 5 4835231 20210409163637 2.220.253.166 1 18 4920509 20210405152805 46.69.71.160 2 25 4990088 20210428175921 110.93.150.186 1 1 3495 20210430171617 90.208.156.134 2 19 4923670 20210405141838 110.77.196.64 4 4 37593 20210418181053 123.160.221.17 2 2 3583 20210414215556 82.132.242.97 2 6 48671 20210418213901 82.22.123.14 20 37 4979981 20210412093650 200.215.171.238 2 2 12203 20210415132804 2.220.192.191 8 24 33992631 20210409173932 45.91.202.155 3 3 24329 20210422160027 64.64.232.133 1 22 5031494 20210414091053 92.40.174.147 1 7 4857503 20210410122716 176.107.185.74 4 4 36455 20210427085812 93.158.90.144 1 1 3435 20210401234442 112.221.46.117 2 2 12203 20210405144350 123.160.221.7 2 2 3503 20210411223247 204.101.61.82 19 19 158100 20210426203037 86.132.12.224 2 2 6870 20210401200338 86.20.42.140 1 20 4973511 20210425122255 81.156.111.74 2 48 10153280 20210430122719 92.40.176.85 1 5 4885886 20210405154426 5.2.76.221 1 1 12126 20210427173726 117.67.143.21 2 2 12203 20210402014701 87.80.210.190 1 1 8922 20210418141319 54.165.232.66 3 3 9870 20210402205823 92.118.160.13 1 1 13769 20210424051641 86.140.215.113 3 22 4927239 20210405140333 86.183.144.250 1 3 114137 20210416123717 45.153.160.131 1 1 12126 20210408023127 174.232.142.230 1 18 4920715 20210428012849 86.129.224.158 2 20 5011393 20210405150137 203.150.156.169 2 2 12203 20210401123727 167.114.1.197 7 7 29105 20210412175759 109.155.115.48 1 1 3389 20210406123242 45.128.133.242 1 1 12126 20210404230341 79.78.72.111 2 38 9808138 20210405083621 125.25.165.17 1 1 12942 20210424023839 148.252.129.16 2 38 9924577 20210426124928 90.206.95.34 34 37 329018 20210422211132 176.255.85.211 1 18 4920566 20210405213529 86.152.238.110 4 10 9842208 20210430083343 143.198.106.76 1 1 3456 20210422223120 109.155.112.101 1 1 3641 20210413154601 14.215.212.37 1 1 12126 20210416022301 86.171.225.168 1 18 4920414 20210409161801 82.132.227.228 1 1 3600 20210421155513 86.170.248.133 1 14 3617 20210403140054 95.146.151.207 1 16 115789 20210425133953 92.20.252.130 1 18 4920659 20210425124852 80.73.84.106 2 2 12203 20210414024037 90.203.237.24 1 1 3377 20210401140527 157.90.171.23 95 98 634976 20210402030249 107.173.246.150 0 1 921 86.179.174.102 1 18 4920659 20210424223021 185.114.224.107 11 50 10081178 20210413165408 86.163.63.30 1 18 4920493 20210403121845 92.1.64.4 1 3 38710 20210402102454 213.205.240.91 1 1 3883 20210404085803 90.192.29.91 3 27 5180616 20210426142400 81.106.100.137 1 3 4843172 20210425210941 52.56.62.214 7 7 28618 20210418093545 86.148.169.58 1 1 3373 20210408230958 176.110.134.2 4 4 38487 20210426100835 109.152.191.102 1 1 3629 20210413084613 80.251.153.23 5 5 36526 20210410204508 109.155.41.137 1 18 4923715 20210429081415 90.192.19.124 7 21 4924528 20210405110448 86.152.112.238 0 3 110492 88.105.7.174 2 38 9957097 20210411223836 94.193.35.121 1 15 4896868 20210422193125 168.205.217.212 2 2 12203 20210422150510 168.119.245.170 69 70 419736 20210401221608 92.40.173.55 1 2 4835440 20210420074157 86.152.230.150 14 16 236213 20210420182528 109.155.112.128 3 5 56517 20210424155640 81.129.229.141 1 1 3318 20210408093604 5.189.130.21 2 2 12203 20210416090728 82.132.221.223 1 1 3336 20210404205849 13.77.182.156 2 2 41549 20210412043223 94.3.238.142 3 24 4958174 20210409194934 213.205.194.108 1 18 4920493 20210404095018 86.149.122.102 2 17 124852 20210418192539 79.78.81.134 48 92 10270481 20210424180248 168.119.250.89 102 104 616678 20210402010555 98.162.25.7 2 2 12203 20210420085104 86.147.191.207 2 19 4927238 20210421205204 95.55.91.177 2 2 12203 20210430074627 213.205.194.213 6 11 4900332 20210405140251 78.86.166.252 1 1 3541 20210425175055 86.172.7.96 3 3 10049 20210403115935 2.26.206.14 1 20 4973448 20210426120248 188.223.53.89 16 54 9890517 20210401153333 152.44.105.168 0 1 568 91.206.1.124 0 5 66160 54.89.207.69 1 1 13156 20210421135220 90.193.248.141 1 12 4886819 20210424215721 213.205.242.56 1 18 4920484 20210407051925 109.155.112.173 1 1 3347 20210402184911 148.252.128.58 7 19 23846 20210413195042 168.91.44.149 1 1 3766 20210429124333 81.102.43.232 11 135 34705701 20210427175649 81.147.165.173 1 19 4968856 20210421193453 77.10.186.58 2 21 4984782 20210426145320 179.107.59.76 2 2 12203 20210408021016 94.192.42.157 10 49 10118795 20210429181005 185.69.145.93 1 14 4856919 20210412193156 86.182.110.14 17 131 55093406 20210430082214 46.165.233.56 2 2 12197 20210421013655 90.204.0.26 2 2 6974 20210428203456 85.159.6.20 2 2 12203 20210405102103 109.155.115.107 4 4 13998 20210405195742 13.77.145.191 1 1 14463 20210423175934 90.204.228.33 3 3 10671 20210420215006 185.69.144.141 1 1 13216 20210413090113 34.236.216.169 1 1 3278 20210403162310 18.221.206.247 2 2 7177 20210418123418 128.199.13.166 2 2 26507 20210429022755 34.220.18.224 1 1 3545 20210424014410 82.25.134.142 1 18 4922137 20210421230640 66.56.83.154 2 2 6245 20210403030740 86.167.1.135 3 3 10190 20210430160614 85.255.233.91 1 13 5413 20210423065519 20.49.136.233 0 1 244872 92.16.170.239 1 20 4973506 20210425140946 86.150.75.241 15 78 25222344 20210420171320 109.155.112.113 2 2 7320 20210418211039 86.17.25.170 2 21 5040200 20210412175518 82.37.241.197 1 18 4920493 20210403123917 120.21.150.186 2 2 7082 20210427234407 69.171.251.22 0 1 244872 90.221.218.69 2 2 7297 20210402095547 137.26.121.166 2 2 12203 20210429170142 34.241.19.249 1 1 3495 20210429201336 92.8.254.255 9 28 4952090 20210408202537 180.211.183.30 1 1 12126 20210427142111 148.252.133.224 17 35 6023348 20210410100330 179.43.167.228 3 3 24329 20210407031520 147.161.166.248 2 44 9997298 20210429092718 92.18.71.194 1 18 4920406 20210405161006 109.229.18.74 2 2 12203 20210403093311 78.86.139.172 2 2 6988 20210409163652 34.68.48.3 1 8 47182 20210406234539 81.100.137.200 4 18 125710 20210418000510 221.230.78.58 1 1 12126 20210405173500 94.194.136.244 3 16 10930 20210425063653 114.111.32.67 1 1 3487 20210425170138 41.231.5.36 1 1 3278 20210404223452 5.81.116.182 2 2 7025 20210403124218 2.217.149.233 1 18 4921011 20210404180533 93.115.193.93 1 18 4924449 20210401202600 86.134.111.6 1 1 3543 20210422074731 92.18.195.25 1 18 4920357 20210409193322 13.77.154.230 2 2 51893 20210425225952 86.152.135.54 3 22 4928259 20210401140843 86.133.149.195 1 18 4904320 20210402195654 185.7.145.88 11 11 109909 20210425143144 86.140.43.155 16 284 60753149 20210430220310 111.7.96.158 2 2 3575 20210417094055 111.7.96.179 2 2 3487 20210426054145 18.134.196.115 4 4 38409 20210406232823 86.142.214.205 1 20 5036746 20210411093814 86.131.253.189 22 74 10005749 20210408161801 191.248.227.74 2 2 12203 20210402173617 114.111.32.131 0 1 6415 176.251.203.253 1 1 3495 20210430200846 131.0.246.113 2 2 24252 20210430175058 20.133.0.13 57 82 5384309 20210430125005 86.19.11.218 1 18 4921526 20210409125433 71.19.144.89 1 1 12126 20210429175553 93.117.72.27 2 2 12203 20210408105805 109.249.185.78 1 12 4896561 20210405142154 148.252.128.175 1 18 4929984 20210422193227 82.43.82.122 1 18 4920357 20210409171603 90.195.100.112 2 2 7405 20210422170557 86.180.147.110 1 18 4920357 20210409163854 92.40.168.78 1 20 4973511 20210425001309 176.255.60.225 2 27 9806476 20210424212731 84.17.49.186 3 3 24989 20210405200057 88.107.196.26 1 18 4920414 20210409160933 94.6.241.160 12 146 34818085 20210429221054 104.196.253.82 2 2 0 20210405145549 192.186.145.59 2 2 3032 20210417181417 94.3.209.68 10 94 20087198 20210430140623 86.171.93.113 5 49 20090796 20210428063012 92.40.175.129 1 1 3690 20210406104133 92.40.175.50 1 4 15916 20210407182224 114.111.32.158 0 1 10128 85.255.234.158 1 15 4986816 20210424221118 213.205.194.188 1 1 3373 20210407121446 109.152.137.223 2 2 8961 20210414084116 85.255.235.94 3 20 4978273 20210418170158 82.33.180.73 1 20 4920722 20210401095347 185.220.100.241 3 3 24329 20210422043400 66.249.93.212 2 2 9638 20210422112055 86.151.201.124 1 1 4923 20210412181148 42.236.10.83 1 5 12367 20210411014601 192.227.171.49 1 1 10627 20210407011242 86.173.41.62 20 35 90323 20210407111219 90.243.1.54 1 4 27940 20210409160921 143.202.226.238 1 1 12126 20210407003245 212.159.116.59 1 18 4922212 20210415094514 54.39.48.71 15 15 57177 20210423112508 186.250.112.166 2 2 12197 20210405225418 13.66.241.3 3 3 53335 20210423191733 188.222.33.126 2 20 9755016 20210419115752 34.220.236.134 1 1 7333 20210401230818 85.203.46.26 8 43 9933814 20210416154849 211.249.46.91 0 3 33044 92.40.178.81 1 14 4970472 20210416131045 135.181.96.14 66 71 1002461 20210402030308 192.0.102.72 0 1 72325 86.160.81.187 18 43 5379827 20210416221206 92.40.175.200 1 2 4836242 20210404101909 35.171.133.216 1 5 24721 20210405081301 81.103.188.195 1 18 4922357 20210418134504 104.245.145.60 1 1 2955 20210413013424 92.6.116.43 1 22 4993318 20210425213825 173.208.246.46 1 1 3583 20210414011006 86.19.59.250 1 18 4922659 20210420190935 90.210.25.133 1 1 3525 20210402143336 197.210.217.66 2 2 12203 20210428084127 95.79.127.94 6 6 36609 20210414122849 109.152.191.116 1 1 3660 20210419123913 3.239.230.173 3 3 10215 20210409215611 80.47.121.89 7 31 9930338 20210429215348 90.206.114.80 11 47 29704507 20210417123234 86.140.180.19 19 55 10044251 20210429200443 36.89.185.79 2 2 12203 20210412071943 3.249.235.191 1 1 3318 20210407201305 194.33.192.2 2 21 4992202 20210420115058 86.131.197.113 11 11 39467 20210422193909 153.246.200.232 0 3 184219 62.210.80.33 6 6 48658 20210421022752 109.70.100.53 1 1 12126 20210403085125 82.132.224.129 1 2 4835379 20210422140449 88.198.226.49 56 64 935396 20210402001221 109.145.17.225 2 2 6778 20210406091827 20.68.240.61 4 4 38409 20210408145434 114.111.32.183 1 1 4401 20210424222916 2.30.10.108 1 20 4973448 20210426192546 192.151.158.243 40 40 132537 20210428034532 93.97.56.243 1 22 5031513 20210419164946 49.234.246.71 0 1 13806 37.120.233.54 1 1 3528 20210427065557 116.58.247.196 2 2 12203 20210401185446 86.184.225.62 1 1 3278 20210404221758 35.237.131.75 1 24 5076603 20210424232603 54.186.236.59 1 1 3462 20210425014128 80.193.38.102 2 20 4977567 20210406163506 211.231.106.28 0 1 124599 188.34.153.110 126 131 947255 20210402001216 54.39.50.77 1 1 3467 20210402180543 176.251.148.141 4 22 4932088 20210404073423 205.185.123.19 1 1 12126 20210428183017 2.30.67.144 4 19 14381 20210421135938 135.181.198.146 94 101 1126381 20210401221209 86.145.169.102 14 101 44086299 20210411120439 109.154.64.38 1 20 4973506 20210425185746 34.219.10.87 1 1 3278 20210404011744 51.210.101.196 2 2 12198 20210420030103 66.249.93.63 5 5 26938 20210430221647 37.57.15.43 1 1 12126 20210429092233 125.164.188.178 2 2 12203 20210412112439 54.188.57.66 2 2 47812 20210425084439 86.180.88.207 1 1 3347 20210402225850 82.132.233.237 1 1 3318 20210407132040 81.134.89.194 1 18 4920557 20210405145953 82.6.28.137 6 23 4941665 20210429190251 92.40.191.111 1 3 4927396 20210425223526 183.89.79.67 2 2 12203 20210426140903 86.171.167.133 1 1 3617 20210403125545 86.135.71.26 1 18 4920495 20210419124725 86.131.216.183 2 25 9778715 20210412203750 86.147.241.13 1 1 3541 20210427084032 185.217.0.190 4 4 39942 20210428210658 184.185.2.45 2 2 24980 20210401174541 82.15.98.86 1 18 4921389 20210403203341 54.210.134.183 0 5 1224360 192.255.78.206 1 1 3456 20210423231501 86.161.139.248 1 18 4920406 20210405152030 106.223.143.3 1 17 4919932 20210427130800 154.59.139.180 1 20 4920722 20210401085459 82.132.234.42 1 18 4920133 20210430073514 92.0.35.192 61 648 144708168 20210426220306 51.146.238.49 1 18 4920493 20210407151523 92.40.190.158 2 3 4838964 20210421200736 82.132.224.169 5 5 22916 20210416233142 79.78.71.165 4 44 10038299 20210412192158 123.183.224.91 0 4 61928 178.103.115.204 1 20 4920717 20210409093954 85.255.237.166 1 18 4921651 20210418185930 109.73.180.67 2 2 12203 20210408051255 86.160.217.234 1 18 4921011 20210430181653 80.6.29.218 1 18 4924621 20210425224122 175.44.42.82 1 2 9928 20210423193200 114.111.32.91 1 1 3456 20210423133056 92.41.145.234 1 18 4921348 20210414174748 82.132.241.105 1 1 3503 20210412132352 92.1.71.166 0 1 244872 114.111.32.144 1 2 3938 20210409131415 213.205.240.237 1 1 3530 20210405145241 178.208.12.4 1 1 4867 20210421102558 213.205.197.164 1 3 56635 20210425065625 92.28.61.187 3 44 14751349 20210429211701 31.124.224.231 1 18 4921039 20210425225023 5.65.79.172 1 18 4920990 20210420193303 35.81.81.194 1 1 3570 20210416025811 46.243.220.89 2 2 12203 20210403160141 80.42.230.244 1 18 4921526 20210409224033 173.212.204.245 2 2 7145 20210417153047 82.132.244.153 1 1 3660 20210418182755 82.25.52.71 1 18 4920406 20210405161201 86.171.212.68 10 42 29235462 20210406160829 86.145.217.145 2 37 5195489 20210409220731 47.254.233.55 0 8 42032 66.249.93.39 2 2 7746 20210422215645 86.153.41.170 2 23 5034967 20210413183223 90.210.28.159 2 17 60553 20210424215112 132.185.160.122 2 23 5035077 20210413114658 84.71.112.94 2 21 4924134 20210408112634 20.64.113.141 4 4 39756 20210414070754 217.113.22.18 1 1 12126 20210415061617 114.111.32.28 0 1 92071 18.237.16.250 16 16 273039 20210429180341 81.110.48.114 2 21 5003583 20210411105534 183.165.195.14 1 1 12126 20210408005435 186.216.204.183 1 1 12942 20210424065244 31.48.217.210 2 23 9829248 20210410005841 82.3.180.211 3 43 9956375 20210419210338 113.73.66.120 2 2 12203 20210415144154 188.240.35.66 1 1 3487 20210427225819 87.117.57.29 2 2 12203 20210414060753 158.180.192.10 16 60 10119484 20210430112656 89.25.66.23 2 21 4923766 20210405081227 90.210.29.162 1 1 3602 20210418153100 87.80.254.218 1 18 4920403 20210406195426 213.205.200.9 2 21 4924218 20210409161450 185.206.225.234 3 3 25527 20210430170409 82.132.235.193 2 24 9872752 20210413132439 66.249.93.35 6 6 47679 20210430191156 79.67.113.152 1 18 4920115 20210405152448 180.163.220.97 0 1 568 86.153.248.84 8 8 27720 20210409222141 196.240.143.233 2 2 16248 20210424181318 211.20.145.202 1 1 12126 20210418231300 194.33.192.4 4 32 14706369 20210413115726 86.170.10.66 3 52 9902524 20210405075234 86.164.210.202 2 25 5080231 20210428182912 94.9.152.43 1 18 4921799 20210413123149 90.193.255.4 8 78 15347421 20210430230505 79.78.89.242 2 20 4907627 20210403122730 81.155.170.17 0 2 109206 82.15.40.124 1 1 3382 20210406193846 162.55.72.19 1 22 4943600 20210425174917 86.14.69.111 2 36 9840834 20210418085530 195.89.10.104 1 18 4923947 20210426135419 147.161.167.22 1 24 5076644 20210430130721 82.132.244.157 1 20 4955535 20210411014116 82.6.26.119 1 18 4920498 20210403121046 213.205.240.217 1 16 81036 20210402180804 90.205.49.206 1 20 4973511 20210425075708 176.121.9.228 2 2 12203 20210416134332 86.161.198.74 1 20 4973453 20210425092231 92.40.181.188 2 3 4838812 20210428074321 2.220.255.104 8 8 27559 20210402144219 109.152.191.93 1 1 3549 20210430085122 79.78.86.220 3 43 10033737 20210418173907 51.52.28.178 3 24 5038932 20210419155238 95.217.9.35 1 1 34604 20210424212525 45.67.14.153 1 1 12018 20210402180553 46.175.70.69 2 2 12203 20210412004018 86.171.107.66 1 1 3257 20210430100225 92.40.175.157 3 23 4989693 20210425170355 82.132.237.186 1 1 3530 20210405203753 60.189.115.226 2 2 12203 20210416123445 35.247.41.82 2 2 0 20210405125151 86.162.254.248 1 18 4920796 20210422145745 109.146.169.232 1 18 4920434 20210403222159 213.205.200.65 5 40 9857033 20210412202848 80.6.30.8 1 18 4920403 20210402182746 86.164.207.88 35 50 449860 20210415145225 82.132.225.133 1 14 4079 20210401223105 31.49.229.56 1 20 5034609 20210411072828 85.237.62.189 2 2 12203 20210403160004 211.249.46.147 2 3 27157 20210428171901 138.204.140.199 1 1 12126 20210419062617 80.247.61.10 2 29 5039706 20210430124701 51.146.248.89 5 32 9923183 20210425173614 82.132.235.49 2 24 5021650 20210426173630 92.40.172.51 1 18 4920403 20210402193524 157.90.240.61 174 186 1457132 20210402023742 45.131.194.23 3 3 35869 20210424001728 2.25.42.25 1 3 24776 20210415072257 90.221.210.212 2 2 7393 20210406183446 178.130.76.59 2 2 12203 20210403171049 3.250.126.121 1 1 3487 20210427200740 91.206.0.35 0 3 19912 80.42.82.116 1 18 4920649 20210412194209 192.109.140.171 0 8 0 188.163.47.9 4 4 24406 20210418102020 142.255.86.85 1 1 3494 20210410113454 188.221.225.93 53 108 34225303 20210427144822 34.251.241.226 1 1 3456 20210423084102 167.114.119.164 1 1 3475 20210405141358 213.205.198.249 1 1 3600 20210422121154 188.221.224.71 1 18 4918830 20210422210413 36.90.229.181 2 2 12197 20210401135350 90.215.161.67 1 1 3572 20210412185234 86.36.48.80 1 18 4924522 20210425085140 213.205.194.20 1 1 4923 20210413164338 1.0.173.21 2 2 12203 20210401173842 121.5.145.96 1 3 115882 20210418022747 40.78.153.184 1 1 3278 20210404232343 81.105.53.66 2 19 4924286 20210404170337 176.249.95.165 1 18 4920493 20210404112539 86.135.136.147 4 25 5043429 20210421212445 94.9.148.186 3 22 4928583 20210403122921 59.63.110.253 2 2 12203 20210407150548 78.46.65.196 1 1 12126 20210420164838 86.130.191.221 11 52 10002219 20210422212003 92.40.189.45 2 15 7282 20210415112910 92.16.220.144 1 18 4921284 20210406222435 103.79.164.107 2 2 12203 20210405153513 18.229.73.207 1 1 3570 20210416053411 87.81.84.62 1 18 4921553 20210404003742 66.102.9.75 1 1 4039 20210424004254 90.208.136.9 1 18 4920806 20210422223933 86.171.92.194 1 18 4920557 20210405145908 109.152.97.7 2 2 7176 20210430175057 109.153.175.242 1 20 4973448 20210425143908 85.255.237.1 7 45 9860920 20210403113027 3.239.235.128 53 62 405600 20210428153238 86.173.41.41 164 1050 207598593 20210430220508 82.132.232.176 9 16 106363 20210428075146 213.205.240.56 3 9 54219 20210414062606 51.161.115.227 1 1 11332 20210424212515 90.220.234.167 3 24 5039116 20210423101141 94.4.133.187 0 4 111035 209.180.91.43 1 1 3318 20210407083136 82.34.202.20 15 104 24714020 20210415230449 52.56.62.212 1 20 4920662 20210407100811 185.200.247.215 1 1 3495 20210430115353 86.139.102.54 1 18 4921418 20210409122959 82.132.226.207 1 1 3617 20210403123224 180.163.220.45 0 1 1286 184.82.140.229 2 2 12203 20210413113651 77.98.204.131 3 20 4928356 20210416122000 92.28.248.240 1 16 115787 20210424222800 86.175.169.245 1 18 4920851 20210428173232 213.205.240.94 1 1 11339 20210425111012 31.54.34.225 1 16 4846019 20210403100515 5.65.71.79 1 17 4919838 20210405141442 213.205.194.12 1 24 5076636 20210426120524 118.186.17.243 2 2 12203 20210429021735 121.5.109.55 1 1 3278 20210404135622 213.205.197.175 5 7 9697374 20210430124135 82.132.225.227 1 11 4906404 20210403121606 2.30.182.34 4 44 9960308 20210410215336 87.81.95.167 6 28 4991039 20210406221905 82.9.113.44 2 21 4984908 20210425003628 54.218.101.212 1 1 3545 20210424014523 91.125.228.161 1 20 4920622 20210404131644 151.228.242.56 1 20 4973448 20210425204251 101.96.115.106 2 2 12203 20210418112246 86.171.25.202 1 17 4904045 20210415170156 1.192.195.5 1 1 3513 20210423102400 80.251.153.44 6 6 36609 20210423225322 128.208.46.205 1 1 4867 20210413181100 93.177.73.35 2 2 12203 20210417210954 54.188.132.62 1 1 12786 20210405180554 94.9.147.77 1 1 3920 20210422151343 188.34.199.190 70 81 1293811 20210402031041 109.152.97.225 1 1 3641 20210415134632 79.71.188.203 1 15 4897833 20210401103944 65.21.53.49 40 42 513811 20210401174203 115.202.199.168 4 4 37513 20210420181705 92.41.126.126 1 18 4921796 20210424083724 213.205.197.202 4 5 4845264 20210408154236 168.119.182.165 59 59 302926 20210401200619 134.249.198.42 2 2 12203 20210426064407 86.135.132.85 8 85 20040780 20210426102900 222.190.197.83 1 1 12126 20210411190341 54.152.238.174 1 1 3633 20210418080005 218.108.31.28 2 2 24252 20210428202221 82.132.225.16 1 1 3641 20210414161246 65.21.61.49 112 114 745739 20210402030602 78.86.137.128 1 1 3641 20210414195618 2.121.202.18 1 1 3541 20210427194352 78.86.39.248 1 15 4918350 20210403135004 92.40.190.227 1 3 4869087 20210425090204 125.209.235.181 1 5 13815 20210424213340 143.159.132.172 1 18 4920749 20210422195141 52.56.62.195 1 1 3318 20210408130631 194.33.196.6 4 20 9833797 20210413110044 176.253.151.144 3 22 5037774 20210412232827 201.48.58.85 2 2 12203 20210401085606 90.194.235.138 1 1 3602 20210419095536 86.162.114.164 1 14 3783 20210425102534 46.193.227.210 2 19 4908891 20210414154929 195.2.70.173 3 3 24323 20210430022510 91.196.10.22 4 4 52558 20210430130302 90.192.52.40 35 49 53464113 20210414172215 82.132.242.56 2 9 18598 20210415162101 125.209.235.168 1 4 110232 20210418022055 86.9.8.154 1 18 4921743 20210412224505 94.13.208.114 4 42 10042918 20210425212755 213.107.0.172 1 22 5031526 20210420150144 86.162.116.182 1 24 5076636 20210427192948 147.161.167.76 4 25 5042244 20210423094927 213.205.197.135 1 18 4922088 20210403181853 5.68.141.237 3 7 33281 20210409172059 90.194.218.214 1 6 32996 20210425160941 183.89.45.223 2 2 12203 20210404044811 86.149.116.175 1 20 5036805 20210411111058 94.0.224.178 0 4 111035 90.196.1.198 6 41 19928704 20210430144558 213.107.66.146 1 12 4901796 20210413102909 65.21.61.192 131 132 862460 20210402030519 88.108.198.124 0 1 244872 85.255.233.131 1 7 4874639 20210422154308 82.132.224.175 4 9 256371 20210424213917 148.252.133.245 1 18 4929281 20210403122524 3.90.219.216 1 1 3467 20210402184146 94.0.92.160 1 18 4920545 20210425104449 79.78.83.82 9 45 9832713 20210426210128 79.64.121.31 2 36 9842290 20210424213733 90.252.15.187 1 18 4921799 20210412202724 94.8.82.213 1 18 4920343 20210402184201 185.69.144.134 1 18 4889307 20210405200115 63.141.241.58 2 2 12197 20210422170144 180.180.151.219 2 2 12203 20210416213454 13.124.99.148 0 2 66516 82.39.212.170 25 53 5411767 20210430061556 90.204.231.183 1 18 4920084 20210406215444 78.146.63.114 5 7 77187 20210425122238 109.156.141.201 1 21 5014814 20210422203322 31.48.28.64 3 38 10024205 20210414095408 148.252.128.34 1 10 4918648 20210423170911 90.211.227.232 2 3 85601 20210413083920 86.180.88.181 2 2 7528 20210418085151 78.159.96.193 4 4 24406 20210429094754 92.40.184.18 1 13 4875614 20210403121026 213.1.11.244 51 588 121543661 20210430222519 100.24.108.51 0 16 5043054 92.27.189.125 1 19 4956895 20210425143828 109.157.190.232 2 22 4939338 20210414214853 176.254.8.21 1 18 4920441 20210403121327 82.22.45.254 6 54 14964419 20210428103753 165.120.83.34 1 1 3538 20210409163255 217.39.152.129 26 28 212659 20210422091558 92.40.175.219 1 1 3495 20210430121205 82.132.220.173 3 23 5233104 20210424233058 103.62.48.232 4 4 39792 20210419022432 51.241.50.233 1 18 4920885 20210410140141 34.220.46.156 1 1 3495 20210430013848 86.164.42.15 1 1 3617 20210403164250 117.50.99.207 5 5 18622 20210412035720 35.177.79.70 1 1 13324 20210430152054 85.210.202.81 1 18 4921006 20210427191936 5.80.131.216 1 18 4921338 20210403200916 86.162.116.77 7 7 24016 20210402202331 213.205.240.8 5 43 5050271 20210419203515 81.153.82.141 4 27 14705581 20210423194416 78.146.57.163 3 23 213361 20210418164427 72.195.34.41 2 2 12203 20210407071708 108.190.232.98 10 31 5073052 20210415170356 123.6.49.36 1 1 4212 20210402095114 2.27.127.107 41 43 256069 20210413154754 82.132.225.245 1 22 5031424 20210423150721 134.35.207.19 2 2 12203 20210411005318 92.40.191.113 1 2 4835325 20210426053503 198.46.134.188 2 2 6458 20210415220944 213.205.194.142 1 18 4920414 20210409212805 85.209.151.137 2 2 23549 20210410030610 90.220.178.231 1 18 4921389 20210403003215 90.204.7.223 1 1 3318 20210408182118 90.221.218.144 3 3 11175 20210425162459 211.249.46.93 0 1 921 45.67.14.143 1 1 14631 20210409122816 184.178.172.18 2 2 12203 20210403112206 88.198.90.9 42 42 861774 20210429221356 62.255.218.18 3 3 10593 20210407125414 80.225.238.144 32 367 84378032 20210413190416 109.170.141.118 17 166 35235061 20210429160619 109.155.112.96 1 1 3560 20210412084211 165.117.232.82 2 2 36840 20210430052052 85.255.236.140 1 18 5039702 20210421121350 82.9.179.157 2 34 5002172 20210429220717 103.131.104.63 1 1 12126 20210413051550 178.184.91.177 2 2 12203 20210403165352 88.255.217.102 2 2 12203 20210416202221 4.15.27.17 1 6 40356 20210406144212 5.69.153.51 1 18 4922047 20210428184821 86.163.213.25 2 19 4923556 20210412180345 5.80.205.81 1 1 3530 20210405203929 88.107.95.33 1 7 4969587 20210411172805 94.181.104.13 1 1 12126 20210402073641 159.203.172.7 1 1 3487 20210427161242 36.66.242.146 2 2 12203 20210405090350 86.176.72.51 8 29 5059122 20210422091218 144.76.222.78 2 2 6892 20210425180241 90.195.226.85 1 22 5032816 20210410210943 78.86.158.207 1 1 3541 20210427085307 109.154.150.18 11 43 5077835 20210424102249 114.111.32.113 1 1 5664 20210410214251 220.64.105.7 1 1 3513 20210407015637 86.162.119.201 1 1 3318 20210408203255 3.15.1.18 2 2 6990 20210430082528 211.231.106.46 0 1 162547 140.250.147.59 2 2 12203 20210416001042 86.164.247.121 5 5 20877 20210413193509 89.236.112.100 1 1 12126 20210430014949 34.211.102.96 1 1 34601 20210424213342 31.52.41.110 1 21 5014901 20210421195058 94.130.167.90 1 1 3726 20210424215359 192.40.57.57 2 2 12203 20210412163144 94.4.58.128 1 8 54734 20210405145818 13.77.147.72 2 2 32403 20210430233526 177.125.204.68 2 2 12203 20210401063414 95.217.9.40 1 1 29434 20210421090837 5.253.204.45 3 3 25253 20210422212240 86.157.72.3 4 4 14212 20210407145314 104.227.106.129 1 1 10627 20210424183146 86.182.34.217 1 1 3632 20210417083945 104.245.145.55 1 1 2955 20210413090256 90.212.167.203 1 18 4920076 20210429181144 123.119.128.168 2 2 12203 20210429163520 193.163.116.30 2 2 12203 20210420224302 1.192.195.11 2 2 14276 20210423102400 181.209.219.28 2 2 12203 20210416202822 117.24.171.27 2 2 12203 20210423193737 217.42.75.138 1 20 4973511 20210425063640 178.63.51.106 123 123 2359944 20210430231535 82.9.245.162 6 92 24605935 20210423055022 54.236.13.198 1 1 13156 20210421195419 209.251.20.57 0 1 654 213.205.194.119 1 18 4921579 20210423143333 204.13.155.51 1 1 12126 20210413094738 185.220.100.250 1 1 9769 20210409184002 92.40.174.83 1 2 4835216 20210401080848 109.156.117.250 3 21 4910905 20210404120022 213.104.124.178 2 11 4919943 20210430202157 77.40.61.178 1 1 12126 20210427152850 80.6.233.56 1 20 4973453 20210425091510 204.12.244.155 2 2 12203 20210407170714 85.255.235.51 1 1 3600 20210421092954 54.156.91.71 1 1 3545 20210424033408 80.42.63.6 2 18 9813144 20210412175801 176.100.168.110 2 2 24252 20210425074305 82.132.221.117 1 18 4920566 20210406065628 90.192.39.60 1 5 7771 20210409160954 82.23.247.136 2 20 9758534 20210427114258 34.221.54.168 1 1 3487 20210429012458 85.209.89.155 6 6 59538 20210428152433 86.142.88.178 4 25 14767062 20210411122628 170.83.178.185 1 1 8039 20210404062542 92.40.190.148 0 1 20214 125.209.235.185 0 1 921 114.32.122.191 2 2 12203 20210404055215 175.110.43.199 2 2 12203 20210421190151 72.206.181.123 2 2 12203 20210407091321 65.21.62.13 143 145 755807 20210402020448 213.205.194.179 1 18 4920406 20210405142102 114.111.32.41 1 1 2532 20210408185200 222.75.202.59 2 2 12203 20210409205911 154.16.12.200 2 2 7406 20210417140239 82.15.42.119 1 18 4920566 20210405183755 123.183.224.148 0 1 921 95.217.238.233 91 94 686993 20210401232724 109.152.191.64 2 2 7282 20210414133802 109.152.191.23 1 1 3386 20210424202613 109.152.97.243 1 1 3513 20210423191328 114.111.32.111 1 1 10146 20210406211317 34.220.239.97 1 1 3318 20210408012105 86.24.31.83 4 21 4931009 20210408221717 80.3.252.104 1 18 4920659 20210424215855 90.255.220.201 2 19 4923838 20210409212203 86.21.198.173 1 10 146124 20210412105556 86.20.28.162 1 18 4922088 20210426152455 139.155.183.183 1 1 3487 20210429145258 213.104.124.61 1 1 3377 20210402091851 176.24.3.147 2 36 9841299 20210422211329 86.149.153.145 1 20 4920721 20210402082556 181.215.176.155 3 3 25527 20210430212025 40.117.190.154 1 1 3495 20210429214002 213.205.242.148 3 5 56059 20210425022437 167.179.117.217 2 2 12203 20210413194514 78.149.79.58 2 21 4984903 20210426100653 82.132.226.176 0 2 14507 86.129.222.20 6 67 15130798 20210426235737 80.43.231.44 2 23 5034999 20210411154701 31.48.254.73 3 49 10157473 20210426203536 86.139.141.135 2 20 4925433 20210422220334 179.109.203.76 2 2 12203 20210414082515 138.97.2.177 2 2 12203 20210425062019 5.71.215.232 1 18 4952361 20210424220601 109.249.185.106 3 3 10923 20210414103958 2.127.125.103 1 20 4973511 20210425075911 124.121.203.231 2 2 12203 20210411232040 82.11.126.93 1 18 4920806 20210423083532 185.34.33.2 3 3 24329 20210423012457 86.152.41.188 4 39 10027418 20210423081010 104.237.154.194 1 1 12126 20210417191814 195.206.107.147 2 2 12203 20210408023124 135.181.214.38 2 2 24179 20210412175330 52.56.62.188 6 6 21539 20210423102914 81.151.44.55 1 18 4920493 20210403133042 23.229.35.224 1 1 10627 20210414120237 92.40.171.232 1 1 4923 20210416090544 86.143.37.121 2 19 4924294 20210420060652 109.152.97.127 2 2 6746 20210407114529 31.50.153.224 1 18 4920659 20210425071318 34.221.131.171 1 1 3494 20210410012108 90.209.223.61 2 29 9819189 20210409160305 2.97.165.24 11 11 37881 20210409190153 49.234.166.139 0 1 2073 82.193.104.168 61 61 301717 20210424212611 86.172.2.15 2 36 9860902 20210424213059 92.40.174.156 1 1 3541 20210427075713 54.250.242.40 2 2 12203 20210404232452 188.220.216.110 1 20 4973511 20210425070739 86.169.154.203 4 42 9850754 20210405134811 5.69.249.181 1 20 4973446 20210424222644 90.221.38.43 7 72 19870963 20210426212243 90.192.50.39 1 14 80226 20210422183340 31.48.254.137 1 1 3641 20210415184840 54.212.145.175 1 1 15130 20210406150217 90.197.6.62 5 21 9734974 20210424215958 86.143.172.191 1 11 3200 20210429191647 90.194.232.229 3 3 12427 20210413201020 86.162.117.39 7 7 23675 20210405211553 13.66.202.83 2 2 44109 20210428174834 86.162.184.127 1 18 4920027 20210425132829 85.255.232.178 1 20 4973511 20210425085637 190.6.26.149 2 2 12203 20210421232108 135.125.97.131 2 2 26050 20210418160554 92.40.190.162 1 10 45207 20210415075726 81.177.183.58 1 1 12953 20210410032115 85.174.204.46 2 2 23083 20210426230842 86.169.171.15 1 18 4920406 20210406221121 81.98.67.179 1 18 4920614 20210422190221 86.144.194.253 1 1 3377 20210401133647 95.13.86.170 1 1 9950 20210429170118 54.189.233.153 1 1 10378 20210407150823 165.225.81.116 1 22 5031494 20210413132319 90.221.47.177 1 18 4920406 20210405155837 132.185.160.131 2 23 5035765 20210412133939 31.52.41.88 1 23 5060083 20210427202847 173.212.197.189 1 1 3602 20210419181949 82.26.70.6 1 19 5060628 20210423125458 213.152.59.167 19 301 75127269 20210430121751 91.206.0.32 1 5 34147 20210425011348 90.192.13.200 10 121 25311476 20210430222243 196.242.47.78 3 3 6569 20210421091603 90.197.5.104 2 2 6556 20210404173523 104.129.27.112 1 1 3545 20210424025629 172.197.125.44 15 37 4954277 20210430045056 31.86.112.114 0 1 354 148.252.132.242 2 9 4953486 20210425130749 195.224.211.110 5 80 24733427 20210426142645 51.219.113.221 1 20 4942986 20210428101215 52.5.70.31 1 1 9318 20210412144619 23.250.17.132 0 1 20214 86.148.100.166 1 18 4920566 20210405182016 54.201.21.146 2 2 30624 20210429133334 46.208.126.203 1 18 4921799 20210412182320 82.15.213.246 61 387 65267039 20210430161928 90.204.87.85 1 1 3530 20210405142736 42.236.10.74 0 2 14374 35.227.166.42 0 2 489744 86.191.207.85 1 18 4921472 20210410194512 78.148.31.101 0 1 244872 34.83.81.203 0 1 244872 86.180.254.237 1 1 3397 20210412175446 213.205.194.55 2 2 7446 20210423120724 90.212.218.20 5 36 5041254 20210425185815 109.146.213.69 1 2 5450 20210401153349 151.230.60.194 1 1 3602 20210418175837 188.28.239.243 2 21 4923996 20210406210942 94.130.167.79 1 1 3212 20210412125407 86.142.30.63 1 1 3641 20210415221213 104.156.204.39 1 1 3557 20210420205854 212.98.156.60 1 1 13324 20210430140828 223.199.70.204 2 2 12203 20210424002512 115.133.117.17 2 2 12203 20210406050005 86.148.48.113 1 18 4920919 20210424104736 90.218.64.69 21 53 48669818 20210428191651 144.76.22.137 1 1 3475 20210405141428 192.99.13.218 1 1 3513 20210418144358 92.40.175.164 2 2 8213 20210426091810 82.37.173.176 21 40 229570 20210430210250 3.236.163.26 3 3 10725 20210417081734 77.97.150.140 1 18 4920796 20210422140131 109.156.85.72 1 20 4973511 20210425073904 213.248.241.181 6 6 20992 20210428114414 82.132.187.138 1 18 4924003 20210422110904 86.135.132.49 1 3 114169 20210419113754 34.248.138.7 1 1 3326 20210406200643 86.138.36.96 40 117 88535622 20210420045618 185.71.28.133 1 1 3617 20210403172509 185.44.217.170 2 2 12203 20210404064759 213.248.241.168 3 3 10627 20210426075307 92.40.175.163 1 20 4973511 20210425090226 158.69.55.230 2 2 6980 20210426142707 82.26.170.34 100 130 5753943 20210430155529 92.40.190.229 1 2 4835383 20210424091552 81.136.21.1 1 1 3541 20210428191121 92.23.192.18 1 18 4956390 20210425081131 5.81.46.235 1 18 4928121 20210416073458 82.26.158.131 4 24 10016562 20210416190202 2.126.205.192 1 8 4911665 20210412193014 182.149.82.78 2 2 12203 20210401194619 65.21.60.209 106 106 501679 20210401222708 94.130.167.87 1 1 9301 20210410220253 51.146.243.199 3 23 4941522 20210410101146 79.78.88.239 2 46 10120166 20210426102234 3.250.144.62 1 1 3572 20210412200647 82.8.94.66 1 18 4920806 20210422211020 80.247.60.10 2 27 117720 20210416122033 85.255.234.237 13 32 9930303 20210409183043 81.98.67.81 7 9 4865297 20210414115320 46.33.33.102 3 3 24329 20210404213755 167.114.15.73 2 2 12203 20210426114739 40.127.89.162 2 2 26628 20210426195040 82.223.9.130 1 1 3602 20210419205828 176.249.49.94 15 179 39922982 20210430114036 45.148.125.129 2 2 21895 20210406214257 90.220.241.81 3 37 9847061 20210429214121 178.208.66.6 2 2 26504 20210415154854 18.183.178.126 4 4 39756 20210414013142 86.182.34.252 1 1 3615 20210420191039 92.40.175.119 1 1 3377 20210402100304 85.255.236.81 1 18 4929904 20210426073226 184.185.2.190 2 2 25450 20210429213928 92.40.184.17 0 5 44884 86.164.42.25 1 18 4920351 20210405142131 194.75.233.178 3 64 14918026 20210429153619 65.21.52.28 93 99 990789 20210401214354 121.225.163.141 2 2 12203 20210409112136 213.205.194.154 2 2 6824 20210405143942 54.66.19.124 4 4 38562 20210402043202 85.249.43.235 3 3 24329 20210429180515 190.104.17.4 2 2 12203 20210418104019 107.172.61.86 1 1 10447 20210429124309 152.44.98.168 0 1 6415 183.141.100.98 2 2 12203 20210404172508 176.254.202.211 1 17 4903881 20210403122936 86.155.73.158 1 1 3641 20210415211534 51.146.255.51 1 18 4920771 20210404080956 95.217.207.28 1 1 3494 20210410124152 5.180.221.44 2 20 4925035 20210409173615 157.90.240.58 76 77 352268 20210401193139 148.252.128.64 1 18 4929089 20210402181120 86.163.181.89 10 12 145210 20210410155630 34.247.155.61 1 1 3487 20210426200629 86.8.164.35 30 192 39845841 20210426135227 5.68.142.127 5 25 5068971 20210426134405 81.105.95.32 53 82 10124039 20210430045338 86.147.241.44 1 1 3336 20210404135131 78.150.132.242 13 60 10206780 20210429144844 128.14.133.50 1 1 3456 20210423223021 147.92.153.19 0 1 6415 3.237.185.26 1 5 24398 20210419105227 78.86.133.26 5 7 19326 20210428092347 86.132.91.152 9 9 31058 20210430081805 82.132.224.211 1 1 3572 20210422191744 82.26.162.43 1 9 4876917 20210409161000 201.236.203.180 2 2 12203 20210413065917 147.12.193.242 1 20 4973511 20210425005001 200.33.152.207 2 2 12203 20210425013742 218.81.50.59 2 2 12203 20210402025726 86.180.88.215 1 1 3641 20210415162641 49.79.128.120 2 2 12203 20210414235455 201.158.106.71 2 2 12203 20210402124804 212.219.120.5 1 18 4921157 20210427105847 115.70.215.7 1 1 13076 20210427020758 92.40.191.121 0 6 26199 213.205.240.171 2 25 5180482 20210411224213 84.67.64.166 5 22 4936246 20210411135039 125.209.235.186 0 2 25257 92.40.174.60 4 17 4981843 20210429210159 31.48.178.176 4 38 9849148 20210402233036 34.77.162.10 1 1 13252 20210414054953 90.192.8.61 3 3 11516 20210414163252 82.34.131.35 1 20 5028712 20210421094039 185.220.102.7 4 4 24406 20210414225006 165.225.17.24 1 18 4921743 20210414111250 94.232.11.178 1 1 12126 20210427141547 104.254.95.154 2 2 5910 20210409215949 113.160.165.170 2 2 12203 20210429235551 81.101.72.196 8 76 25303209 20210424223833 86.135.255.194 36 161 30205435 20210426195208 121.53.83.5 1 1 3575 20210417024458 80.42.57.251 2 19 4924420 20210422195235 177.137.168.150 2 2 12203 20210404215114 82.132.185.206 1 18 4922142 20210425220423 192.99.232.217 1 1 3467 20210427193856 46.39.51.49 2 2 22623 20210401230845 109.152.97.35 1 1 3336 20210404104227 81.157.192.7 1 18 4920414 20210409160901 94.11.18.187 53 430 90343315 20210429210804 77.103.40.32 1 18 4922088 20210414195617 185.69.144.42 1 5 4845102 20210418161422 158.69.35.227 1 1 77 20210409184415 86.132.95.49 96 104 650106 20210416132952 13.113.194.83 2 2 12203 20210426235502 82.132.224.229 1 1 3615 20210420132352 192.241.80.163 3 3 13659 20210428192107 81.152.8.80 7 7 24084 20210403194702 14.207.26.137 2 2 12197 20210407143120 125.209.235.172 0 3 4834612 125.209.235.174 2 5 9625 20210418022104 88.99.195.208 1 1 4542 20210409122825 110.78.149.232 2 2 12203 20210421170727 34.77.113.66 2 2 25522 20210409103244 191.233.232.45 2 2 12203 20210406192116 192.227.138.101 2 2 3032 20210412150942 86.149.14.11 1 18 4920566 20210405204603 49.49.242.243 1 1 3583 20210415115246 86.148.124.60 7 79 19826428 20210413185343 116.209.129.115 2 2 12203 20210415064752 13.66.202.88 1 1 21341 20210419004603 44.192.34.176 1 1 3575 20210417160818 90.199.233.50 1 18 4920771 20210410003215 135.181.99.46 60 63 502534 20210401180120 109.145.91.88 26 54 441487 20210425111556 144.217.80.80 3 3 24329 20210415014850 62.210.92.175 1 1 3318 20210407034121 92.40.191.198 2 3 4838952 20210420211805 90.221.32.226 1 18 4920806 20210422205817 35.230.117.152 0 2 489744 81.109.106.2 2 24 5145803 20210418091613 109.152.191.29 1 1 3389 20210406083601 2.95.196.197 2 2 21895 20210401214358 66.249.93.218 2 2 8078 20210421082139 31.53.21.42 9 9 31440 20210410103505 86.164.148.179 2 23 5036376 20210424091138 109.147.11.164 6 61 14883856 20210422194415 90.197.2.51 1 1 3495 20210430195815 51.15.113.84 3 3 24329 20210403151939 90.255.178.37 2 19 4923805 20210408141300 86.178.231.86 1 18 4921226 20210417101637 79.78.91.37 3 43 10033308 20210423093334 82.35.254.248 2 36 9842835 20210420115315 109.249.185.38 1 2 4836705 20210413130517 92.40.178.172 1 18 4920542 20210406151702 190.152.71.46 1 1 12126 20210414075344 148.77.34.200 2 2 12203 20210405150019 86.152.11.202 19 162 34726900 20210415112412 95.153.31.90 3 3 36397 20210425231425 92.40.170.2 1 2 4835440 20210419080135 77.101.146.96 2 20 9734368 20210429222905 34.216.123.253 1 1 3543 20210422011527 86.142.30.117 1 1 3336 20210404213543 90.221.34.81 1 18 4926644 20210414211512 34.196.97.47 1 1 11334 20210425132454 81.153.194.247 2 36 9841721 20210427215944 61.7.169.60 2 2 12203 20210429101111 85.255.234.171 3 12 4965478 20210429180043 52.56.62.209 2 23 5035047 20210423093112 82.132.223.135 1 1 3600 20210421142944 90.221.46.219 8 15 77198 20210424194950 201.170.73.56 2 2 12197 20210420215144 82.132.226.238 1 18 4920434 20210403132239 109.155.112.119 1 1 3347 20210403084650 185.215.151.126 1 1 3487 20210428135050 82.152.40.157 12 12 118603 20210429030222 181.214.1.47 1 1 12803 20210408225034 109.152.191.13 3 3 10300 20210403144406 94.12.194.241 2 23 5035271 20210421084604 122.4.41.129 2 2 12203 20210403143426 90.192.8.204 1 18 4920403 20210402184404 109.151.136.153 6 25 4942650 20210408145836 65.21.61.43 129 134 800037 20210401233916 81.168.73.16 9 9 67672 20210429030311 94.11.177.159 1 18 4921841 20210402125259 96.127.71.88 0 3 361131 213.205.200.110 1 14 3582 20210413152828 86.190.46.171 1 21 5014933 20210417203852 113.53.60.229 2 2 12203 20210408215232 86.173.41.106 19 21 120796 20210429101635 86.160.205.230 1 1 3538 20210409164255 203.133.180.84 0 1 155248 90.193.240.218 3 22 4927611 20210409165102 86.168.58.69 3 6 4878713 20210407151809 82.202.167.53 3 3 24323 20210404145118 180.241.240.16 2 2 12203 20210425211124 27.42.186.109 2 2 12203 20210425121313 117.71.149.233 2 2 12203 20210411224135 82.132.225.22 3 3 10066 20210405130441 94.7.250.123 1 18 4920434 20210403162147 85.255.237.81 1 11 4915407 20210403153105 90.205.255.166 1 1 3660 20210418212025 49.7.21.65 0 1 20214 184.170.241.20 1 1 12833 20210424215341 2.220.103.128 1 20 5036805 20210411132707 54.67.118.30 16 16 28444 20210430142235 54.164.13.111 1 1 3633 20210405185006 80.2.22.181 4 24 5000759 20210425132601 86.151.235.92 1 3 114070 20210412103306 86.130.84.98 12 36 431681 20210428043303 86.134.71.186 12 22 210854 20210410235733 99.79.38.195 4 4 39432 20210411015138 90.204.81.9 1 18 4920659 20210425083245 194.33.196.2 6 9 308003 20210424211843 109.249.185.51 1 14 66617 20210425090646 109.157.55.82 2 33 9813592 20210425154134 78.86.49.139 1 1 3435 20210402135241 62.64.130.197 7 76 15247667 20210430154710 59.124.31.73 2 2 12203 20210421072821 90.210.36.100 2 19 4924104 20210409225528 185.244.214.46 2 2 26279 20210412223024 86.20.237.32 2 19 4926044 20210411010154 86.169.42.134 1 15 4902557 20210419212407 85.255.234.127 1 1 3617 20210403122754 94.11.187.198 1 18 4920493 20210403122320 136.158.31.124 2 40 9841324 20210409045638 93.75.48.211 2 2 12203 20210413112610 114.111.32.177 1 1 2532 20210418234347 125.209.235.167 0 1 283 86.160.128.124 1 18 4919963 20210406130154 94.0.123.133 2 19 4928524 20210423233708 94.193.243.34 21 36 203101 20210422111554 78.146.63.143 6 47 5258522 20210415153712 82.5.95.90 3 22 5216588 20210425193651 212.67.109.122 1 18 4920384 20210408140212 52.213.91.143 1 1 3583 20210414200614 13.77.170.114 27 27 549893 20210428155414 63.33.58.105 1 1 3377 20210401200657 90.192.0.101 4 27 5088275 20210425211006 198.20.168.229 0 1 6415 46.182.129.31 3 3 24329 20210419170543 62.254.71.104 1 18 4920406 20210430171259 109.155.112.100 1 1 3641 20210414120624 109.147.142.218 1 18 4920414 20210409160805 90.192.55.70 38 64 48499181 20210428071305 109.153.253.132 29 99 15691737 20210420211115 82.132.247.57 1 18 4920403 20210402184045 86.190.85.120 1 18 4920403 20210402211002 90.197.169.29 38 76 5558643 20210429191235 90.193.220.108 1 18 4921089 20210426215202 211.249.46.22 1 1 8964 20210421223259 109.157.114.117 1 20 4973453 20210425002350 114.111.32.59 1 1 3495 20210430130747 69.171.251.17 0 1 244872 114.111.32.26 1 1 3883 20210425224236 184.178.172.28 6 6 48652 20210422154021 109.157.62.120 6 46 9967848 20210415135724 213.205.197.138 2 4 52643 20210424142440 85.255.234.59 2 19 4945136 20210426182547 31.54.173.44 1 1 3495 20210430121222 90.254.13.148 2 3 4838828 20210430054320 34.86.35.11 1 1 13314 20210426220025 46.165.234.58 4 4 24394 20210406035849 52.56.62.216 2 2 6974 20210427141458 3.8.237.254 1 1 3503 20210412132254 2.27.116.238 1 4 4951708 20210411081135 109.152.137.93 2 31 41587 20210425161752 34.247.182.70 1 1 3405 20210409200613 82.35.229.233 1 20 4973453 20210425114215 101.228.77.198 2 2 12203 20210401002918 77.98.163.84 2 19 4924023 20210405153019 82.19.17.73 1 19 5021729 20210410220426 78.146.54.243 7 28 5069105 20210411153208 23.229.73.76 2 2 3032 20210418031125 222.129.39.181 2 2 12203 20210427192224 65.21.53.167 134 139 949840 20210401210205 86.175.250.24 6 12 140739 20210418164332 157.90.120.248 74 80 1141157 20210401235650 86.22.38.223 6 44 19634318 20210411095443 51.9.243.47 59 154 20499622 20210430191957 82.132.216.25 1 1 3495 20210430185325 82.34.129.248 2 5 44623 20210409160806 20.197.56.211 8 8 77058 20210409192307 109.146.14.246 22 43 9897837 20210429143358 82.207.59.154 2 2 12203 20210413095651 192.99.19.229 1 1 4023 20210426153846 85.255.236.142 0 3 4855586 82.132.244.9 1 18 4920414 20210409161038 81.104.92.184 119 309 45680020 20210430201428 87.80.241.16 1 18 4920448 20210409234248 86.182.34.191 1 1 3513 20210423130017 157.90.175.68 63 65 343453 20210402031614 109.152.93.203 4 80 19682885 20210402173528 80.78.68.111 2 2 12203 20210415105042 86.160.82.97 1 18 4920806 20210426183207 213.205.194.242 2 21 4977292 20210425110117 85.255.237.222 1 9 4910356 20210403134926 192.111.139.162 2 2 12203 20210402001117 86.182.34.53 1 1 3600 20210421134142 90.197.2.9 2 2 6864 20210417111404 107.150.30.202 3 3 26390 20210416015048 217.155.193.75 1 18 4920406 20210409093837 213.248.241.201 2 2 3318 20210408163125 91.206.0.63 0 3 4839954 95.151.111.34 1 18 4920351 20210405175819 84.70.150.31 1 18 4920493 20210403202055 92.19.100.82 10 30 34456951 20210415181827 94.8.85.237 1 1 3495 20210430174440 2.58.45.2 24 123 34957700 20210429235331 92.28.167.73 2 23 5035018 20210415105526 62.252.60.70 1 20 4965194 20210424112049 86.184.27.57 8 24 4933204 20210404222530 31.181.76.156 2 2 12203 20210402094500 86.142.12.117 1 18 4921991 20210414215402 37.44.254.84 2 2 21895 20210426061422 62.189.127.37 0 47 0 82.12.33.61 1 18 4920509 20210429091250 51.146.60.55 1 20 4973446 20210424222913 92.40.179.134 4 23 9765598 20210402141857 95.150.195.164 37 225 50112646 20210429111527 88.145.182.163 5 62 19615815 20210403182313 86.174.179.162 1 20 4973453 20210425111852 51.140.142.200 2 2 6815 20210409222415 86.152.171.254 3 39 5108330 20210425111233 135.181.78.162 2 2 22749 20210429174658 86.177.148.122 1 18 4922142 20210425201110 116.209.100.31 2 2 12203 20210420092111 85.255.236.72 3 18 9828800 20210410185321 82.132.237.130 1 1 3541 20210427080024 3.250.83.145 1 1 3557 20210420200741 94.7.249.219 6 26 194612 20210425105311 151.231.180.255 1 1 3524 20210402181023 46.114.138.47 1 18 4921526 20210409194805 86.8.203.187 2 13 4838674 20210404152435 116.206.235.2 2 2 12203 20210409220045 80.192.167.58 54 113 15173954 20210415114911 147.92.153.12 0 1 654 212.102.57.145 4 4 24406 20210416184251 118.99.99.114 1 1 12126 20210430055213 213.205.240.216 1 1 3541 20210428172949 85.255.236.168 1 2 4835305 20210402182728 35.153.211.251 1 1 13156 20210421195509 92.20.254.208 76 104 5524505 20210427160255 213.205.197.217 2 2 7166 20210415105222 87.81.91.71 5 19 4912445 20210401130146 92.2.168.52 2 19 4923822 20210412153517 87.75.38.246 1 18 4921899 20210428132327 82.25.61.132 13 86 15141424 20210422231237 86.8.201.57 2 3 6745 20210404152536 37.120.235.156 3 3 25517 20210426090715 64.233.172.234 1 1 4039 20210427193047 90.197.4.58 6 37 5081809 20210428194412 116.24.64.74 2 2 12203 20210403045947 90.217.94.205 2 2 7215 20210421190058 78.46.204.123 182 184 904935 20210402010112 1.2.230.79 2 2 12203 20210427161642 86.184.225.49 12 71 14912748 20210412181021 81.102.176.199 14 38 9971486 20210426162501 46.161.15.40 8 8 48812 20210421095134 54.198.55.229 1 1 13217 20210422181241 66.102.7.217 1 1 4039 20210401194528 90.254.4.40 4 44 9964867 20210411073645 209.239.115.181 2 2 5910 20210427093844 89.32.123.184 2 29 248874 20210424221142 54.219.169.19 1 1 13324 20210430142215 213.205.197.195 1 18 4920343 20210402205603 176.10.107.180 2 2 12203 20210412011803 81.156.6.167 3 9 83840 20210424231908 185.86.10.219 1 20 4973503 20210424221834 109.152.178.45 1 20 4973446 20210424233047 35.81.170.193 1 1 3602 20210419010734 223.243.183.15 2 2 12203 20210419144940 72.195.34.59 1 1 12126 20210412204208 81.105.95.7 42 340 70439228 20210430112615 213.205.197.235 1 2 4835396 20210403123116 167.114.173.221 1 1 3475 20210430073101 82.132.232.128 2 2 7200 20210422070159 103.134.25.80 1 1 12126 20210430122649 90.210.6.95 19 63 44175163 20210428212916 81.98.119.158 3 23 9878318 20210415234524 109.156.97.18 1 19 4904081 20210403103437 213.205.200.71 1 2 82083 20210418161944 18.236.196.142 1 1 7115 20210410014935 86.147.137.114 49 306 56301720 20210430182609 92.19.96.190 4 27 14707909 20210410192653 69.171.251.117 0 1 244872 148.252.128.155 1 4 12803 20210407173603 142.4.218.55 10 10 40806 20210424215333 86.149.227.233 1 20 4973506 20210425150621 77.99.148.132 1 18 4920963 20210406175825 34.216.187.8 1 1 13217 20210417161613 86.149.170.224 29 207 44771907 20210414223043 223.214.217.246 2 2 12203 20210411160450 88.108.206.66 1 17 4909618 20210424185434 82.132.246.119 1 10 4885488 20210422134800 90.255.9.182 1 18 4920659 20210425070603 82.46.41.70 1 20 4973511 20210425081953 192.99.8.19 1 1 3475 20210405141859 173.252.127.19 0 7 4874904 66.102.6.105 1 1 4039 20210420175214 31.181.254.226 1 1 12126 20210412123950 77.99.26.69 4 76 19850913 20210424220343 90.197.172.34 2 2 7098 20210430224949 77.101.147.46 4 17 14781 20210425090323 123.6.49.6 1 1 8220 20210422095341 85.210.200.134 9 11 88624 20210408151708 82.132.222.255 3 5 9674379 20210408133013 112.201.76.79 12 58 24613743 20210418153617 109.146.123.142 1 8 4873673 20210422194624 89.243.108.82 1 24 5076698 20210430064457 81.132.21.85 16 230 50487371 20210429163134 80.88.211.34 5 28 5098670 20210429132138 81.136.21.55 1 1 3373 20210408185050 34.82.116.29 0 1 244872 210.220.70.7 1 1 3513 20210414073851 86.18.63.224 32 100 15240486 20210429151913 85.255.233.194 2 9 4866438 20210417141121 129.12.215.61 1 19 4921613 20210429165833 94.181.44.79 1 1 12126 20210412044006 46.19.141.83 2 2 12198 20210418223809 213.205.240.33 1 4 4871945 20210412175600 86.162.224.125 7 47 5240300 20210430124141 143.159.221.64 1 20 4973453 20210425090429 90.221.219.59 2 2 6974 20210426205621 52.34.76.65 2 40 9841352 20210406144213 78.86.144.253 1 1 3541 20210426065650 213.205.240.83 1 13 90650 20210425224115 109.147.163.247 72 773 174144421 20210416164413 221.230.78.59 1 1 12126 20210422150732 89.197.83.114 13 34 5083414 20210416132617 31.54.240.149 3 26 5011215 20210427234530 79.65.1.114 1 18 4920441 20210403121335 38.145.68.118 1 1 3495 20210430061546 78.86.132.44 1 1 3373 20210407184444 94.11.17.21 2 36 9840694 20210405141752 86.8.200.95 1 12 4916765 20210410101940 109.152.97.75 1 1 3549 20210429231051 106.5.175.240 1 1 3318 20210408181441 119.246.119.131 1 18 4922164 20210422144909 92.40.174.153 0 13 63335 86.170.124.194 1 1 3495 20210430085603 85.255.237.101 2 28 7234 20210405111005 221.5.11.110 2 2 12203 20210405115348 180.183.226.236 2 2 12203 20210402060109 147.161.167.28 2 25 5087970 20210426095333 139.99.104.233 1 1 12942 20210424043659 51.219.235.12 1 21 4958647 20210407115151 92.2.173.16 4 8 106662 20210421065103 200.24.255.93 2 2 12203 20210429213232 180.150.38.69 1 18 4922442 20210422125024 82.132.226.2 1 14 3617 20210404062917 202.44.240.118 2 2 12203 20210417221650 185.220.101.21 3 3 24329 20210425051645 109.153.175.144 1 20 4973453 20210425090020 86.18.63.128 9 62 19614947 20210426222954 83.171.225.54 1 1 12126 20210413144618 94.6.60.159 2 16 9681036 20210429175057 82.132.226.155 1 3 48642 20210424184857 90.207.7.63 2 19 4926322 20210404223342 82.26.175.81 7 28 5054342 20210422135056 109.234.37.227 6 6 69846 20210428112720 109.249.187.19 1 1 4923 20210413162914 54.76.175.47 2 2 16842 20210411120349 86.160.87.20 17 73 10251387 20210430001501 91.240.109.1 6 6 78367 20210427194100 94.9.37.101 3 43 10000741 20210430225438 158.69.124.235 2 2 9007 20210430064532 186.167.1.210 1 1 12126 20210408211311 92.232.169.125 3 30 4955138 20210424233359 92.40.175.123 1 1 3377 20210402100125 92.40.175.191 1 1 3629 20210413103215 34.67.16.31 1 20 4920721 20210401235942 213.205.240.135 2 19 4924110 20210403153411 80.2.20.200 3 4 4843875 20210418185821 82.26.201.125 1 18 4921841 20210424004335 134.249.198.227 2 2 12203 20210413093555 62.33.235.111 3 3 24329 20210411225345 34.86.35.16 1 1 12854 20210402180308 157.90.240.62 116 123 868894 20210401233109 82.132.214.227 1 1 11392 20210426171031 185.241.224.229 9 27 4983463 20210409101212 92.40.175.124 1 1 3377 20210402124002 109.145.211.205 2 2 7500 20210406093747 82.132.225.139 1 20 4973503 20210424232658 82.132.224.100 1 2 4836242 20210402203014 5.71.188.134 118 122 704297 20210418214054 90.192.12.170 1 18 4920796 20210422142604 135.181.155.76 2 2 13421 20210426055724 78.86.9.241 1 1 3530 20210405141423 95.144.62.91 15 17 164648 20210413094143 86.179.59.130 1 18 4920349 20210425094444 144.76.94.113 4 4 8222 20210422181409 31.13.115.8 1 8 57932 20210426051053 192.111.137.35 2 2 12203 20210401172152 203.133.180.29 0 1 120377 86.11.204.106 1 18 4920659 20210424221440 31.181.38.89 2 2 12203 20210413204142 90.205.20.11 1 18 4922142 20210415164354 86.22.36.149 3 5 36198 20210411054826 188.126.175.142 2 2 12203 20210404073840 177.36.159.34 2 2 12203 20210425010323 85.255.234.49 1 9 4913738 20210412195156 1.20.100.111 2 2 12203 20210405164530 35.172.137.48 1 1 13264 20210419163653 110.93.150.38 0 1 1286 5.65.74.63 125 153 5817374 20210427211059 180.163.220.99 1 4 38800 20210402111154 119.42.123.169 2 2 12203 20210405131815 89.240.128.170 6 10 112193 20210427123752 211.249.46.189 1 1 3583 20210413170921 87.80.20.96 40 123 20448025 20210411124951 90.204.152.16 1 18 4920557 20210405145553 82.153.168.40 1 18 4921142 20210414171106 82.132.218.218 1 1 3543 20210421014921 88.255.102.114 2 2 12203 20210419140859 212.250.117.163 1 2 4835621 20210426145113 179.191.224.50 2 2 12203 20210413175222 86.186.65.173 2 19 4923984 20210405183152 92.40.190.91 1 1 3515 20210422191326 81.151.92.119 3 30 14788549 20210422162443 86.162.116.148 1 17 4903881 20210403125136 82.132.232.120 1 5 3373 20210408210350 82.132.242.195 1 3 114139 20210412223538 180.191.56.143 1 1 13091 20210412095647 213.81.182.57 2 2 12203 20210402124905 3.141.163.156 2 2 12203 20210405193224 135.181.198.164 91 91 407852 20210402010407 86.175.89.155 1 18 4920311 20210420170706 157.90.167.28 130 134 847489 20210402021457 80.41.95.199 22 83 68725380 20210424215423 79.78.87.73 2 24 10069782 20210426222048 81.130.224.104 14 14 73710 20210403172308 185.220.102.248 3 3 24329 20210430080137 192.0.99.11 0 1 288422 110.93.150.176 1 1 3500 20210419001416 90.3.64.203 5 21 4916485 20210403132403 92.40.174.246 2 2 8930 20210410145305 86.173.41.4 1 3 3318 20210408104459 94.11.10.56 1 1 3530 20210405165002 24.249.199.4 3 3 24329 20210425060023 92.29.146.166 1 24 5076636 20210425191601 109.249.185.66 1 1 3920 20210422135316 94.11.17.147 5 58 14768224 20210409161049 90.211.228.140 1 21 5014814 20210423170215 82.132.247.123 1 1 3541 20210426150049 86.190.208.142 6 67 15034128 20210425203517 176.12.106.30 8 52 10136759 20210426103746 60.216.58.144 1 1 12126 20210411015619 95.145.115.56 1 18 4920498 20210405145727 188.235.61.22 2 2 12203 20210429235100 86.180.81.204 19 37 5015600 20210423222842 81.151.52.28 1 18 4921841 20210420164015 109.153.71.162 160 237 54391689 20210426191255 77.96.109.53 1 2 4835077 20210405142729 90.197.7.254 32 118 29776371 20210411164717 109.155.112.16 1 1 3373 20210409083928 86.139.240.131 1 1 3583 20210414095856 172.245.142.82 1 1 3278 20210403194110 192.252.211.197 4 4 24406 20210426165408 85.255.233.213 2 9 4839414 20210407142644 82.132.232.253 1 1 3336 20210403171958 78.46.73.116 18 18 145974 20210430033518 213.205.240.202 1 1 3538 20210409192114 51.81.139.66 1 1 12126 20210412093828 90.192.41.48 6 25 5057242 20210413224245 80.41.94.219 7 8 23846 20210407090700 92.40.174.205 1 2 4835381 20210422080944 90.192.59.249 12 31 4967134 20210401143438 172.58.107.61 1 18 4922520 20210422005921 109.148.187.214 2 22 5018222 20210416204102 114.111.32.193 1 1 3543 20210421135824 213.248.241.165 3 3 10251 20210411174257 45.87.212.88 2 2 13024 20210410124125 89.201.193.228 3 3 25961 20210424074756 90.197.171.96 1 18 4925512 20210420191946 176.100.111.30 3 3 24329 20210419011056 86.163.6.1 1 14 3340 20210412175838 125.123.124.208 1 1 12126 20210427114240 193.9.114.254 2 2 50987 20210409200832 100.11.54.9 1 1 3617 20210403130143 66.249.83.11 1 1 4039 20210401160626 92.207.199.161 18 43 5250561 20210428104728 36.85.59.187 2 2 12203 20210429063732 2.29.136.97 1 18 4921472 20210409192634 213.205.194.168 1 18 4920406 20210405142004 5.188.210.18 5 5 57372 20210406201100 94.193.97.36 2 33 9891066 20210424214557 92.40.176.102 3 3 18474 20210429082924 86.1.205.7 1 18 4921786 20210406211542 86.24.28.52 2 13 4920627 20210425095937 92.40.181.195 1 18 4920493 20210404110446 180.163.220.47 0 1 6415 78.86.0.117 2 5 53107 20210424171447 109.152.191.37 1 1 3541 20210428140854 92.40.190.159 0 1 654 51.6.134.248 1 20 4973448 20210429222906 86.152.74.207 86 330 56106059 20210430221827 86.8.188.221 1 18 4921526 20210410152704 185.69.145.14 1 18 4933703 20210412181701 86.182.34.121 1 1 3389 20210405225126 37.187.196.70 3 3 24329 20210406050143 217.42.221.173 11 52 10081881 20210410142131 94.175.123.178 6 22 5011049 20210424064327 88.97.77.126 1 18 4920343 20210402182548 168.119.11.187 140 140 2921314 20210430024118 113.128.39.71 2 2 12203 20210409142646 195.246.120.36 2 2 10101 20210412092101 65.21.52.136 123 125 749570 20210402004711 109.154.178.17 1 20 5036805 20210411021422 85.255.236.112 1 20 4973506 20210425150949 92.40.176.107 1 1 3541 20210428181337 185.220.100.248 1 1 12883 20210409183958 3.86.114.47 3 3 10641 20210424110939 86.141.234.136 43 66 5227704 20210425092213 5.81.117.93 1 18 4921743 20210415151203 81.154.221.172 17 41 19584596 20210421202356 177.222.161.18 1 1 12126 20210427152814 94.6.190.110 87 104 356048 20210430220632 5.65.71.107 1 18 4920556 20210422181700 51.146.238.141 2 5 9738 20210403163323 86.190.46.125 4 61 15066897 20210416174303 109.155.194.34 7 9 87176 20210425122649 92.40.176.160 2 5 7879 20210401210349 49.71.141.101 2 2 12203 20210402085406 178.130.123.178 2 2 12203 20210416190217 51.19.171.215 1 18 4901222 20210429173439 82.26.201.30 6 25 45089 20210425075740 109.249.185.76 2 2 6801 20210409135838 110.93.150.95 1 1 3602 20210418164326 82.132.227.136 3 23 4983852 20210414183612 94.205.24.76 1 22 5031414 20210411143657 46.64.39.107 1 16 4903960 20210403124351 90.195.101.20 5 27 5073774 20210424233604 90.208.53.14 1 17 4905931 20210427095955 157.90.169.241 35 38 302419 20210402030603 114.111.32.139 1 2 18206 20210420232150 94.15.104.168 2 38 9895466 20210425064657 157.90.175.152 56 56 267166 20210402020122 42.236.10.76 0 1 568 211.249.46.52 1 1 3487 20210426174040 123.234.46.51 2 2 12203 20210405124953 168.119.169.3 139 147 1324893 20210402031447 86.182.34.158 1 1 3560 20210411161711 46.243.220.88 2 2 12203 20210422104712 90.210.27.16 1 18 4921799 20210412182330 27.44.198.21 2 2 12203 20210405100250 152.44.107.249 0 1 20214 82.44.248.119 1 20 4973509 20210424214944 54.190.37.150 1 1 3495 20210430012938 90.192.58.126 1 18 4920133 20210429194445 89.238.177.176 2 2 7442 20210401044910 143.159.253.223 21 21 80073 20210419182225 45.151.167.11 1 1 77 20210416024713 189.146.147.21 2 2 12203 20210401145925 109.152.191.83 1 1 3600 20210421162740 81.109.128.201 1 20 4973511 20210425102012 52.52.190.187 1 1 3332 20210406153403 82.13.40.66 1 16 4897325 20210403121626 90.194.233.9 1 1 3494 20210410134823 86.129.222.220 1 18 4920357 20210409205324 92.40.176.81 1 10 4878656 20210408173149 157.90.240.66 40 43 359027 20210401151953 191.243.115.80 7 33 5094071 20210427225933 46.233.82.89 0 1 701 164.39.212.186 2 25 5080123 20210429123802 2.223.69.27 2 15 7276 20210422185646 109.151.163.188 4 27 5058759 20210411091804 82.132.225.92 2 38 9894007 20210424214241 109.151.10.95 1 11 4887286 20210402181331 103.102.141.61 2 2 12203 20210404160135 185.12.45.118 1 1 12126 20210429175520 193.113.48.9 6 48 65815 20210428080836 82.33.180.182 1 18 4920406 20210405150142 81.109.252.177 6 27 5060429 20210422095803 85.255.236.104 5 31 9766940 20210404171637 90.199.156.160 1 1 3583 20210414175640 109.152.97.150 1 1 3660 20210419191241 168.90.199.24 1 1 8039 20210429004302 86.155.162.5 1 1 3456 20210423173048 82.132.227.4 1 3 4836317 20210403122425 86.4.246.113 1 18 4920492 20210415220847 122.106.58.68 1 18 4921643 20210423100943 77.97.7.83 1 18 4922922 20210418202455 121.4.181.178 0 2 1489 31.48.178.210 2 17 4915486 20210409165111 170.83.179.245 1 1 8039 20210426122953 5.69.161.15 1 18 4920659 20210424215946 148.252.128.104 1 3 12405 20210403121932 81.158.178.88 3 3 10222 20210405153832 2.218.95.126 1 18 4921786 20210413195823 67.205.174.91 1 1 3602 20210419075830 86.167.1.194 3 3 11022 20210416164736 84.67.86.61 1 18 4920566 20210405182814 1.192.195.8 1 1 6056 20210430074930 86.142.30.246 1 1 3641 20210414094155 201.212.187.38 4 4 24400 20210405015309 116.203.147.122 96 101 918394 20210402002209 94.6.191.221 1 18 4921841 20210418173515 86.174.131.132 15 22 287373 20210414153450 107.23.190.136 1 1 13314 20210428014119 45.154.255.68 1 1 12126 20210412011804 82.132.235.48 1 2 4835362 20210412135803 192.210.167.201 1 1 3773 20210429124301 85.174.10.233 2 2 13019 20210424014320 183.89.59.97 2 2 12203 20210415064917 82.132.235.147 3 10 4883582 20210427130517 103.54.36.59 2 2 12203 20210408031507 52.56.62.202 5 7 130408 20210418093051 90.192.27.206 1 18 4920562 20210410071733 34.75.173.132 1 1 3332 20210406124632 92.40.190.74 1 2 4835294 20210423092108 82.132.224.171 3 5 16157 20210413173516 82.132.240.255 2 19 4924110 20210404120319 5.80.104.62 1 18 4921306 20210417022359 213.205.240.210 1 18 4922088 20210419143048 51.15.225.216 1 1 13324 20210430141349 86.164.6.6 1 3 4836964 20210410100350 54.39.16.19 4 4 6815 20210426055303 46.4.83.150 68 68 1370895 20210430140617 92.40.177.39 5 7 17876 20210405173316 213.205.240.169 1 1 3660 20210419170602 2.126.128.237 1 17 4914151 20210405223822 77.101.67.206 2 2 6912 20210423080040 63.141.247.178 2 2 12203 20210407203953 82.21.116.247 35 526 120335150 20210428203346 92.40.179.54 0 2 110567 125.166.139.95 2 2 12203 20210405183000 109.252.108.147 1 1 6959 20210430210906 78.46.90.120 64 64 1244647 20210430151900 178.20.55.18 1 1 13324 20210430141352 51.195.188.98 4 4 39651 20210417185009 89.197.8.10 1 18 4920965 20210406164214 51.146.43.161 28 333 75178943 20210430162452 2.97.167.159 1 5 4885969 20210414212443 86.140.143.116 165 249 30593500 20210430005313 178.136.56.246 2 2 12203 20210405133012 104.227.106.203 1 1 10627 20210424145424 213.104.124.147 2 3 4838702 20210417112329 109.249.185.10 1 18 4920404 20210427170023 81.156.2.8 1 20 4970097 20210413214529 54.202.4.213 1 1 3487 20210425214631 82.132.245.251 1 16 4897048 20210422135148 157.90.175.149 1 1 3278 20210404203922 86.169.227.110 2 6 97450 20210429085252 148.252.133.115 2 11 9824135 20210430105944 213.205.194.173 1 18 4920493 20210417211729 195.189.89.252 2 2 12203 20210401224222 170.210.4.222 2 2 12203 20210429070818 180.163.220.95 0 2 14727 86.134.111.76 1 3 114086 20210411073544 92.38.136.69 15 15 116931 20210425114745 92.40.191.123 2 3 9371 20210414085907 81.178.135.147 1 1 3318 20210409084330 51.6.249.28 8 45 9861776 20210403211341 35.226.128.22 0 1 33258 213.205.194.113 2 15 70388 20210419165936 86.185.106.6 2 22 5057941 20210429065618 54.69.168.72 3 3 10774 20210420015340 142.44.215.7 4 4 28515 20210424212515 163.156.209.145 5 45 9966332 20210422111904 86.170.191.193 1 18 4920406 20210405143401 77.100.36.219 1 12 119870 20210411140715 148.251.185.171 2 2 12203 20210405192520 82.132.235.223 1 1 3660 20210419190945 94.130.167.105 1 1 3239 20210405125159 79.159.105.14 1 18 4925718 20210424112420 183.87.39.174 2 2 12203 20210411080000 192.186.177.213 0 1 654 13.233.73.212 1 1 3543 20210421065858 82.13.251.49 1 18 4920351 20210405142007 109.154.109.117 12 12 40306 20210405174030 185.220.101.203 1 1 12126 20210422002520 51.19.172.132 1 17 88576 20210409161611 183.166.123.96 2 2 12203 20210426120909 92.232.170.57 10 10 45995 20210428062037 86.159.83.50 1 18 4920406 20210405142448 182.253.246.171 2 2 12203 20210404002531 86.148.169.46 2 4 117242 20210410084314 90.195.97.81 1 1 3332 20210406105459 158.255.46.97 1 2 256517 20210426075401 96.46.146.254 3 3 24329 20210402140645 114.239.146.154 2 2 12203 20210412122739 51.210.205.6 6 6 52364 20210412114422 84.247.48.14 3 3 25057 20210402004220 110.93.150.109 0 1 149771 90.203.80.165 2 2 6974 20210427134628 195.171.128.2 1 5 4981397 20210427094643 216.218.212.244 0 24 5729567 31.24.217.222 3 24 5041582 20210421143722 35.196.239.63 1 22 5031414 20210411130433 86.10.190.128 9 24 115944 20210425154635 5.157.12.155 1 1 11459 20210405130014 81.101.165.252 1 18 4920434 20210404180141 38.18.37.8 0 1 244872 82.3.44.214 3 20 180246 20210424212750 213.105.183.98 1 11 7265 20210425073708 5.44.168.127 2 2 12203 20210409191739 92.40.170.186 1 1 3583 20210414214656 81.68.118.100 0 1 543 90.206.192.210 22 161 20662939 20210430091043 83.167.171.63 1 18 4891809 20210409160530 62.189.127.36 0 43 0 86.21.56.111 2 25 4946615 20210412180736 78.47.119.7 2 2 6530 20210416233649 86.164.83.144 25 133 29774546 20210416193844 109.155.112.193 1 1 3541 20210427171237 195.92.38.20 18 171 39760116 20210428120417 34.216.11.193 1 1 3278 20210404011814 185.69.145.167 4 21 9814933 20210427202759 86.142.214.212 1 3 3783 20210424220804 5.70.104.105 3 22 4928412 20210409212110 195.206.183.226 7 7 25354 20210416092316 94.5.196.93 30 32 159964 20210430222337 188.34.178.100 129 131 809493 20210401222950 135.181.96.102 172 179 1818446 20210402023442 81.158.171.16 1 18 4920273 20210412180622 86.146.219.184 1 18 4921841 20210408213645 92.40.174.18 1 18 4920493 20210404154132 94.2.171.53 1 1 3558 20210403215811 81.103.79.42 1 20 4973506 20210425205511 82.9.179.0 1 14 64429 20210407211836 78.148.1.148 2 20 4961134 20210416211138 86.156.86.48 3 21 4928941 20210425202643 109.157.65.106 3 23 4948484 20210410204947 79.71.190.88 3 17 4906856 20210416064756 85.255.237.104 1 18 4929086 20210403123726 2.25.42.60 1 3 119929 20210411094524 34.204.79.150 1 1 12854 20210401134118 192.3.139.153 3 3 6344 20210408204622 82.132.227.50 1 18 4922869 20210403144228 86.158.247.194 1 21 5136060 20210430221652 24.115.152.248 1 1 13156 20210422093940 180.163.220.124 0 4 8644 95.149.138.157 3 22 9745224 20210405182153 88.255.65.124 1 1 12126 20210425214925 34.83.235.0 2 2 0 20210405141412 119.132.62.235 1 1 12126 20210416014051 109.156.215.53 1 18 4921799 20210413060748 85.255.236.83 1 18 4920806 20210422225549 51.105.33.7 1 18 4921899 20210407172714 114.111.32.217 0 1 654 13.66.152.34 1 1 14298 20210409012933 45.181.47.1 2 2 12203 20210424233658 86.137.119.100 1 1 3617 20210403135656 94.4.87.8 1 18 4920406 20210405141855 193.113.57.166 4 42 5034740 20210423081411 185.69.144.156 1 1 13447 20210413133654 86.170.31.182 29 112 39429369 20210430185935 86.148.239.229 2 2 6902 20210406232705 138.128.6.254 0 1 13806 185.220.101.195 1 1 12126 20210404230333 143.198.122.115 1 1 3519 20210411015608 42.60.164.93 1 21 4955663 20210418221453 114.111.32.163 1 1 3487 20210425130007 35.143.123.99 7 7 25005 20210422124734 211.249.46.123 1 2 4055 20210428131532 86.4.130.211 1 18 4921938 20210401211227 109.154.36.111 1 18 4920493 20210411184527 18.132.16.119 1 1 3513 20210423152650 81.105.94.192 1 18 4922057 20210429185851 46.64.34.24 26 256 59992922 20210430202329 82.34.128.193 1 18 4920343 20210402181245 122.232.167.142 2 2 12203 20210425110048 5.45.80.13 2 2 25606 20210407212816 86.179.138.62 5 24 4935417 20210408171706 51.222.13.156 3 3 36936 20210404084351 90.196.141.184 14 75 33993190 20210410104321 2.30.182.2 4 42 9848324 20210404125526 86.166.111.174 1 18 4922788 20210424220812 86.168.242.56 101 1816 411108210 20210430192932 81.141.167.105 3 3 10355 20210429210637 208.127.53.51 22 45 5161383 20210428145812 82.24.113.50 4 27 5087065 20210430200224 92.15.201.88 1 20 5036806 20210410225247 90.194.235.253 1 23 5062884 20210427084455 18.236.214.100 1 1 3377 20210402012011 90.214.89.149 1 1 3530 20210405151342 47.254.230.6 1 14 4901568 20210412022543 23.129.64.235 1 1 12126 20210416024716 92.40.190.75 1 3 4927365 20210423064742 146.90.215.62 48 177 59285053 20210425124627 125.209.235.180 0 4 4884306 213.205.194.107 2 20 4904870 20210402172227 119.29.109.115 2 2 7124 20210420144551 177.143.141.235 2 2 12203 20210401015205 109.151.95.216 2 19 4924060 20210410075919 52.37.118.25 2 2 7090 20210424013211 86.177.252.136 8 72 29608000 20210429210810 185.46.213.85 1 18 4925407 20210422100124 98.162.25.23 4 4 24406 20210425050401 49.235.16.218 0 1 354 54.202.32.241 1 1 8781 20210429235900 86.189.243.72 4 22 4933815 20210410091506 81.154.67.13 5 51 10164253 20210429223921 109.147.65.75 1 3 24678 20210422120413 103.28.121.58 2 2 12197 20210410193758 107.158.86.48 2 2 6411 20210423172032 79.78.92.215 2 42 10029920 20210419092937 103.106.219.208 2 2 12203 20210423161348 90.192.13.117 19 23 287700 20210413143604 183.89.165.46 2 2 12203 20210401143500 109.155.112.127 1 1 3336 20210404083802 77.98.165.10 45 171 44775364 20210430164539 194.33.196.4 1 5 134247 20210422134910 94.3.142.137 1 18 4920929 20210410110322 157.90.21.47 182 188 1302423 20210401224217 94.11.111.154 33 54 5152146 20210430074725 213.105.202.82 31 58 72586489 20210430103515 86.173.25.185 108 748 169459805 20210415161844 90.204.84.176 1 1 3524 20210402181044 86.162.118.142 1 1 3487 20210426225707 90.192.50.36 3 3 10654 20210404181315 86.17.78.186 1 18 4920806 20210422201508 90.240.158.65 1 20 4920634 20210403083940 213.205.194.194 1 1 3513 20210423173701 2.30.126.17 1 17 4906608 20210409183242 109.152.220.169 1 18 4921553 20210407080209 85.115.53.202 7 45 10071236 20210426131801 31.48.254.66 2 3 41089 20210425084554 191.101.132.183 3 3 35865 20210424141930 92.40.190.152 1 1 3583 20210414190523 190.2.132.136 6 6 36609 20210426224101 89.34.164.23 1 14 85039 20210406155839 91.222.38.90 2 2 12197 20210430051800 128.208.4.97 2 2 9056 20210415150949 86.164.207.87 5 28 5092516 20210426205631 213.205.194.105 1 18 4920629 20210425102616 180.180.151.201 2 2 12203 20210401204643 5.65.85.162 0 4 111035 13.228.104.57 1 1 3318 20210407144442 192.42.116.26 1 1 3487 20210428061206 146.200.192.40 1 20 5036746 20210411124753 120.34.199.100 1 1 12126 20210428211402 52.56.62.225 3 18 10788 20210423102646 78.19.67.63 1 18 4920322 20210406183841 217.43.131.209 2 19 4925652 20210414232736 170.83.178.227 2 2 16078 20210426015552 86.164.247.0 5 5 17913 20210420191411 87.81.117.74 1 18 4921377 20210408112146 2.25.42.34 3 35 5088683 20210430073125 13.66.162.184 14 14 201317 20210430212413 185.220.101.215 1 1 12126 20210419211413 110.93.150.45 1 1 3664 20210413214235 5.65.96.4 21 24 144213 20210426210322 198.20.176.238 6 6 9096 20210415091202 44.227.133.159 1 1 4571 20210401061703 117.85.89.84 2 2 12203 20210421135508 52.117.127.93 1 20 5013541 20210401174245 52.56.62.229 8 13 83628 20210426074215 45.55.9.226 1 1 4569 20210423061251 165.225.81.109 4 22 4934334 20210406163323 92.40.168.108 1 1 3543 20210422085930 82.10.113.234 1 10 4866295 20210422144604 66.249.93.43 1 1 4039 20210401221041 54.221.93.137 1 1 3377 20210401175758 148.252.132.42 1 9 4919461 20210409174740 192.99.18.122 1 1 3377 20210402015330 34.83.67.118 2 2 0 20210429181243 85.255.235.29 4 19 44651 20210429174944 114.111.32.100 1 1 3503 20210411124226 188.214.11.37 0 1 244872 86.147.219.69 18 137 34774337 20210422172058 176.27.99.0 1 1 3347 20210403092935 43.225.194.26 2 2 12203 20210411004846 86.186.184.16 1 20 4920721 20210402114555 158.69.27.213 9 9 39474 20210428142914 65.21.56.145 105 106 495235 20210402004739 65.21.110.16 1 1 28416 20210410220245 113.128.26.166 2 2 12203 20210401181520 134.35.229.24 3 3 37401 20210422140316 157.90.171.68 140 147 1299942 20210402002959 86.183.98.219 4 57 14881391 20210410225823 81.104.105.56 65 978 234747021 20210429183044 110.93.150.157 0 1 654 86.162.110.70 9 95 20188362 20210429134120 35.230.10.252 2 2 0 20210424212515 92.40.190.149 1 3 24571 20210415075824 109.146.61.253 15 62 15037303 20210429083915 86.187.160.175 1 1 3660 20210419065526 92.40.189.56 1 1 3641 20210415125303 31.132.220.2 4 4 24406 20210412190915 31.52.123.131 1 6 4896746 20210404095022 213.205.192.80 1 2 4835313 20210407080100 80.95.45.113 1 1 13314 20210426163753 91.125.60.12 1 17 4907929 20210403235705 90.203.83.78 1 1 3583 20210414131015 82.132.241.32 1 4 16723 20210406203432 217.44.201.173 1 1 3530 20210405145803 117.85.88.187 2 2 12203 20210411111835 87.228.32.117 2 2 12203 20210405231716 185.69.145.139 1 18 4930346 20210409124646 51.195.103.74 3 3 24329 20210403214724 65.21.60.211 147 153 1030787 20210401231911 94.14.196.58 7 10 78253 20210430093429 61.78.127.199 5 26 5045506 20210411085018 209.127.17.242 3 3 24329 20210414221038 148.252.128.67 3 21 4974714 20210422230605 213.205.194.30 2 19 4925115 20210410093500 92.29.106.163 2 19 4934108 20210417163659 213.205.200.49 3 66 15094656 20210414143536 86.172.3.232 9 16 224173 20210411201336 188.126.79.27 2 2 23021 20210414162036 181.129.181.10 2 2 12203 20210409215412 82.132.217.153 1 1 3930 20210429134259 90.195.98.169 8 29 5059227 20210416232043 63.141.245.194 1 1 8039 20210411070433 177.36.77.34 2 2 13030 20210410093639 193.56.252.196 3 24 5039948 20210420165306 120.83.251.164 2 2 12203 20210413145152 191.97.3.198 2 2 12203 20210401103743 188.240.114.131 2 2 12203 20210409220411 86.137.29.135 1 1 3435 20210401230910 159.192.227.95 2 2 12203 20210403034902 86.106.74.211 1 1 3487 20210426222609 66.102.6.232 1 1 3583 20210415200228 213.205.200.94 1 7 4872459 20210409033128 213.205.194.40 3 3 10623 20210426090501 114.111.32.108 1 1 4388 20210413220307 80.88.203.58 4 36 9818244 20210422134943 117.68.146.25 2 2 12203 20210402005554 217.79.178.53 1 1 12126 20210414082643 116.203.56.178 1 1 3487 20210427092712 194.33.192.6 9 31 5237777 20210422134448 94.5.117.236 4 23 5091307 20210412132020 168.119.249.199 159 166 1195654 20210402011038 31.49.83.204 1 20 4973511 20210425093425 206.189.158.28 3 3 24329 20210402032214 51.19.166.209 1 17 4951447 20210425100043 213.104.126.35 3 4 11218 20210405151820 185.69.144.161 2 9 4857877 20210416141307 5.80.131.91 5 26 5048845 20210418142308 116.232.115.203 1 1 12126 20210414232637 121.5.113.11 1 3 20147 20210420142308 200.73.130.238 1 1 12126 20210418231202 94.10.142.128 2 21 4974131 20210425094121 34.77.72.232 1 1 13217 20210417162056 90.193.247.24 10 30 267133 20210411110914 92.14.91.206 3 22 4929695 20210402141639 178.165.72.177 2 2 12198 20210423122513 31.124.47.217 1 22 5031508 20210417224003 117.69.24.181 2 2 12203 20210416013941 92.40.178.233 2 2 8175 20210420222924 135.181.196.223 153 160 1805562 20210402000431 211.249.46.63 1 1 3602 20210418130558 125.209.235.179 0 2 18036 86.162.115.169 1 17 4903995 20210415141715 34.218.240.19 1 1 3456 20210423013407 91.73.52.132 0 1 62287 109.156.117.210 2 22 5018772 20210417220440 192.3.214.24 1 1 10627 20210423132909 82.132.222.207 1 1 3660 20210419213103 18.237.181.80 1 1 3378 20210401021844 86.137.53.32 2 19 4924893 20210422225027 185.163.110.68 3 3 8865 20210427221106 90.211.230.7 1 20 4920676 20210406130415 94.11.62.253 54 94 5307279 20210419215827 104.168.65.195 1 2 12620 20210429124432 185.178.220.126 2 2 12203 20210402043038 77.99.146.109 1 18 4920602 20210425075831 5.80.179.249 1 17 4906293 20210423094110 90.217.139.89 6 30 5070882 20210430165458 58.49.170.21 2 21 4923900 20210404032110 82.39.120.161 1 18 4921743 20210413160733 85.255.235.61 1 18 4920403 20210405125210 195.154.172.137 2 17 4955689 20210427224430 92.40.190.223 1 2 4835395 20210420161259 79.78.78.81 2 46 10120166 20210429083848 90.203.86.136 7 9 142498 20210412182125 109.248.142.44 2 2 12203 20210413224948 213.205.198.28 1 18 4920414 20210409161313 86.167.150.142 17 71 14898028 20210412174322 60.242.225.118 2 2 12203 20210403104441 49.12.71.65 47 47 204519 20210402015643 80.2.23.88 2 6 4839135 20210401173542 86.22.38.67 1 18 4920759 20210418215023 91.219.237.21 3 3 24329 20210429220819 80.251.153.59 2 2 12203 20210414203538 82.132.220.106 1 18 4921799 20210412190334 217.35.101.16 15 54 15098575 20210421163828 185.56.80.65 2 2 12197 20210411112511 37.140.66.201 1 1 12126 20210423195331 36.84.109.9 4 4 24406 20210423192643 94.9.154.49 2 19 4930758 20210423115514 5.157.23.151 1 1 8039 20210417002204 147.161.167.86 3 23 5069036 20210428154345 213.205.240.11 1 1 3538 20210409171113 34.207.249.4 1 1 3377 20210402075708 92.2.167.185 1 8 4841004 20210405143635 31.121.24.34 9 27 4966998 20210415115859 188.34.200.92 40 53 838688 20210401182300 82.132.217.31 1 1 3541 20210429113028 81.105.94.223 17 93 19896003 20210424221129 36.57.77.26 2 2 12203 20210416023801 81.163.254.107 2 2 12203 20210407215437 176.255.61.247 42 99 5868241 20210430082021 92.40.175.205 1 1 3495 20210430121527 86.167.142.61 1 18 4920414 20210409160120 31.54.227.49 1 2 4538 20210403131556 86.9.36.77 1 18 4920493 20210403123550 192.99.47.125 1 1 0 20210423085123 5.188.210.27 3 3 39557 20210421124048 31.52.219.239 1 19 4998905 20210411112946 90.198.149.169 4 7 14510894 20210413085345 78.86.152.20 1 1 3690 20210405221746 92.40.191.125 2 16 5009241 20210414080944 90.213.3.78 10 25 34902 20210430215112 65.21.62.23 88 88 443602 20210401212808 82.14.32.4 1 18 4920406 20210405141857 157.90.240.60 131 142 2042096 20210402023248 109.148.51.153 3 3 12011 20210413090830 86.154.86.232 1 18 4920403 20210403131205 148.252.132.61 2 8 67489 20210423110142 82.26.204.179 20 159 39426355 20210430133339 23.108.52.40 1 1 3575 20210417152409 213.205.240.244 0 4 111035 31.205.221.255 1 18 4920506 20210410025403 122.4.40.103 1 1 12126 20210408170842 5.66.21.62 4 43 19699572 20210422141930 37.205.60.118 1 4 3435 20210402094020 2.97.165.27 1 18 4921526 20210410200414 78.86.130.230 1 2 4835421 20210414122356 31.48.139.82 1 18 4920170 20210405131906 92.40.190.165 1 9 4948781 20210415075750 86.148.100.225 17 93 20137968 20210430224706 162.247.74.27 3 3 24329 20210427044518 88.198.36.15 2 2 3622 20210405145550 183.141.100.211 2 2 12203 20210427230329 86.8.164.171 1 2 4835396 20210403124256 90.193.60.2 3 26 5084825 20210424222305 37.120.194.39 3 3 25517 20210427190023 46.65.190.13 5 43 9855935 20210405125147 52.4.104.152 1 1 4284 20210415224412 86.164.191.40 1 18 4920417 20210401140950 34.219.247.49 1 1 3456 20210423013355 86.172.2.113 1 4 4888408 20210424212532 90.213.2.39 1 20 4973446 20210424223714 86.186.66.22 5 5 17875 20210420155929 89.163.245.250 3 3 24329 20210411164617 120.21.229.193 4 9 97607 20210425232358 188.220.228.235 4 23 4932527 20210410205604 82.71.47.175 5 26 5050072 20210413173833 49.234.47.214 3 4 27003 20210418034558 64.233.172.238 1 1 3495 20210429202255 86.143.99.88 7 7 25323 20210429180734 46.8.16.245 2 2 12203 20210409060523 92.239.14.142 1 18 4921345 20210412133542 3.142.243.62 1 1 3403 20210410162103 213.107.65.130 2 2 6715 20210412164217 94.3.56.74 1 9 75885 20210425141035 78.106.87.3 6 6 48658 20210430220027 81.155.74.208 4 54 15129393 20210428120945 191.54.59.216 2 2 12203 20210424171806 113.116.47.196 2 2 12203 20210418200229 148.252.129.17 1 18 4921612 20210414210207 93.146.244.26 2 2 12203 20210418195228 187.19.165.194 2 2 12203 20210423201234 81.101.255.197 1 18 4920351 20210405142050 213.205.240.120 1 5 4856946 20210424215946 90.195.101.85 10 52 10097495 20210423163418 109.153.71.179 1 18 4878829 20210403162227 98.190.102.62 2 2 12203 20210403040151 34.84.235.227 2 2 49467 20210429041617 112.78.161.35 2 2 12203 20210413140120 82.132.242.73 1 4 4951706 20210410220429 213.121.246.82 0 40 0 109.145.118.137 1 1 3377 20210402114858 213.205.194.183 1 1 3920 20210422171339 3.249.19.185 1 1 3575 20210416212822 80.1.55.72 1 19 4927021 20210411000108 109.155.112.163 1 1 3435 20210401193553 86.30.239.214 1 1 4874 20210414131933 31.13.115.3 0 7 4885602 54.203.27.233 1 1 3487 20210429012551 86.162.173.143 1 18 4920406 20210405145753 220.64.105.1 1 1 3513 20210403061131 77.98.162.211 4 24 151956 20210425072140 109.156.81.183 2 24 5063981 20210424201026 92.232.189.230 1 18 4920414 20210410000151 120.21.89.172 2 7 129896 20210412230129 86.155.162.14 1 1 3622 20210403121143 79.78.90.146 1 7 144744 20210410222023 148.252.128.149 1 18 4905219 20210422181512 82.1.100.42 1 18 4921482 20210414204308 54.39.104.161 9 9 38459 20210422181231 79.78.67.206 2 42 10029802 20210422085154 86.191.252.100 1 18 4920705 20210404165715 86.175.166.157 13 34 5189335 20210413092752 90.200.5.191 1 22 5010958 20210404143024 168.119.69.91 131 131 2464876 20210430170842 114.111.32.218 0 1 568 90.197.5.120 1 1 3318 20210408100411 109.152.191.30 2 2 6988 20210409163328 82.132.245.70 1 18 4926555 20210416134804 3.235.253.56 3 3 10635 20210424083905 86.159.87.50 1 20 5036805 20210411124651 78.86.5.60 1 3 48779 20210425133310 66.102.9.77 1 1 11334 20210426100210 94.8.81.131 5 5 16390 20210405080334 213.107.66.91 1 2 4835325 20210426110023 80.193.38.130 1 1 3883 20210410233018 195.171.196.51 1 18 4920796 20210422141018 78.147.216.58 2 16 169128 20210411074441 81.131.210.155 1 14 26193 20210425074502 78.86.177.230 3 3 10539 20210423202156 92.40.190.98 1 1 3543 20210422092157 86.143.109.123 2 19 4930870 20210419081539 188.34.156.36 165 167 1011934 20210406114724 82.18.73.166 1 18 4920076 20210429195248 213.205.200.68 1 1 3617 20210403122921 180.163.220.126 0 1 1286 94.130.167.117 1 1 3201 20210411103634 92.40.202.19 1 1 4597 20210409122948 86.149.155.73 4 4 13392 20210404185839 167.172.132.13 1 1 3583 20210415023837 185.71.75.252 1 18 4920493 20210404105102 109.148.51.148 2 2 7925 20210417112201 2.126.79.75 2 19 4923838 20210409193543 81.147.139.137 1 1 3716 20210410181959 81.152.15.223 2 21 4940412 20210405122146 112.65.61.207 1 1 3541 20210428185347 109.145.126.193 6 66 19606022 20210409170523 178.46.128.165 1 1 12126 20210422231648 147.161.167.24 2 23 5034917 20210412155839 86.154.129.26 2 19 4924429 20210423061409 90.193.112.119 1 18 4920509 20210407084034 80.41.92.142 11 33 48812059 20210430205916 92.14.90.6 2 19 4925776 20210402041307 84.13.25.167 4 22 4932699 20210428010827 86.161.226.250 2 19 4923822 20210425082632 167.114.159.149 3 3 11882 20210430223218 79.78.89.45 9 9 31112 20210430102611 78.46.94.83 68 68 1446267 20210430015246 5.68.140.164 1 18 4920566 20210405152409 176.254.87.249 1 17 4909036 20210405185430 64.62.202.84 0 2 53037 27.254.149.139 3 3 24329 20210425203519 86.168.58.67 3 3 10439 20210417202553 151.224.231.214 1 19 4921842 20210423001849 78.86.168.125 1 1 3541 20210427150500 185.104.136.29 1 18 4921743 20210417093906 90.218.249.65 9 10 63886 20210412095443 89.206.252.19 28 322 70232404 20210430173838 92.20.15.118 1 1 4620 20210421175245 31.48.254.226 1 1 3632 20210417115210 109.148.71.4 4 10 14547126 20210408205519 147.92.153.10 0 1 921 80.225.159.97 24 303 65599893 20210426200806 217.160.42.149 1 1 3602 20210418171435 213.205.194.238 1 18 4923898 20210415125154 78.86.162.207 1 1 3294 20210405130517 92.40.178.79 6 14 87888 20210416131114 44.234.49.88 1 1 13194 20210409174418 86.129.35.97 1 18 4920434 20210403122625 185.220.100.253 1 1 9769 20210429175625 65.21.51.182 47 59 1130319 20210402005601 86.21.198.72 1 18 4920343 20210410154815 92.40.175.106 2 4 4938730 20210425222512 142.4.219.91 2 43 9998531 20210430184020 109.152.85.124 1 21 5014960 20210419211318 81.154.221.239 1 18 4921526 20210409234516 213.205.194.198 1 20 4973448 20210425171035 86.131.72.80 19 38 5020451 20210417170812 80.44.160.188 8 27 4954836 20210402230228 94.0.142.0 1 18 4920403 20210402181935 121.5.226.36 0 1 1495 35.231.113.20 1 24 5076498 20210424181041 31.127.202.62 3 22 5041739 20210409192522 86.166.85.23 5 21 36538 20210413222203 90.198.201.131 4 22 4932305 20210409163425 82.132.227.29 1 1 3435 20210401141146 79.78.70.72 2 38 9808338 20210401084427 60.185.205.133 2 2 12197 20210406183219 188.222.4.88 2 2 6874 20210402190815 2.29.206.233 2 20 5168283 20210405140223 82.132.221.159 3 24 5082910 20210430082054 46.243.220.121 1 1 12126 20210406161130 78.29.102.188 4 4 24406 20210405111342 2.30.182.17 17 166 35288958 20210429083228 89.243.110.159 1 20 4920662 20210408182026 2.29.139.133 3 51 14765038 20210426213422 81.154.111.98 14 62 29549967 20210414211943 82.132.213.220 5 7 63138 20210425074828 109.154.161.0 2 28 9808219 20210407070455 88.83.120.100 1 7 128493 20210416150452 195.92.38.21 2 44 10062948 20210422121616 109.147.226.1 30 53 5181537 20210430185733 213.107.65.153 2 21 4977174 20210425130622 117.89.130.171 2 2 12203 20210408135621 198.204.238.198 2 2 12203 20210414090946 151.227.132.146 1 15 4904687 20210429192229 92.18.192.184 94 1338 365599176 20210430213823 202.166.217.49 1 1 12126 20210403104120 211.249.246.132 67 71 1011277 20210430234108 94.26.209.61 2 2 12203 20210419150954 178.159.37.139 20 20 122030 20210429133958 90.212.13.27 1 11 66605 20210403200558 34.83.215.166 2 2 0 20210410220239 176.254.15.153 1 21 5031296 20210416164859 123.58.212.79 14 15 55128 20210423190555 92.18.213.30 0 1 244872 66.249.83.9 1 1 3575 20210417213444 86.159.178.33 1 16 56635 20210425080355 77.102.177.248 1 18 4921699 20210417185116 109.249.185.13 3 19 9749225 20210409194518 89.240.134.20 2 2 6974 20210429084820 52.56.62.207 8 30 4946321 20210427095907 82.132.223.160 1 19 4956895 20210425150828 54.190.54.35 1 1 3543 20210422012321 90.211.224.155 29 104 25067627 20210430215450 81.111.241.189 12 55 10185358 20210412154424 176.193.62.165 1 1 2955 20210427222202 86.8.215.127 1 17 4904581 20210407171320 79.78.87.117 2 42 10029802 20210421141213 182.52.171.2 1 1 12126 20210421011256 119.136.18.110 2 2 12203 20210412153730 107.152.254.218 0 2 2207 86.164.247.31 1 1 3487 20210429170824 94.195.230.16 2 38 9957464 20210429233951 90.215.252.182 1 7 49295 20210404133453 191.209.21.52 2 2 12203 20210427043034 192.3.10.171 0 1 13806 86.132.104.158 25 80 10834418 20210429180625 81.129.38.44 2 44 10062922 20210421202331 109.155.112.123 2 2 7143 20210428083625 35.222.105.97 2 2 12203 20210413131248 86.167.136.22 2 15 69779 20210422220101 86.172.123.184 1 18 4920659 20210424234036 115.62.127.233 1 1 11570 20210410162100 213.205.198.35 2 2 7254 20210416113835 95.105.125.151 2 2 21895 20210401055428 3.239.207.81 51 99 592200 20210419202053 79.71.163.169 8 31 5102327 20210425084607 101.88.150.38 0 1 198720 81.132.164.136 5 24 4936587 20210409165933 185.114.123.86 1 20 4973448 20210426105104 2.220.254.100 51 51 197656 20210414170826 90.216.213.204 1 18 4899376 20210405145731 90.220.87.126 67 216 25872864 20210430193641 2.97.172.37 1 3 114150 20210413221056 180.254.249.48 2 2 12203 20210406035423 99.177.197.197 1 1 0 20210409023708 86.129.137.214 1 18 4920566 20210405225418 90.220.210.76 1 16 56627 20210424223923 188.221.224.173 11 51 9986107 20210411205148 111.199.197.177 2 2 12203 20210416135107 109.155.112.203 1 1 3629 20210412181546 107.173.202.98 0 1 568 174.64.199.82 2 2 12203 20210424141745 34.83.125.251 0 3 734616 52.51.213.21 1 1 3575 20210416200644 80.193.2.41 9 111 25115073 20210424214722 90.202.176.153 17 87 10281681 20210429191745 81.102.176.180 1 18 4920493 20210403132141 78.146.62.103 3 24 5045053 20210423211602 114.111.32.37 1 1 3570 20210416151353 90.255.37.116 2 15 7060 20210405233630 35.153.134.224 1 1 12803 20210407101102 94.130.239.244 1 1 3487 20210427213831 192.99.13.56 2 2 0 20210423155506 166.205.147.59 3 16 11643 20210424230748 35.241.255.191 15 39 23715 20210429174658 82.36.196.185 2 19 4924236 20210422191040 92.40.174.0 1 1 3641 20210415154253 121.206.4.180 1 1 12126 20210401044922 218.75.69.50 4 4 24406 20210429133713 213.205.198.245 1 1 3660 20210419143626 107.175.89.136 0 1 654 81.129.34.221 1 14 3617 20210403123132 46.243.220.119 2 2 12203 20210409180152 37.115.112.150 2 2 12203 20210407205621 92.19.75.81 1 20 4973503 20210424234518 211.249.46.198 0 1 1286 222.129.32.232 2 2 12203 20210401183535 80.195.216.78 1 19 4927021 20210412164203 109.152.191.107 1 1 3435 20210401130859 81.141.167.75 2 2 8903 20210413134231 79.78.89.250 15 55 10010411 20210414075430 86.179.4.249 2 2 7054 20210402195114 77.97.120.141 2 34 9861644 20210424213613 31.131.73.230 1 1 12126 20210419024254 89.17.51.234 2 2 12203 20210422112419 82.132.232.56 1 20 5036747 20210410223005 109.155.115.24 1 1 3560 20210412130855 86.173.223.15 11 11 38563 20210402123809 51.79.77.176 13 13 72437 20210424215333 104.244.76.13 3 3 24329 20210422111547 116.206.101.226 2 2 12203 20210423015116 217.38.148.2 1 1 3920 20210422143915 73.174.23.54 1 18 4921553 20210402204909 110.93.150.67 1 1 3503 20210411162013 118.99.113.17 2 2 12203 20210401094328 213.205.194.202 1 2 17181 20210409120051 54.39.16.124 6 6 43877 20210424212559 213.205.200.36 1 18 4920434 20210403130557 82.132.227.108 1 14 3617 20210403133741 96.9.79.233 2 2 12203 20210419061546 86.19.94.103 1 18 4925890 20210419172140 46.208.39.96 1 17 4904785 20210402225526 219.147.112.150 2 2 12203 20210429195630 109.152.137.32 2 2 7200 20210421224604 54.80.251.77 1 1 12786 20210405175623 176.254.74.111 1 18 4920509 20210405194159 86.179.27.121 2 27 9883339 20210411085620 46.101.51.236 2 2 12203 20210428131658 85.255.234.101 2 2 7565 20210416082722 92.40.168.113 1 1 3602 20210419090436 213.31.217.237 1 18 4920614 20210422181451 5.8.213.108 2 2 12197 20210427081340 109.249.185.2 1 18 4920566 20210405165818 59.45.63.202 2 2 25217 20210412094939 54.183.181.45 2 2 12203 20210426072220 92.40.175.2 1 12 4932100 20210429080445 91.206.1.61 0 4 13280 34.223.229.162 1 1 3572 20210413012640 85.211.55.223 5 24 160899 20210425220218 35.239.144.96 1 22 5031414 20210412001019 171.192.0.10 0 2 0 213.205.192.87 1 18 4922142 20210414130148 54.149.166.127 1 1 3572 20210413012107 81.99.200.222 28 69 39270270 20210427084829 82.132.229.215 1 24 5076690 20210428155009 34.96.130.11 1 1 13324 20210430181037 5.102.58.41 2 2 12203 20210405092730 114.111.32.160 0 1 568 185.152.12.49 2 2 24252 20210401120928 134.35.13.177 2 2 12203 20210419132652 116.202.35.84 1 1 3340 20210412175339 81.178.191.209 2 19 4925143 20210409231101 31.48.254.175 2 2 7149 20210430222523 165.225.81.98 11 141 31804393 20210427025119 45.15.16.115 1 1 77 20210422002901 86.186.198.19 1 21 5014899 20210422164247 51.146.99.233 2 36 9842682 20210416133751 178.255.66.95 3 54 14761785 20210426162506 52.117.123.131 1 17 4907162 20210417091826 185.82.148.18 1 1 0 20210424101202 80.235.129.13 1 20 4973453 20210425080006 173.252.127.36 1 2 23761 20210424104325 185.220.101.205 1 1 12126 20210407212553 213.205.200.86 1 1 3783 20210425202408 90.218.67.122 1 18 4920216 20210412180347 176.254.71.43 11 161 35364076 20210420210127 213.205.200.59 4 4 14376 20210423091927 80.2.21.241 1 3 56630 20210425134022 54.91.161.30 2 2 8593 20210424221531 157.90.240.38 105 112 1312439 20210401220229 45.93.80.231 3 3 24329 20210406150539 94.130.167.91 1 1 3481 20210409160131 147.148.93.225 1 14 64340 20210420192931 79.71.177.173 3 22 4927455 20210408171737 92.40.174.102 2 4 51936 20210424142416 54.190.100.68 1 1 3462 20210425014139 77.102.22.58 1 20 4941754 20210411081011 80.168.199.75 1 20 4973448 20210427112303 85.203.34.84 5 22 5024193 20210412112521 86.166.46.248 3 22 4927455 20210407172517 109.70.100.50 1 1 12126 20210416024713 82.40.25.13 1 18 4920115 20210405180912 88.107.88.105 3 7 9709384 20210415193011 86.181.255.106 1 18 4920414 20210409160946 165.22.195.177 9 9 90714 20210422022101 109.155.112.195 6 6 21819 20210422215955 185.220.101.134 1 1 12126 20210406030754 93.115.193.205 2 20 4963543 20210424213851 82.132.224.155 1 18 4941807 20210424214958 2.125.252.193 1 20 4973448 20210427132414 120.21.5.166 1 1 3660 20210420082706 165.225.17.31 1 18 4923900 20210419152111 109.150.189.226 1 19 4998959 20210411132459 86.141.44.92 1 18 4920566 20210405174021 23.236.221.62 1 1 10627 20210405094620 109.152.97.95 1 1 3541 20210429083707 81.154.221.215 1 18 4920357 20210409161137 86.162.108.106 2 27 4960533 20210410085912 18.236.251.106 1 1 3462 20210425013652 193.31.103.78 4 4 37802 20210407142720 85.255.233.84 1 18 4920572 20210422173645 90.202.208.47 1 18 4922212 20210423212941 213.205.197.243 2 15 7919 20210410160426 81.135.194.72 1 15 4901234 20210402184204 109.255.168.111 3 22 14581906 20210404211447 94.10.175.107 1 18 4924238 20210404001501 35.178.79.226 1 1 3513 20210423182028 88.111.83.142 7 44 9949839 20210413162654 81.129.38.25 1 1 3641 20210414220227 149.155.37.31 23 62 92088759 20210429122226 86.147.250.160 12 140 34456970 20210411003236 188.222.253.22 3 25 5117276 20210415165601 92.40.175.208 0 1 4831838 80.43.230.242 3 3 9954 20210408234505 90.204.1.106 9 9 32316 20210409230354 82.26.157.150 2 19 4923820 20210405105804 82.25.165.113 2 17 4908429 20210405221621 92.0.46.233 1 18 4920404 20210428200452 86.131.60.194 18 20 111631 20210429215730 183.89.163.198 2 2 12203 20210406174041 218.71.151.226 1 1 3583 20210415033919 88.108.185.67 1 21 5014933 20210417133007 90.192.49.42 2 2 14933 20210428210050 94.8.197.203 1 18 4920406 20210405160321 90.251.49.210 9 16 9864326 20210416142256 5.66.187.99 4 20 4925300 20210412181837 185.164.109.84 1 1 12126 20210403225751 109.154.132.176 15 101 20234623 20210428163235 77.18.49.20 1 18 4921588 20210404200038 82.132.229.51 1 18 4920406 20210405180229 85.95.52.75 1 18 4922142 20210404142613 80.43.229.79 2 21 4984132 20210402111658 92.40.190.225 1 1 3349 20210424161743 213.205.198.27 3 4 10623 20210426134613 101.109.97.228 1 1 12126 20210401233604 3.10.152.179 2 19 162183 20210420000440 109.152.191.113 1 1 3373 20210408084430 82.132.235.109 2 19 4923838 20210409200636 66.102.6.107 1 1 3456 20210423135219 213.205.194.177 1 14 3690 20210406064112 86.134.42.238 1 15 4931932 20210425215236 20.84.113.192 4 4 39942 20210425170111 85.203.46.27 5 24 5078466 20210427121813 65.21.57.118 36 38 211119 20210401195519 158.69.241.99 8 8 48603 20210424213100 92.28.251.161 2 24 5087897 20210426185120 90.202.48.185 2 20 4924849 20210403190342 125.209.235.170 0 2 108624 94.2.131.79 6 6 21494 20210418204613 37.147.166.229 3 3 24329 20210402105711 94.8.93.165 58 114 10600115 20210403220041 2.31.168.255 1 1 3617 20210403123058 49.36.241.251 1 20 4920676 20210406071204 107.150.42.82 0 1 42497 81.69.191.124 0 1 16553 86.166.85.117 20 200 40628383 20210430190057 109.249.185.34 4 25 9859860 20210418110225 116.22.81.34 1 1 12126 20210415010629 92.118.160.45 1 1 12786 20210406000006 86.140.6.188 14 166 39387551 20210407211221 66.249.93.220 3 3 20126 20210421232240 3.91.223.3 1 1 11338 20210424213201 95.29.42.110 4 4 36455 20210417204407 31.53.44.219 1 11 58837 20210409181928 5.81.71.126 4 44 19872138 20210427212005 213.205.194.83 1 3 56633 20210424214525 90.210.1.19 2 25 5081401 20210428192036 202.44.228.66 2 2 12203 20210412080742 2.123.1.92 1 18 4920566 20210405215702 94.195.16.104 5 34 5000873 20210424220009 213.205.194.33 2 6 54336 20210430152316 86.167.176.222 1 14 4895338 20210405161511 86.151.74.100 12 225 54464289 20210415085840 86.138.7.177 1 18 4920543 20210410142803 2.29.40.128 6 29 5119160 20210425000818 82.132.223.132 1 15 4918808 20210405175509 103.204.110.140 1 1 8039 20210408001832 153.125.230.120 4 4 24406 20210420205419 34.85.63.9 1 1 3519 20210411042635 94.8.198.34 2 34 9811586 20210409160208 175.13.3.80 2 2 12203 20210421124335 85.255.234.9 0 1 47816 95.217.105.108 10 10 145962 20210406131410 79.66.35.21 1 18 4923261 20210418222641 185.220.100.242 2 2 12203 20210409041151 2.99.0.128 2 40 9841383 20210407204719 44.234.26.60 1 1 3583 20210415012346 123.160.221.28 8 8 13508 20210402173109 87.118.116.103 2 2 12203 20210429040718 117.68.147.144 2 2 12203 20210420185613 94.0.93.84 1 18 4920806 20210422210239 65.21.61.121 92 97 694151 20210402032315 185.220.100.244 6 6 48658 20210417010243 223.214.222.173 2 2 12203 20210408035024 88.198.43.207 87 87 1627398 20210430172312 81.152.109.105 2 19 9761430 20210410105226 213.205.194.43 1 9 4877772 20210407092252 86.150.183.252 4 40 9957726 20210410210656 5.157.12.64 1 1 11483 20210411103914 109.249.187.112 2 3 4838812 20210427122502 208.70.245.226 1 4 765709 20210410084927 34.211.226.25 1 1 34595 20210425082006 86.177.147.250 5 10 4895478 20210401154643 82.47.242.245 1 22 5031513 20210419164016 213.205.240.22 1 18 4920659 20210426071737 86.143.207.57 1 1 3641 20210415083523 95.148.69.46 1 17 4904480 20210402145429 91.78.0.13 6 6 36591 20210428012731 94.192.255.10 3 26 4993745 20210424221342 144.168.201.161 1 1 8039 20210425105341 86.144.209.1 5 28 5099496 20210427201711 213.205.240.143 1 1 4923 20210413012529 222.241.210.242 2 2 12203 20210427114039 88.107.89.47 2 6 4862362 20210408202810 109.155.112.116 1 1 3541 20210428164602 109.158.124.55 1 17 4919835 20210403114035 109.149.206.7 1 2 248221 20210424152728 23.236.142.106 1 3 24255 20210429124258 101.109.154.103 2 2 12203 20210430004915 66.102.8.209 0 2 164044 54.159.39.181 2 2 12542 20210411000543 86.30.217.6 46 244 45748979 20210430102156 90.255.7.23 3 41 9844767 20210406203100 5.68.143.210 1 1 3495 20210430173304 184.178.172.24 2 2 12203 20210413050653 3.249.236.40 1 1 3456 20210423200714 80.192.190.100 2 21 210918 20210410220537 49.177.161.178 36 118 24907421 20210424233556 78.86.6.172 1 10 3541 20210428215535 109.155.112.184 1 1 3632 20210417093849 81.141.167.35 1 1 3560 20210411224610 213.205.242.101 1 17 5034987 20210416135346 114.111.32.168 0 1 13806 82.132.212.250 2 2 6919 20210405152346 183.147.212.134 2 2 12203 20210410231637 92.40.174.22 5 10 4850494 20210401173250 109.157.62.115 1 18 4921799 20210412202647 52.117.125.35 1 17 4907162 20210417091821 86.168.53.243 1 1 3602 20210420092130 192.254.89.144 2 2 12203 20210402010356 82.47.196.145 1 18 4920806 20210423071852 5.62.43.240 1 18 4920659 20210425090335 92.18.205.75 22 317 102716612 20210408161551 109.147.13.226 4 27 5087129 20210430110437 217.145.199.112 2 2 12203 20210416063215 92.40.168.146 8 9 44517 20210403150422 81.107.236.28 8 64 15012597 20210430114258 167.114.101.27 9 9 37641 20210424213022 90.192.15.149 34 177 54196769 20210416210749 82.16.98.170 7 11 29236 20210406192759 94.8.80.25 72 151 83100377 20210430191644 79.78.88.62 2 42 10029882 20210414150705 94.1.120.16 0 2 226738 72.49.49.11 3 3 36397 20210428085457 82.132.246.50 2 8 50416 20210412143912 34.222.236.53 1 1 3332 20210406012258 93.190.111.173 2 2 23083 20210427033815 14.126.29.192 2 2 12203 20210412224448 110.93.150.43 0 1 20214 151.228.169.228 1 18 4924091 20210426134506 90.197.169.209 1 20 5036747 20210410223133 90.221.216.236 2 2 7166 20210415222742 95.146.163.210 1 9 58301 20210420075334 49.234.246.194 1 2 23587 20210408174630 92.2.197.113 1 19 4964853 20210422221659 94.7.248.219 7 11 114484 20210424211637 52.15.212.3 1 1 3557 20210420121013 109.148.204.210 1 5 4885737 20210406203514 117.79.134.74 2 2 12203 20210405181508 86.14.137.87 1 22 5031494 20210413190907 86.162.117.239 1 18 4920506 20210410090548 68.234.44.221 0 1 921 109.184.163.7 2 2 12203 20210413172312 86.162.116.58 2 2 7166 20210414220709 103.112.0.215 2 2 6245 20210402232443 85.255.235.2 2 2 26554 20210419220357 51.222.30.203 3 3 36936 20210403152528 79.78.89.161 3 27 10030613 20210415231736 174.138.20.8 2 2 6990 20210430150841 31.48.178.235 1 1 11397 20210425063953 195.171.176.86 14 58 10150745 20210430141913 82.132.226.231 1 1 3538 20210409184111 184.181.217.210 4 4 24406 20210430103922 171.5.24.136 2 2 12203 20210411020032 85.203.34.21 2 34 9821376 20210418221552 82.33.183.127 15 117 25080154 20210430170645 80.95.44.77 2 2 29119 20210410200359 114.111.32.76 0 1 1286 118.172.47.97 2 2 12203 20210408055720 185.159.163.121 4 4 34839 20210409132236 86.183.172.111 1 18 4920216 20210412175816 135.181.94.245 139 147 1451302 20210402032624 188.235.203.150 5 5 36525 20210409034608 86.184.228.200 2 35 9822913 20210423173057 87.80.28.237 2 2 6806 20210430062044 109.249.185.31 2 19 4969020 20210424215613 34.74.46.140 1 1 3332 20210406125339 86.191.251.95 5 52 19846938 20210425085044 211.249.46.77 0 1 11451 188.35.131.246 17 17 133848 20210429014800 82.26.206.149 1 18 4920659 20210424223855 212.67.116.58 1 1 0 20210423161128 117.90.5.175 1 1 12126 20210416201813 34.222.211.138 1 1 3495 20210430002311 88.107.92.61 4 10 14815 20210421203633 90.220.241.211 2 19 4926610 20210416175159 86.25.221.239 0 1 244872 86.164.207.75 3 4 4841901 20210430151709 34.77.246.112 3 10 6934 20210402180546 86.136.95.126 1 1 3530 20210405145410 86.185.63.178 1 4 27057 20210401121136 95.217.17.117 137 151 2217570 20210402024732 3.91.179.8 3 3 9870 20210402215811 94.3.59.68 1 16 179085 20210410220637 82.25.52.159 1 18 4920806 20210422215330 79.67.123.65 1 11 4976528 20210419065552 2.97.170.160 3 24 5042088 20210410193236 109.249.185.58 1 1 3541 20210429132140 90.206.195.201 8 28 5064930 20210411083444 188.220.91.1 1 4 15551 20210407090211 144.217.67.28 11 11 47203 20210425024712 194.35.233.164 2 2 7762 20210424104334 111.88.231.228 1 1 12126 20210410161627 79.78.74.20 5 66 15069636 20210411120511 31.14.249.125 1 18 4920806 20210422223456 54.218.154.159 1 1 3575 20210417011015 101.75.174.147 2 2 12203 20210418064103 35.199.180.64 0 1 244872 86.182.12.252 2 23 5035844 20210415212754 86.158.196.28 1 5 22446 20210403202457 86.152.200.55 19 118 24991834 20210419213156 114.111.32.83 1 1 8485 20210428115730 118.209.201.197 1 1 13184 20210420153040 3.90.13.163 1 1 12216 20210407125900 143.198.128.5 3 3 26628 20210426223051 94.10.94.132 1 21 5015774 20210430110523 92.40.190.6 1 1 3570 20210416082926 138.201.140.79 2 2 9341 20210421090817 49.71.141.146 2 2 12203 20210405140102 114.103.21.224 2 2 12203 20210426063932 79.78.65.232 4 48 10127304 20210425112952 128.14.209.242 1 1 3318 20210407142413 194.74.128.74 5 68 15035573 20210429130933 66.102.8.211 0 3 193128 159.192.165.170 2 2 12203 20210404025111 183.89.4.93 2 2 12203 20210415064558 109.249.185.43 1 18 4920659 20210425015419 109.155.112.93 1 1 3600 20210422084108 42.243.118.14 2 2 12203 20210408084515 65.21.109.10 1 1 11483 20210411103638 86.152.189.93 1 19 4972941 20210424215017 45.57.217.189 1 1 10627 20210406160631 3.249.224.55 1 1 3602 20210419201154 84.67.71.248 1 4 4951706 20210410220928 77.101.67.126 4 57 14825890 20210424221646 51.219.202.227 7 8 4856592 20210428122412 188.31.18.3 1 18 4920584 20210404212637 23.254.56.32 2 2 3032 20210426001733 167.160.65.204 0 1 20214 86.14.85.80 1 1 3336 20210403212300 81.147.94.59 2 36 9840816 20210430145706 94.181.47.232 12 12 98924 20210425002206 92.40.176.218 3 3 11184 20210423083622 2.126.117.202 6 14 9818740 20210425085136 95.144.143.183 1 15 80418 20210424150159 82.132.235.105 1 6 4854483 20210410103703 178.214.245.131 3 3 24323 20210414044926 77.234.43.182 5 28 5078146 20210425104206 90.221.44.251 1 17 4904187 20210422134709 128.208.46.93 1 1 4596 20210410223133 192.143.51.67 2 2 12203 20210426150925 2.96.163.52 1 13 4884874 20210425112349 82.26.176.171 2 19 4924043 20210410072535 89.144.141.241 1 1 12849 20210401121006 109.249.185.83 1 18 4920799 20210424213147 85.117.62.202 2 2 12203 20210420064050 92.40.175.52 1 23 5075715 20210425125515 176.248.123.206 1 1 3389 20210405161913 76.86.56.150 1 18 4922212 20210402181337 90.197.2.167 1 18 4920414 20210409163932 95.150.196.194 13 70 14808822 20210402114053 147.147.167.239 2 2 6821 20210412180656 86.132.121.143 4 26 19535779 20210426191032 157.90.175.65 117 122 809347 20210402005559 34.76.55.64 15 40 31943 20210424215336 198.245.67.26 0 1 1286 213.205.240.62 1 1 4923 20210412230051 66.249.93.45 7 7 27182 20210415092018 35.230.26.62 2 2 0 20210402181554 51.146.99.1 5 58 24431788 20210430053647 92.18.197.175 8 8 27633 20210430155835 170.83.179.25 1 1 8039 20210421144004 82.69.26.100 94 177 20541749 20210430204328 34.82.1.65 2 3 244872 20210403121022 86.144.181.63 9 122 29968222 20210417140131 165.22.43.8 2 2 12203 20210416073033 193.113.48.7 9 69 189587 20210426101121 54.213.12.217 1 1 3503 20210412012040 194.58.88.195 1 1 12126 20210410193111 92.40.171.156 0 14 139136 58.245.239.146 1 1 6864 20210408074335 87.81.94.35 98 143 179373823 20210430203759 81.141.48.213 1 12 4916765 20210410090319 92.40.168.126 1 22 5031511 20210421081813 119.42.125.110 2 2 12203 20210425174456 213.205.194.246 1 1 3487 20210427214529 109.156.81.165 1 21 5014915 20210420205646 109.156.103.220 8 29 5060828 20210413193927 65.21.61.46 109 113 1015126 20210402010543 81.151.92.174 12 19 33863095 20210409130049 148.252.133.143 3 10 4897386 20210413161801 185.220.101.142 1 1 12126 20210419181132 185.69.145.198 1 5 4845152 20210427114726 51.146.240.112 1 18 4920493 20210403190258 88.99.195.227 1 1 3565 20210403121035 18.135.29.202 1 1 4821 20210430211056 90.192.56.237 1 18 4920493 20210403123837 82.35.158.71 1 18 4921786 20210402143243 13.66.158.22 29 29 545719 20210430230625 77.222.109.213 16 16 221492 20210417095802 121.5.219.20 0 4 48884 90.210.40.14 2 5 9672404 20210403152120 45.224.255.135 1 1 3318 20210408043050 52.56.62.218 6 52 10172776 20210429140531 82.132.226.127 3 20 4934897 20210424140046 109.152.137.55 2 2 7505 20210406191044 86.129.222.249 1 20 4973452 20210424213149 51.210.80.127 1 1 12126 20210409184005 5.202.47.12 2 2 12203 20210413142641 144.76.22.144 1 1 3622 20210405145616 2.28.114.154 1 3 93773 20210430122740 185.169.233.136 8 8 29110 20210423190114 147.92.153.6 0 1 1286 81.107.70.238 1 1 10558 20210424013234 123.207.205.117 1 1 3377 20210401190658 82.132.226.177 1 20 4973511 20210425114603 117.57.76.111 2 2 12203 20210417105018 185.213.155.161 2 2 7360 20210421223202 92.29.33.6 6 46 9970017 20210413150759 94.8.92.105 1 18 4920406 20210405150542 114.111.32.104 1 1 3393 20210409172419 193.56.29.26 4 4 14172 20210421223528 82.23.244.221 10 50 14694852 20210412153848 169.255.126.211 2 2 12203 20210408101506 86.161.210.5 12 167 35418515 20210428202149 90.46.160.146 1 1 3495 20210430003955 185.92.25.104 1 17 4903939 20210426194254 94.101.155.130 1 19 5523464 20210420133015 79.78.68.128 3 39 9811690 20210407105155 88.107.88.219 1 1 3660 20210419192754 51.6.173.88 1 24 5084487 20210424213406 90.206.88.234 2 2 7231 20210422010843 109.152.230.247 1 1 8707 20210403224430 192.111.130.2 4 4 24406 20210427162505 82.132.224.218 1 1 3617 20210403124835 87.80.134.106 1 18 4920400 20210421233957 165.225.81.117 7 43 10133202 20210421100232 82.132.227.241 2 2 7167 20210425171854 92.40.180.147 1 5 26209 20210420150412 109.249.185.95 1 1 3527 20210402183502 82.132.226.42 1 8 5013056 20210410221232 212.49.224.94 7 91 20136784 20210423133620 37.120.232.67 1 1 2955 20210416100609 90.215.163.32 10 31 5070697 20210410213805 82.132.221.104 2 2 6806 20210430122033 94.195.114.221 1 18 4921841 20210408135358 213.146.158.149 1 20 4998840 20210421015347 65.154.226.100 1 1 3583 20210415170334 81.153.141.197 32 81 228687 20210412124553 82.5.198.42 1 18 4922948 20210422193120 87.80.156.149 74 793 127117742 20210430164402 82.132.241.185 2 2 7565 20210416102425 82.18.10.107 1 18 4920566 20210406020247 213.205.194.145 1 1 3560 20210412071233 82.132.223.198 1 20 4973448 20210425180938 78.149.77.74 2 20 4925550 20210423082107 34.244.46.139 1 1 3318 20210408200650 81.131.124.31 5 26 5047394 20210413190042 157.90.175.178 133 137 1275152 20210401234117 180.247.80.31 1 1 12126 20210422173240 94.5.3.29 1 18 4920357 20210409164252 92.18.218.215 5 96 24885846 20210429223634 109.155.112.35 2 2 7565 20210416084211 175.102.16.34 0 1 211475 186.159.3.41 1 1 12126 20210407092313 18.133.73.49 1 1 3377 20210402123354 86.182.34.201 3 3 10846 20210401162648 86.159.183.182 1 18 4920357 20210409160342 82.132.226.250 2 21 4924920 20210408154935 18.130.89.21 3 3 13145 20210423071830 179.107.59.187 2 2 12203 20210407205014 78.46.204.109 158 159 761300 20210401223138 150.143.183.132 18 41 5146493 20210429190948 82.39.128.38 1 18 4922605 20210429183738 82.6.27.196 1 20 5004795 20210423143800 35.200.76.224 1 1 13526 20210420091345 86.150.122.34 1 18 4920566 20210406095657 125.209.235.182 1 4 18672 20210410193957 138.88.130.204 0 1 346810 82.33.5.40 3 20 4930430 20210428160513 125.209.235.184 0 1 921 109.249.185.50 2 2 7098 20210430134419 90.199.156.49 4 25 9937973 20210411154532 185.81.157.139 1 1 13602 20210410055946 45.125.245.88 1 1 4499 20210427222616 92.40.190.231 1 1 3545 20210424073805 90.192.51.41 40 221 55089942 20210430223835 117.71.148.251 2 2 12203 20210401023808 82.132.227.70 2 2 6810 20210409174505 35.197.36.86 0 1 244872 86.130.62.125 1 18 4920493 20210403190111 81.154.32.234 1 18 4920415 20210403161319 78.86.174.75 3 3 10923 20210415080641 86.149.154.45 12 92 20741024 20210409161013 86.163.237.218 2 25 9797083 20210425103411 176.254.78.5 43 266 36176640 20210430121659 167.160.38.41 1 1 11459 20210412192925 193.60.220.253 5 24 4938131 20210403211605 95.150.228.85 72 1199 270740689 20210430130253 86.153.16.173 1 18 4920715 20210421204558 125.209.235.176 1 2 10531 20210404113936 188.34.159.203 90 96 912902 20210402024304 92.2.206.137 2 38 9893955 20210424225850 109.195.215.210 2 2 12203 20210416075028 183.143.110.78 2 2 12203 20210406230325 181.129.49.4 1 1 12126 20210407070555 95.144.143.150 1 18 4921524 20210417000128 95.144.240.23 3 24 5045180 20210422231322 82.132.229.131 3 4 4842105 20210409162513 31.54.138.179 2 2 7211 20210405145646 118.172.226.126 2 2 12203 20210403132521 34.75.235.17 1 20 4920661 20210409111945 18.209.22.50 3 3 10215 20210409184953 109.155.112.130 1 1 3600 20210422121539 79.73.43.66 5 24 4935814 20210407195709 92.40.175.0 2 8 4968454 20210430081513 138.19.193.114 4 4 24406 20210427134607 162.253.129.212 1 1 2955 20210403203408 90.211.225.146 1 1 3583 20210415084446 109.229.20.246 2 2 12203 20210401165257 51.161.117.63 7 7 40086 20210430122338 78.86.17.71 1 13 4871592 20210407153329 157.90.164.62 97 98 553922 20210402022523 188.166.188.124 4 4 39150 20210423155359 31.49.212.96 1 18 4920406 20210405141917 90.199.177.24 1 18 4921542 20210428075248 82.129.92.131 1 18 4920566 20210405184450 2.96.160.145 1 14 72719 20210409165747 95.216.12.101 3 3 24329 20210421023000 66.249.93.208 4 15 73904 20210422142553 213.205.197.213 1 18 4920403 20210402185029 31.76.124.109 1 20 4920726 20210406213810 211.249.46.160 1 2 24732 20210425232128 86.138.174.238 5 39 9851858 20210409165334 176.248.6.112 1 20 4920680 20210404210857 152.44.109.2 0 1 13806 35.230.123.0 0 2 489744 184.94.240.92 3 3 37775 20210412060942 109.144.20.219 1 15 4995927 20210418123000 117.89.133.16 1 1 12126 20210416001717 46.69.165.155 1 18 4920493 20210403132411 86.163.6.104 66 86 5243828 20210408132236 90.192.55.57 23 60 1040751 20210430090821 80.41.177.99 1 18 4920493 20210403121601 86.148.181.149 6 22 60225 20210405145320 211.249.46.81 0 1 921 90.199.247.165 1 20 4973504 20210424215741 2.123.77.157 2 8 7147 20210405141444 34.105.44.210 2 2 0 20210409160910 2.29.42.37 1 18 4920493 20210407172530 82.41.235.242 1 18 4920357 20210410152334 90.221.209.73 7 30 5105639 20210425123156 100.26.3.0 1 5 24946 20210412034518 85.255.233.90 1 8 4910356 20210403153853 78.46.197.37 121 124 700603 20210402031622 46.65.132.17 1 18 4925584 20210429090045 110.93.150.41 1 1 2532 20210403210516 176.255.55.29 2 19 4924694 20210424131009 54.72.55.91 1 1 3583 20210415200646 86.15.2.171 2 2 8128 20210422104213 81.136.21.100 1 1 3600 20210421083747 176.113.115.10 12 12 118770 20210422001850 82.132.225.210 1 20 5036805 20210415074852 110.85.162.227 2 2 12203 20210416003632 51.81.139.71 1 1 12126 20210412192911 85.255.234.209 2 4 117983 20210422192532 132.185.161.120 3 21 5017639 20210422135734 213.205.194.141 2 2 6778 20210406115408 195.181.163.129 1 1 12786 20210405220019 92.239.69.211 1 1 3530 20210405144724 92.40.190.77 1 2 4835294 20210422205524 192.169.139.161 2 2 13030 20210410082402 78.86.128.180 2 10 124919 20210413091545 109.146.213.82 2 13 5057760 20210412192551 92.40.190.21 1 1 3882 20210416082757 78.86.4.107 3 18 137101 20210423152316 138.197.147.158 1 1 4316 20210423061251 82.23.65.96 5 23 4938352 20210409223947 138.128.4.142 0 1 921 49.234.4.25 0 1 701 86.139.173.160 16 41 48515761 20210405195711 101.108.176.212 1 1 12126 20210401073420 5.64.124.165 1 20 4973511 20210425085450 65.21.61.41 56 64 1567746 20210401200816 90.221.42.207 5 36 14762171 20210418191837 109.155.112.241 1 1 3541 20210428113535 85.255.237.161 1 20 4973448 20210425142405 86.162.119.177 1 17 66150 20210422134723 45.159.23.131 2 2 21895 20210425092218 123.10.13.189 2 2 12203 20210425180228 92.19.101.218 1 18 4921526 20210409181544 194.33.192.48 8 41 10076176 20210424205239 109.249.185.103 1 18 4920740 20210422142007 101.51.173.72 2 2 12197 20210418045128 82.132.235.60 1 10 36330 20210422144359 87.80.252.39 3 37 9844944 20210424222219 119.42.67.47 2 2 12197 20210415011719 92.40.175.102 1 3 4927452 20210421081049 151.231.80.64 2 17 4883047 20210402194137 52.205.181.203 47 60 394630 20210412213923 82.132.235.207 1 8 4868827 20210429174753 24.235.4.63 1 1 3349 20210424185139 188.34.200.103 121 126 1210437 20210402025713 92.40.193.109 0 6 57410 90.201.87.122 35 82 97651818 20210425162825 80.192.190.52 1 18 4920493 20210404122713 36.80.114.143 2 2 12203 20210429094720 92.40.174.204 1 18 4920806 20210423074200 193.113.57.165 5 24 87814 20210430082744 148.252.133.244 1 16 4954200 20210424214825 91.77.108.18 4 4 24394 20210412185904 92.232.171.130 6 48 10085856 20210419011205 198.23.226.192 0 1 6415 86.1.222.234 1 1 3487 20210429095151 91.203.146.126 3 3 24329 20210403215001 46.254.250.112 1 18 4920509 20210428155056 78.47.67.67 124 130 731499 20210401222946 90.211.226.85 3 3 10806 20210418234648 78.86.62.7 1 18 4921553 20210405082500 181.177.111.211 2 2 6672 20210424061209 111.7.96.144 2 2 3378 20210401000947 181.129.147.27 3 3 24329 20210416083722 92.204.170.186 2 2 25568 20210403082131 194.33.196.3 3 33 14746819 20210424190833 185.220.102.253 2 2 12203 20210428183015 217.43.208.176 1 18 4922605 20210411184128 86.138.40.89 2 48 10153272 20210428110534 86.137.32.103 28 111 98516835 20210424130733 81.152.232.71 1 12 56627 20210424232342 188.222.164.199 17 38 5174671 20210425225118 147.147.200.243 1 9 35108 20210405184815 80.82.136.189 1 20 4973448 20210426160037 86.148.239.209 1 1 3435 20210402110336 79.66.219.88 1 16 4900438 20210425003858 37.144.112.183 2 2 12203 20210421020325 92.40.174.208 2 2 6912 20210423090804 49.12.39.231 140 142 774840 20210402005246 92.40.190.19 1 1 3570 20210416082749 194.165.16.83 1 1 12684 20210404143258 88.99.144.161 2 2 3726 20210424215607 172.96.94.102 0 1 921 217.42.75.192 2 18 60986 20210425090724 92.40.186.217 1 1 3641 20210414081130 211.249.46.136 1 1 2532 20210403214025 81.129.229.155 19 24 19509178 20210411232251 87.80.153.194 1 18 4920311 20210421211907 199.34.86.236 0 1 20214 195.189.60.97 1 1 12126 20210421190017 90.195.234.63 1 17 66502 20210405133403 31.221.251.136 3 21 4929891 20210425135545 46.185.51.13 1 1 12126 20210418145339 49.12.101.14 92 97 766041 20210401215107 66.135.227.181 2 2 12203 20210411154552 52.56.62.227 12 12 43758 20210411220102 192.99.62.32 1 1 3773 20210419233011 3.89.109.117 1 1 12009 20210409161653 146.198.139.192 1 20 4973511 20210425095901 92.40.171.72 0 2 4923909 94.119.96.1 1 1 3583 20210413134135 86.158.158.39 1 20 4973453 20210425114721 213.205.197.132 1 18 4921841 20210422210506 194.33.196.47 1 1 3685 20210420120022 34.82.3.241 2 2 0 20210422171453 18.209.241.14 1 5 24398 20210428000434 90.210.137.104 1 18 4922088 20210404184132 95.216.152.179 2 2 12203 20210404031247 168.119.252.212 115 124 1876803 20210401235352 3.238.55.132 1 5 24846 20210410152457 92.40.191.182 2 2 7114 20210420205301 86.18.105.189 7 71 15149870 20210428184343 82.132.233.166 1 12 4890735 20210403151903 84.71.107.99 3 47 10111604 20210427085908 95.217.152.54 1 1 12687 20210422181243 88.107.91.51 6 11 9724291 20210406200947 31.53.194.198 5 24 4938420 20210402182559 5.66.186.162 2 23 5036243 20210418113444 92.28.253.244 1 11 5003810 20210428195105 213.205.240.38 1 12 167510 20210411122256 46.64.35.29 5 85 19907551 20210416163145 82.31.114.88 1 18 4920434 20210406223915 36.156.24.95 2 2 12203 20210406092415 176.249.3.246 1 19 4927076 20210419210958 79.78.77.126 5 43 10038117 20210410165406 182.107.134.88 1 1 12126 20210412191829 5.133.11.116 6 6 78837 20210428065026 86.189.189.215 5 28 5098908 20210425200206 109.249.185.75 1 1 3560 20210412094128 85.255.237.115 1 6 4927511 20210418161504 109.152.242.23 3 37 9845712 20210413104736 54.187.140.240 0 5 1224360 101.75.162.165 2 2 12203 20210408152002 94.3.96.9 1 18 4920509 20210405201443 109.156.11.129 1 18 4921001 20210413143211 78.86.24.247 3 3 13475 20210412192710 213.16.81.182 1 1 12126 20210419024748 86.137.29.250 1 1 3373 20210407231132 34.105.1.44 2 2 0 20210424215337 86.186.238.80 1 18 4920749 20210422223644 185.100.87.243 4 4 36455 20210412090827 92.40.171.221 1 1 3627 20210416090532 35.197.117.132 2 2 0 20210411103630 34.222.191.138 1 1 3575 20210417010950 183.89.127.189 2 2 12203 20210411153100 91.199.145.21 1 18 4921312 20210406144715 110.78.168.105 2 2 12203 20210410162858 86.143.207.115 1 1 3513 20210423112001 135.181.198.159 138 140 837599 20210406112825 88.198.36.62 66 66 1269874 20210429084348 156.67.35.158 3 23 5023820 20210412200627 85.209.89.243 2 2 12197 20210426143157 3.250.92.192 1 1 3487 20210428200745 84.65.122.118 1 1 11397 20210425085301 51.161.115.226 5 5 22111 20210415115601 175.4.114.184 2 2 12203 20210419153625 82.132.229.98 1 1 3627 20210416171531 109.249.187.20 2 19 4924922 20210410161525 82.12.81.199 1 14 149024 20210411071338 202.169.246.55 1 1 12126 20210410152333 86.149.155.138 1 3 115414 20210410202351 94.4.91.116 7 47 14910808 20210412151230 185.169.233.138 6 6 21342 20210422103609 90.197.5.255 10 52 10091795 20210421151247 42.236.10.107 0 1 6415 82.36.147.14 1 18 4920659 20210424220024 180.248.24.235 2 2 12203 20210421115143 82.132.226.7 1 4 4865827 20210410093219 94.2.120.230 1 18 4922844 20210407074305 186.248.113.158 2 2 12203 20210423084024 193.218.118.183 1 1 12126 20210423122508 90.213.165.211 1 14 3530 20210405180917 86.8.201.223 1 2 4835341 20210412171544 90.252.83.193 1 14 3538 20210409163011 92.40.175.201 1 3 119927 20210410221428 54.178.182.46 1 1 3318 20210408065654 86.179.4.216 1 1 4923 20210412211514 86.128.188.98 1 17 4904546 20210403175450 90.206.180.196 1 18 4920749 20210422222845 132.185.160.132 4 46 10071226 20210419141416 81.105.102.183 2 2 8283 20210410062605 158.46.127.166 2 2 12197 20210427153021 51.146.252.145 10 60 5146200 20210424215500 87.81.89.181 2 17 4909713 20210401223922 84.247.48.7 3 3 24989 20210406091907 90.197.74.172 1 1 3541 20210425175526 86.13.46.6 1 18 4920164 20210425180023 46.64.143.6 7 27 5045146 20210421160418 213.205.198.89 3 3 10623 20210427124012 90.219.204.212 1 1 3686 20210410121431 51.146.254.154 1 18 4921799 20210425140243 82.132.225.50 1 2 4835440 20210418144810 165.225.16.122 5 28 5090157 20210426211029 114.97.204.173 2 2 12203 20210401212518 36.90.123.58 2 2 12197 20210418195056 54.39.103.203 11 11 51166 20210429175157 176.25.213.132 20 138 39762343 20210430201828 42.192.17.155 0 1 654 95.149.171.174 1 20 4973511 20210425005128 82.34.251.25 1 18 4920400 20210402180649 86.182.223.226 12 108 24851473 20210419161220 34.78.108.29 1 1 13314 20210427093209 34.212.135.124 1 1 13264 20210419215738 80.0.208.76 1 18 4920749 20210423160749 81.105.146.36 1 18 4922088 20210427230451 34.217.112.112 1 1 3462 20210425014039 18.237.167.14 1 1 12009 20210409160501 42.236.10.81 1 3 32685 20210419081253 82.132.222.245 1 18 4920351 20210405160453 176.254.86.245 2 19 4925064 20210409185456 36.26.221.20 2 2 12203 20210426110950 86.144.33.73 3 20 5016847 20210429213708 175.44.42.158 1 2 9804 20210406102001 65.21.62.12 163 169 1139054 20210402025825 88.97.16.31 2 35 9934043 20210412164921 5.150.99.96 1 20 4973448 20210426100640 147.161.167.21 1 22 5031513 20210419090039 213.248.241.182 1 1 3318 20210407112451 92.15.98.32 1 18 4920557 20210423230438 213.205.200.16 1 18 4920351 20210405160717 90.209.79.22 83 211 200290493 20210429144631 213.248.241.184 4 4 13417 20210411224206 18.207.120.216 1 1 3475 20210405190527 92.16.5.130 2 21 4924016 20210404122335 213.205.194.251 1 18 4920566 20210405154413 34.214.200.35 1 1 12719 20210402184552 92.40.174.54 1 20 4973506 20210428121847 92.40.190.82 1 2 4835294 20210423071913 188.220.51.69 1 20 4920722 20210401125658 52.56.62.190 2 2 6951 20210407105348 86.132.70.13 2 18 4901677 20210401180030 199.249.230.148 2 2 12203 20210430230101 211.249.46.205 1 1 3583 20210415055335 213.205.197.226 1 1 3617 20210404100806 188.222.255.237 1 18 4923261 20210407220053 90.252.54.99 11 162 35324778 20210426204613 87.74.14.103 1 18 4920357 20210409180924 82.132.224.101 1 18 4920602 20210425095023 86.178.18.184 2 19 4924067 20210405193507 206.217.141.247 0 1 20214 177.136.14.178 2 2 12203 20210407045845 62.255.253.162 1 1 3378 20210401112021 92.28.169.54 1 18 4920562 20210410092725 183.88.38.244 2 2 12203 20210411183904 147.161.167.11 3 45 10066625 20210421134416 86.157.113.230 7 9 70600 20210425193831 181.215.176.153 3 3 25467 20210419204257 46.33.33.120 3 3 24323 20210413202735 86.135.132.116 2 2 8252 20210428092248 185.69.144.86 1 18 4920614 20210422183110 86.8.21.44 1 18 4920400 20210402181029 94.12.239.76 9 44 15000212 20210426211844 213.205.198.162 1 14 3247 20210429174812 3.249.190.92 1 1 3332 20210405201155 66.115.149.104 3 3 26628 20210427141431 41.71.9.126 1 1 12126 20210402035338 86.157.126.249 2 20 4922112 20210409160223 148.252.133.90 1 5 4866027 20210426113904 157.90.114.227 144 148 1096126 20210402011846 87.115.13.232 4 39 14686714 20210415154554 86.180.88.129 1 1 3641 20210413210321 80.42.36.90 1 16 4896745 20210403175826 80.41.91.152 1 18 4920796 20210422142002 46.243.220.106 4 4 24406 20210429221256 94.5.196.108 1 13 4895622 20210422202947 46.105.45.118 4 4 39756 20210414171850 82.21.230.98 1 20 4973448 20210425174103 34.77.162.14 1 1 12803 20210407125851 110.93.150.63 0 1 13806 51.15.239.254 1 1 0 20210405075413 62.250.143.96 1 18 4921889 20210401153129 175.174.228.141 2 2 12203 20210420051623 84.71.116.232 1 18 4929406 20210420211742 123.97.96.36 2 2 12203 20210403145439 54.218.50.188 1 1 18042 20210410105540 13.66.165.70 6 6 92039 20210412043605 46.64.150.103 2 23 5015435 20210413151524 82.15.38.157 88 121 649860 20210430143840 77.82.248.111 2 2 12203 20210416222721 82.132.231.50 1 24 5076690 20210426103502 146.200.253.230 21 36 133227 20210409182508 199.15.236.121 1 18 4920406 20210419094150 90.197.2.221 2 2 7414 20210417231849 65.21.61.42 107 112 729535 20210402022206 92.10.4.121 1 18 4921799 20210413204138 109.248.149.24 3 3 25455 20210415084324 2.97.171.117 9 32 5112818 20210429211546 82.165.126.203 1 1 3543 20210421155140 103.203.133.250 2 2 12203 20210413184517 34.217.65.84 1 1 3543 20210422012538 176.255.120.211 1 18 4921472 20210409200928 79.78.64.56 11 36 19500701 20210408171621 66.249.93.210 3 7 48359 20210422142553 178.69.12.30 1 1 12126 20210412092318 185.247.224.14 4 4 36450 20210428164945 69.171.251.116 0 1 244872 3.129.65.40 1 1 3349 20210424161616 144.217.71.169 2 2 7262 20210430095552 82.34.195.113 1 22 5031481 20210416100422 101.108.199.1 2 2 12203 20210427214917 213.205.240.132 1 2 4835461 20210405150554 13.77.163.14 12 12 231274 20210423204139 157.90.19.132 145 145 726767 20210402031308 125.123.127.234 1 1 12126 20210411000530 86.13.240.29 2 2 7149 20210403121237 13.77.171.82 18 18 320164 20210430230223 87.80.30.62 1 18 4920351 20210405141407 195.194.82.4 1 20 4973448 20210426115155 78.86.6.226 1 1 3549 20210430191517 90.194.109.218 1 20 4973509 20210424212720 92.40.193.120 1 16 4974101 20210422081927 165.227.132.233 2 2 13019 20210424034815 46.183.135.164 2 2 12203 20210404072421 2.97.163.130 6 113 25207698 20210428211126 139.180.228.57 1 1 4596 20210429124306 194.35.233.224 6 8 66874 20210428094312 92.40.174.103 1 1 0 20210426050400 92.23.197.200 1 18 4923089 20210422011318 2.97.164.151 4 6 124942 20210418194628 36.89.192.115 1 1 12126 20210408153018 54.159.38.137 0 4 979488 2.25.42.51 1 1 3435 20210402093006 34.253.164.171 51 82 5401915 20210413141207 92.40.173.53 1 3 4927511 20210419220024 31.13.103.19 0 1 4831838 86.143.172.240 1 18 4921799 20210412214526 90.206.89.19 2 24 5063291 20210429195115 188.29.93.90 1 9 3538 20210410173058 90.208.139.28 9 50 10167384 20210424212646 213.205.200.18 1 21 5021322 20210425141649 86.162.117.29 1 1 3487 20210428190418 109.156.127.99 17 50 5284707 20210415092151 86.180.141.95 4 64 15048392 20210420180955 120.35.203.200 2 2 12197 20210403204055 156.67.32.98 1 14 4863832 20210405181546 113.103.120.137 1 1 12126 20210421111300 86.182.16.241 7 42 24234923 20210405081834 78.86.142.162 1 1 3549 20210429223201 94.4.56.54 11 11 38110 20210430133802 86.184.200.186 1 18 4920414 20210409164314 2.219.98.84 1 18 4920493 20210412175535 217.42.98.198 1 16 115789 20210425193637 93.124.116.81 1 1 12684 20210404183421 69.64.55.94 1 1 2955 20210430094042 79.78.126.53 2 9 58802 20210425194047 154.21.208.42 2 2 3026 20210402133051 82.23.128.65 2 38 9957209 20210425203328 84.70.157.43 1 18 4920351 20210405143100 183.166.169.1 2 2 12203 20210401192433 125.209.235.171 1 2 5390 20210410194002 81.17.16.150 2 2 12203 20210426022848 213.205.197.187 1 18 4920566 20210406013312 88.99.161.50 8 8 34087 20210429085148 120.76.249.219 1 1 12126 20210409220316 109.149.96.207 3 3 12401 20210416072946 5.67.80.126 22 199 35603804 20210429184858 151.228.242.174 1 18 4920493 20210403121555 2.220.255.87 1 18 4920509 20210405171103 156.214.128.154 1 1 13314 20210427071440 88.99.227.17 102 108 2596853 20210402010352 81.136.21.39 1 1 3389 20210406161721 90.204.86.240 1 14 39793 20210418124533 107.189.31.181 1 1 12126 20210418223806 178.148.7.150 2 2 12203 20210418091529 82.3.190.116 3 20 4929246 20210422135028 36.71.234.11 1 1 3349 20210424143007 82.37.41.64 2 16 9672176 20210412201354 94.6.60.151 4 41 14679548 20210405090206 79.76.232.100 1 18 4921599 20210420171755 213.205.240.114 1 18 4920406 20210405181312 91.84.219.207 1 4 47492 20210405143844 103.111.28.162 4 4 24406 20210427081405 88.108.197.86 0 1 244872 86.15.240.226 4 21 4930781 20210405151800 178.17.170.91 1 1 13324 20210430141351 212.193.12.58 1 1 3290 20210402225428 94.15.105.160 8 38 10051165 20210429180327 171.79.66.132 3 10 273284 20210423071741 86.142.31.107 1 18 4920493 20210404091927 42.192.11.192 0 3 201292 82.132.242.90 1 18 4920351 20210405173146 168.119.176.110 124 131 866233 20210402030221 180.249.6.178 2 2 12197 20210401044525 90.197.172.241 21 40 5094092 20210425174845 86.21.34.37 9 49 9980839 20210411015053 34.125.144.155 1 5 24946 20210412120138 176.249.93.130 1 18 4920919 20210424073232 109.154.203.179 1 21 5110379 20210422140243 36.90.228.43 2 2 12203 20210429090151 177.54.145.61 2 2 12203 20210401013302 18.197.125.181 2 2 6952 20210417160017 198.46.190.179 1 1 13217 20210416230428 86.158.0.169 2 17 9777177 20210425071945 213.6.41.238 1 1 9769 20210407164414 34.96.130.12 1 1 12879 20210409172232 95.43.42.100 2 2 12203 20210417195058 82.132.225.204 2 3 4838750 20210423131950 18.215.166.152 1 1 3200 20210429180958 80.7.217.81 1 18 4920493 20210404184855 109.237.91.155 2 2 6556 20210404231952 115.239.76.175 2 2 12203 20210402004857 167.160.66.70 0 1 6415 211.231.106.61 0 1 124599 90.29.11.42 2 2 6920 20210419022342 94.101.157.123 2 21 4977174 20210425134218 109.150.98.67 2 19 4925064 20210409160756 51.19.8.238 1 18 4922353 20210426202832 185.220.101.143 2 2 12203 20210403085124 82.132.225.148 3 14 74905 20210417223125 23.129.64.237 3 3 25961 20210424075315 80.1.106.12 14 35 5092996 20210426190355 5.8.16.166 1 1 12126 20210401020115 5.81.254.106 27 150 83885688 20210419075049 86.147.22.140 1 21 5014901 20210422124752 86.132.54.141 1 17 4903446 20210416123443 86.172.11.171 6 27 5048295 20210411110737 3.239.226.79 1 5 24398 20210411020905 45.10.218.10 1 1 3340 20210412180629 151.229.43.26 44 454 100267365 20210428213906 86.143.207.93 1 1 3541 20210427121647 110.93.150.173 1 1 4728 20210427113236 94.2.111.4 1 18 4920434 20210403122857 107.189.10.42 1 1 12126 20210414091359 82.132.216.250 1 21 5031328 20210424063501 151.224.64.103 2 10 9746226 20210425113806 90.206.193.226 1 18 4920076 20210429183334 90.217.241.53 36 192 73212965 20210430203430 3.239.33.209 1 5 24930 20210427175502 31.50.210.132 1 18 4920566 20210405155254 185.31.154.21 3 33 14988963 20210428190456 196.17.115.83 1 1 9523 20210429070052 86.133.7.107 2 8 142172 20210427172321 90.199.179.137 3 20 4927446 20210412132819 88.99.148.108 2 2 3201 20210411103627 80.73.9.238 2 2 12203 20210427003735 173.254.222.170 1 1 12126 20210417010417 88.99.195.200 1 1 11332 20210424212524 104.36.167.69 2 2 6772 20210410103755 109.155.112.11 1 2 95647 20210411084231 85.114.96.154 2 2 12203 20210406212500 81.132.26.96 1 18 4920740 20210422152409 213.107.64.240 2 3 85532 20210411182354 54.86.66.252 0 1 244872 176.10.99.200 3 3 25527 20210430141352 109.152.137.18 1 1 3336 20210405084737 86.40.14.10 1 18 4922443 20210401211800 94.12.208.253 2 8 7147 20210405141658 90.203.237.216 2 2 7166 20210415161043 109.70.100.33 4 4 24406 20210406233904 185.220.103.7 3 3 24329 20210410155328 109.156.141.203 6 26 5039750 20210413192041 92.40.190.240 2 4 4850694 20210424161614 46.166.187.171 2 2 12203 20210426050037 35.170.76.102 4 4 38052 20210404221324 109.249.185.118 3 13 127411 20210421222054 135.181.208.169 1 1 12105 20210405141431 82.12.121.103 2 27 4965196 20210425083635 51.19.169.23 3 4 13498 20210407141534 176.10.104.240 3 3 24329 20210418010254 90.195.233.235 55 124 170458688 20210423155151 2.25.42.3 2 2 8564 20210413201540 109.156.104.91 1 18 4920115 20210405125702 35.205.17.176 3 10 3340 20210412175331 78.145.230.230 1 8 4862290 20210403122752 135.181.141.13 1 1 12879 20210422134644 46.64.134.43 4 9 4869241 20210403134141 92.45.19.7 1 1 12126 20210427061933 36.67.101.162 2 2 12203 20210416084618 168.119.253.69 94 94 443167 20210401221848 5.187.53.52 1 1 12126 20210417235800 86.165.103.236 1 1 3373 20210407164654 81.1.209.77 2 2 12203 20210426071028 85.255.237.0 1 20 5036803 20210410222744 47.26.201.203 0 1 169933 49.12.67.51 151 154 918261 20210402000459 80.95.45.200 1 1 13216 20210412214638 148.251.54.157 4 4 25208 20210424052155 198.46.235.47 3 3 6513 20210427203121 125.209.235.183 0 1 10777 109.150.238.28 2 2 8213 20210427092048 2.57.122.21 3 3 9958 20210408122214 80.194.234.191 1 3 56630 20210425183029 147.92.153.2 0 2 1575 78.86.153.122 2 2 7082 20210428185910 51.19.172.92 1 17 4903876 20210405153037 85.211.41.1 2 25 5087927 20210424214812 211.231.106.24 0 1 11360 90.203.236.153 1 17 4886199 20210405203306 51.146.247.52 1 18 4920084 20210407082828 135.181.29.236 169 172 894625 20210401221357 85.255.232.214 1 18 4929250 20210424225050 161.51.11.2 9 30 5059994 20210422212940 59.59.66.12 2 2 12203 20210401034154 109.70.100.38 1 1 12126 20210417073540 81.102.42.156 1 20 4973448 20210426125328 85.255.234.78 1 18 4920493 20210404175547 34.210.249.60 1 1 39422 20210410105607 77.99.22.9 1 18 4920273 20210412180143 213.205.194.241 1 18 4920123 20210429174746 114.111.32.203 1 1 3400 20210419204129 103.138.147.102 2 2 12203 20210427022202 175.110.10.144 2 2 12203 20210402024942 82.15.42.13 2 19 4924304 20210422190920 35.227.24.99 3 64 14983517 20210416143056 117.50.101.170 6 6 21753 20210416193038 92.40.173.166 1 9 57863 20210403125416 86.156.95.59 6 17 146242 20210421073631 178.250.73.49 8 8 34002 20210425132721 103.138.108.26 1 1 3318 20210407115710 84.9.80.2 3 24 5040338 20210414000057 86.142.237.198 1 19 4904069 20210403140442 35.230.65.220 0 1 244872 213.123.220.5 1 18 4920509 20210407125351 95.217.134.156 1 1 12009 20210409160105 217.182.175.162 16 16 0 20210429174814 79.173.132.106 1 18 4921338 20210423114746 94.11.19.241 1 18 4921799 20210413191940 92.40.190.24 3 5 4934578 20210421091143 109.155.112.230 1 1 3549 20210430154347 188.221.85.80 1 1 3920 20210422143011 78.17.14.126 1 1 3602 20210418170401 217.35.61.209 2 7 4891598 20210409171350 90.252.172.129 1 20 4973453 20210425103323 109.155.112.7 1 1 3654 20210418112128 177.53.8.243 2 2 12203 20210404092645 171.4.240.216 1 1 45765 20210404151222 109.249.185.52 1 14 3397 20210412180300 212.102.38.147 3 3 24329 20210412140308 109.151.206.65 1 18 4922727 20210414145948 80.169.44.1 1 18 4922157 20210428103744 195.92.38.22 12 118 25119434 20210426115907 90.204.5.106 1 18 4922605 20210420204540 23.229.35.225 1 1 10627 20210405161319 195.154.171.54 3 3 24323 20210406132033 109.157.231.125 1 18 4922142 20210427234605 86.130.161.207 38 67 5548922 20210430175711 85.255.233.166 1 6 139178 20210410221445 91.90.121.148 1 18 4920493 20210418175948 185.69.144.33 9 27 4975258 20210413151338 109.249.185.104 1 1 3373 20210408134421 101.109.253.16 2 2 12203 20210401052712 52.201.80.46 1 1 2955 20210427225849 54.209.60.63 1 1 9689 20210419030718 109.150.98.54 1 1 3615 20210420231912 67.198.228.208 2 2 12203 20210423114700 81.141.167.13 1 1 3347 20210403100156 195.206.105.217 1 1 12126 20210420030100 168.91.9.69 0 3 1790 77.100.36.59 2 19 4923936 20210405142814 54.193.28.187 1 8 47359 20210430142226 109.146.142.255 5 24 4935867 20210403121442 82.25.249.227 148 268 441028757 20210430131324 86.182.34.89 3 3 12053 20210401084720 165.225.81.119 1 18 4923490 20210406193107 82.9.112.108 15 43 5060876 20210427225630 107.172.255.33 0 1 921 165.225.81.99 6 64 15546066 20210408110825 183.89.4.231 2 2 12203 20210409151017 35.223.197.125 3 3 10749 20210413175322 92.40.176.87 0 8 73799 69.171.249.23 0 1 4831838 176.253.151.71 1 18 4920614 20210422181608 80.41.241.63 7 9 138439 20210424094551 66.249.93.41 8 8 30826 20210422215645 78.33.21.74 0 4 111035 185.38.142.126 1 1 3318 20210408222249 178.101.83.137 1 20 4920717 20210407104707 34.247.213.8 1 1 3495 20210430200644 92.40.190.232 2 4 4931436 20210424073731 77.99.180.49 90 122 705428 20210429071337 81.159.114.64 1 5 18663 20210403133149 80.6.233.24 3 23 4981611 20210407081538 86.128.233.230 3 5 4843044 20210419105554 94.4.189.221 1 18 4920498 20210405145858 147.92.153.20 0 1 568 45.125.65.45 3 3 24329 20210430065412 49.234.29.195 0 2 1489 192.99.44.57 9 9 49553 20210424212517 68.183.90.223 4 4 39732 20210418002656 35.82.29.5 1 1 3456 20210423012107 86.167.1.162 1 1 3487 20210427192832 54.82.255.104 1 1 13264 20210419163535 44.242.156.89 1 1 10508 20210416190207 119.187.146.163 2 2 12203 20210418082901 65.21.62.31 19 24 706788 20210401155551 77.97.66.237 1 18 4920759 20210405135516 92.28.163.45 3 37 9905625 20210430231231 92.40.174.73 1 18 4920493 20210403122136 185.65.25.114 1 1 3538 20210409165414 94.15.86.242 1 20 5036805 20210410233038 51.52.47.131 3 29 5085079 20210427135705 94.14.35.10 2 20 4942186 20210422220944 185.244.214.115 2 2 26279 20210411064045 51.81.139.96 1 1 12126 20210413024450 85.255.236.44 1 18 4920403 20210402181815 213.205.194.245 1 24 5076690 20210427184644 90.221.208.88 1 23 5060083 20210429122911 95.148.75.71 1 18 4920414 20210409191312 151.231.162.152 1 18 4921001 20210402212145 82.132.226.8 2 11 5056206 20210425160525 85.208.98.21 1 1 3456 20210423041857 92.40.174.14 1 22 5031454 20210422082120 5.248.165.86 6 6 48658 20210403035947 2.220.254.126 2 40 9957687 20210418093659 82.118.117.183 2 19 4923838 20210409161336 109.156.215.64 2 21 4884401 20210429223905 81.109.73.178 13 34 5082041 20210422191945 192.111.139.165 4 4 24406 20210403173801 82.132.222.156 1 17 4906883 20210403134546 94.8.95.177 46 76 5465017 20210429210216 84.65.71.254 1 18 4920414 20210409161154 61.155.83.22 1 1 12126 20210429193030 192.71.3.26 1 1 3543 20210421213648 176.253.53.74 3 23 9877943 20210411052228 152.37.93.202 1 20 4973509 20210424214122 92.40.176.114 1 1 4259 20210428181414 84.71.114.60 15 36 5090244 20210412082035 165.225.81.42 4 23 4930930 20210407130858 80.194.234.241 4 23 4931351 20210403122130 46.8.110.4 2 2 12203 20210418011620 94.202.108.29 1 1 13166 20210422174517 35.230.56.66 1 1 13252 20210414021710 104.129.18.167 4 4 39792 20210419054922 86.137.201.26 1 18 4920562 20210410080317 52.210.69.180 1 1 0 20210425132005 86.150.169.251 1 1 3513 20210423084036 92.10.15.58 3 50 14989063 20210428134549 168.91.13.185 0 1 20214 185.220.101.199 2 2 12198 20210430015350 90.209.142.132 1 11 51084 20210405164035 213.205.194.35 3 18 4927348 20210422141829 86.147.182.166 1 18 4922142 20210404173311 81.133.85.220 2 2 6790 20210407101415 177.152.187.218 2 2 12203 20210405175357 190.2.133.224 4 4 34775 20210408130319 116.203.62.37 129 129 2061165 20210412121133 185.220.102.252 1 1 12126 20210406045711 92.40.174.6 1 16 159251 20210423105031 185.220.102.254 3 3 24329 20210417211755 46.65.105.220 4 4 13112 20210404084024 86.164.148.253 1 21 5054215 20210425173725 90.210.42.145 1 20 4973446 20210424222156 213.205.197.221 1 1 3530 20210405145447 185.69.144.105 3 10 4870745 20210422134507 104.144.229.201 0 2 12830 82.132.220.238 1 1 11334 20210425172640 147.161.167.34 1 24 5076636 20210428140512 31.54.68.208 3 41 9954946 20210410181721 213.120.33.161 3 15 70764 20210403160555 213.205.194.93 1 18 4920403 20210403115128 90.192.41.102 1 1 3632 20210416213003 34.86.135.134 2 2 6556 20210404200237 109.146.199.146 1 1 3627 20210416134523 137.59.161.161 1 1 12126 20210427172717 80.229.160.16 1 1 5993 20210405094234 92.40.190.86 2 3 4839229 20210422191307 77.96.63.131 1 18 4920566 20210406103715 5.71.251.118 1 18 4922498 20210406150929 46.65.219.166 1 18 5072679 20210425123534 209.58.165.79 10 10 28716 20210421105204 81.141.167.22 1 4 7011 20210426191242 82.132.240.193 1 18 4920749 20210424141659 185.244.214.41 2 2 26279 20210409032052 23.129.64.203 3 3 24329 20210420223809 81.151.68.113 1 1 3378 20210401120955 109.154.49.100 2 40 9947012 20210425200504 120.21.194.71 2 6 39424 20210416101430 82.102.25.155 4 4 39273 20210411124655 81.135.226.149 1 18 4921648 20210410114931 213.205.240.228 4 41 14680665 20210410103447 92.2.170.70 1 18 4921498 20210417142612 46.33.33.20 6 6 50278 20210424105812 109.155.112.255 2 2 7088 20210411105039 31.51.49.62 8 10 9701073 20210429144508 90.29.103.129 1 1 3318 20210407134939 5.58.47.25 4 4 24400 20210426070224 86.170.42.130 2 23 5035330 20210419083329 82.132.232.80 1 1 3920 20210422134646 81.178.132.75 7 7 28043 20210415143650 90.192.56.65 1 1 3487 20210428161305 90.218.65.142 3 10 14567493 20210410234715 125.87.89.231 2 2 12203 20210417164835 77.96.63.237 1 18 4920434 20210403164317 109.249.184.231 1 20 4973506 20210428130809 209.127.17.234 1 1 77 20210404230337 86.162.173.231 3 39 9898100 20210425100838 35.166.187.108 1 1 3456 20210422212731 86.140.170.134 2 4 117605 20210410225523 49.234.54.180 0 8 4870278 185.192.70.195 1 18 4920509 20210405210845 76.173.13.173 1 1 4597 20210428183255 85.255.232.247 3 3 39858 20210412131244 217.137.43.239 6 29 5103436 20210425193018 34.75.102.195 0 1 244872 82.30.226.0 1 20 4973506 20210425215714 109.152.137.239 1 1 3513 20210423230247 82.45.1.162 24 60 5092569 20210425092953 77.101.168.206 10 75 15099444 20210427162024 31.54.8.62 1 20 5210311 20210420172005 82.26.206.191 2 19 176557 20210426142512 86.137.167.220 1 18 4922605 20210420193058 109.146.199.155 1 1 3660 20210420084156 90.221.36.233 3 28 9778469 20210423060010 78.153.199.234 1 18 4922194 20210430102048 46.69.165.137 1 18 4920133 20210429195236 27.153.201.224 2 2 12203 20210403090040 125.209.235.177 1 1 3440 20210424213345 213.205.240.60 1 1 3617 20210403122120 31.124.225.65 8 27 4948721 20210406013714 90.215.185.116 1 1 3530 20210405163332 158.176.123.229 15 76 15064573 20210427194447 79.78.89.31 4 4 13961 20210401083646 143.159.253.142 1 1 3378 20210401093236 217.179.38.58 2 23 5035271 20210421114756 85.255.236.219 1 2 12217 20210402184335 79.71.167.202 3 24 5040338 20210413212021 82.132.224.220 2 14 4910724 20210413002659 86.184.27.56 1 1 3487 20210429084812 81.136.40.211 1 1 3538 20210409212956 82.165.185.18 1 1 3597 20210418013100 176.9.77.78 4 4 6815 20210412175512 92.40.191.115 1 1 3583 20210415193535 52.56.62.200 9 26 150295 20210422122248 86.186.198.27 9 61 14732764 20210406190735 86.24.24.155 1 19 4998905 20210411153828 104.238.97.215 4 4 24406 20210415085751 86.164.6.95 1 14 3527 20210402235048 109.156.131.170 2 19 4923826 20210405175810 51.146.247.26 4 31 5014936 20210402202452 90.222.51.174 1 20 4973506 20210426090219 34.212.150.25 1 1 12803 20210408124839 109.152.97.253 1 1 3632 20210417163904 94.11.17.38 12 33 48854346 20210430184416 34.86.35.28 1 1 13221 20210413045129 86.138.225.224 1 18 4920406 20210405141558 185.122.192.229 3 10 63973 20210409224236 185.102.113.154 1 1 3462 20210425044105 176.255.60.72 2 36 9845454 20210421115503 92.40.203.190 1 20 4973453 20210425072749 213.248.241.183 6 6 21317 20210429143646 2.97.167.100 2 40 9841256 20210404180544 77.247.181.163 1 1 12126 20210409041138 62.28.77.163 2 2 12203 20210418180055 80.79.222.89 1 18 4920349 20210428121743 86.182.34.33 1 1 3641 20210413231215 125.209.235.175 0 4 21108 86.144.51.140 1 17 4903798 20210405142045 86.129.45.4 1 18 4920357 20210409173215 86.158.247.246 36 451 100433539 20210421222402 86.26.10.214 0 1 244872 130.226.142.188 1 1 0 20210404011438 31.40.208.111 2 2 21895 20210429081929 194.33.192.46 2 19 4900184 20210409110222 82.166.195.64 66 66 558205 20210429224119 82.16.94.226 6 43 9859589 20210426140012 196.240.143.104 1 1 8039 20210419081428 86.167.1.198 8 27 4950982 20210402191736 79.78.66.43 5 41 9818686 20210406091009 176.251.67.96 1 14 79818 20210403121058 86.183.36.56 1 20 4973509 20210424213351 185.69.144.122 1 18 4929080 20210409160140 31.76.121.57 1 20 5036744 20210410220356 31.50.143.108 2 23 5035439 20210418082443 90.221.208.238 10 14 9811415 20210411091508 109.158.64.152 1 18 4920607 20210410011505 86.186.49.197 2 16 4901291 20210403134652 86.8.203.6 1 1 3617 20210403125314 86.128.190.153 1 2 4835319 20210409161156 37.57.37.213 2 2 12203 20210425130843 84.51.56.69 1 1 12126 20210429162603 90.254.27.18 26 58 39107306 20210426233331 86.158.174.62 1 18 4920493 20210403123126 90.194.233.91 8 8 27007 20210405234405 86.132.188.170 1 20 5036805 20210410235704 190.145.154.218 4 4 35182 20210417112520 94.5.148.72 2 17 9824094 20210412193712 3.87.216.214 1 1 12803 20210407100808 176.253.52.229 1 18 4920761 20210402210457 51.161.119.229 51 938 226944434 20210430183505 90.200.242.97 177 299 441119657 20210430191641 2.26.51.71 4 26 19511222 20210411011339 178.159.37.41 7 7 48729 20210424175906 188.163.46.213 2 2 12203 20210417150146 90.192.13.190 5 8 14512686 20210430185752 5.81.115.164 1 2 4835498 20210418192321 184.178.172.13 2 2 12203 20210414194931 94.193.167.141 1 11 4853128 20210408081002 47.199.83.113 82 103 571115 20210430221134 45.15.143.183 12 12 119496 20210430210505 203.133.180.144 0 2 168937 157.182.247.21 0 1 120377 90.213.166.110 13 42 39146195 20210417222407 94.192.223.42 2 36 9844253 20210415214029 213.205.240.233 1 1 3336 20210403122751 115.186.76.93 1 1 77 20210410161629 124.41.240.203 1 1 12126 20210426150223 92.239.69.142 12 33 14697442 20210425065847 88.108.207.238 2 36 9841152 20210428165828 147.161.167.6 2 23 5035025 20210420160808 86.167.66.22 6 21 102283 20210405203144 134.35.94.161 2 2 12203 20210411010943 90.215.255.149 8 45 5226311 20210425074335 216.211.249.149 0 1 120377 120.21.228.111 1 1 3373 20210407123830 1.4.214.148 1 1 12126 20210416083435 86.165.103.140 1 1 3336 20210403231653 86.157.106.187 1 13 3602 20210419185422 86.170.164.126 1 18 4920990 20210417151431 90.200.98.125 1 18 4922069 20210428032627 176.48.9.251 4 4 24406 20210426002217 86.157.106.131 1 1 3543 20210421192840 103.86.161.246 1 1 12126 20210408032352 147.92.153.9 0 1 654 213.205.194.116 2 19 4933135 20210426142704 77.99.8.203 1 17 35254 20210422211747 185.69.144.162 3 23 5051896 20210424230320 90.197.169.203 37 43 294302 20210428232049 182.253.108.82 4 4 24406 20210420061312 86.136.143.212 1 18 4920170 20210405125621 194.33.192.47 9 28 5109829 20210426140012 85.255.232.234 1 4 13699 20210409164130 92.40.174.56 1 11 5045876 20210428203439 78.86.134.89 1 1 3600 20210421190313 147.92.153.5 0 1 1286 85.255.235.220 2 2 26848 20210424023215 82.132.220.72 6 36 5025905 20210412214957 90.217.244.0 8 32 14523059 20210403134606 142.44.215.6 2 2 6432 20210416091344 31.48.254.111 1 1 3541 20210429133136 148.252.132.124 4 25 5042793 20210423080932 178.239.160.203 4 4 13972 20210430171315 92.29.144.50 1 20 4973511 20210425090632 87.118.110.27 7 7 48735 20210419211419 82.165.104.24 2 2 7030 20210429095247 86.167.150.183 6 27 5049421 20210420172940 109.155.115.75 1 1 3428 20210409130326 88.97.96.67 1 18 4922142 20210407182631 89.250.149.114 2 2 12203 20210408201930 81.147.94.12 1 22 5031454 20210421124333 82.29.100.69 7 25 5043888 20210424213404 148.252.132.175 1 6 4896655 20210402184954 176.252.203.69 2 36 9949028 20210429194420 143.198.128.10 6 6 53256 20210428204359 78.86.6.80 1 18 4920404 20210425083720 125.126.114.145 2 2 12203 20210415192928 184.178.172.14 2 2 12203 20210425003757 90.194.233.133 2 2 7452 20210416171632 192.99.44.95 2 2 7066 20210424215836 195.154.172.59 2 33 9909411 20210428164951 54.75.96.165 1 1 3583 20210413200625 94.9.145.173 14 65 24499409 20210412192713 84.17.48.234 3 3 25517 20210428155820 147.78.5.70 1 18 4920749 20210422195544 5.70.202.118 2 17 61550 20210424222345 82.132.237.26 1 20 4973506 20210428090408 82.132.224.73 1 1 3726 20210425124416 109.155.151.110 2 19 4926420 20210410144320 168.161.200.12 5 27 5142001 20210412172213 109.152.137.57 1 1 3660 20210419163057 109.155.112.216 1 1 3336 20210403183955 92.40.175.15 1 7 60324 20210424215837 62.182.80.59 0 1 22277 78.86.132.235 1 2 23603 20210406160411 82.14.112.149 1 17 87781 20210412180630 82.132.227.102 1 1 3604 20210424114344 92.40.175.1 1 7 4873140 20210424213808 157.90.240.65 133 139 797859 20210401220055 194.33.192.3 4 4 13727 20210409155202 77.101.146.207 3 19 10536 20210405213703 78.149.68.171 1 10 4861778 20210402091010 109.201.133.100 1 1 12126 20210421155242 213.123.3.61 2 21 4924641 20210401133913 88.107.91.133 7 25 109863 20210429191600 62.4.16.40 2 2 7150 20210417052213 107.173.184.74 0 1 1286 179.107.57.93 2 2 12203 20210401083426 82.132.225.33 1 18 4921648 20210410123521 2.31.85.90 1 18 4922096 20210424235457 84.67.6.173 1 20 4973503 20210424232011 86.168.58.123 5 8 206578 20210412153908 92.40.190.81 2 2 8358 20210422192421 85.211.50.24 1 18 4921899 20210408074546 195.140.215.172 4 4 21795 20210429102216 92.40.174.207 1 5 4981397 20210428080943 86.165.66.77 7 26 4992857 20210407111359 86.143.207.51 2 2 6977 20210416231205 80.6.58.226 1 17 4905347 20210414172456 92.40.171.151 1 8 4892332 20210420170939 179.107.62.90 2 2 12203 20210416232113 86.151.233.122 1 13 4917531 20210406052448 213.205.194.94 5 24 180222 20210428152846 86.170.222.158 14 102 20260047 20210427180004 192.252.214.20 2 2 25174 20210424180303 135.181.196.233 137 138 893791 20210401235705 111.7.96.162 2 2 3332 20210405204610 84.92.106.167 1 1 3460 20210410165359 159.192.198.103 2 2 12203 20210403124345 175.44.42.130 1 2 10044 20210413075016 194.80.130.124 2 36 9841016 20210412201431 213.205.240.12 1 1 3690 20210406100132 82.132.232.62 1 18 4920557 20210405150029 34.227.24.183 1 1 3680 20210422182317 86.142.228.222 2 3 8791 20210406171631 41.71.9.103 2 2 12203 20210413190055 42.236.10.82 1 5 37056 20210411015509 94.130.73.225 87 95 616318 20210402015401 109.155.112.236 1 10 66769 20210426100153 90.210.1.61 8 27 248487 20210412160639 176.35.22.225 10 10 41992 20210430083119 139.180.224.59 0 1 921 81.108.160.222 49 153 20309202 20210430120822 92.60.190.249 4 4 24406 20210406223411 80.43.233.193 2 38 9894168 20210424221910 77.98.192.250 6 32 5003692 20210412182409 85.255.235.151 1 18 4920975 20210416184027 124.206.180.139 1 1 12803 20210408051041 42.62.207.248 2 19 4926184 20210425095542 213.205.240.70 1 18 4920572 20210422112458 114.111.32.166 1 1 3602 20210419172902 86.27.70.68 1 20 5036805 20210411085147 93.115.193.148 1 18 4921190 20210430095637 163.116.162.120 6 27 5051237 20210416091238 82.37.26.40 1 18 4921799 20210413102040 135.181.97.210 167 171 819479 20210401223150 162.253.129.180 1 1 12126 20210422064753 195.201.245.31 2 2 9301 20210410220337 81.159.211.94 1 1 3543 20210421180404 2.221.196.250 3 41 9958240 20210426072356 109.155.79.0 1 18 4920441 20210403121445 92.40.171.68 2 4 53490 20210429114131 212.129.62.32 5 35 10025223 20210430074350 82.132.225.38 9 9 38969 20210403130224 92.40.175.108 1 17 4904196 20210423074741 82.14.153.152 1 20 4992457 20210412173140 107.172.232.135 0 1 13806 8.211.3.197 2 2 12203 20210401202457 54.194.245.189 1 1 3543 20210421200820 109.249.187.105 1 1 3600 20210422084204 79.78.94.151 3 47 10123382 20210430074907 213.205.240.20 1 18 4920566 20210405223052 109.156.103.249 1 18 4921799 20210412192557 176.254.9.94 1 18 4924786 20210419202620 109.154.178.98 1 14 4855533 20210409170942 195.2.80.73 2 2 25964 20210410041040 51.6.73.177 1 8 4910273 20210405141904 35.237.248.37 1 22 5031454 20210422093539 217.42.153.214 1 7 129662 20210411075718 173.252.127.38 0 2 1940 1.20.191.170 2 2 12203 20210402131947 168.119.102.167 55 55 249753 20210401224444 80.94.192.239 1 20 4973448 20210426123759 84.21.130.217 3 11 9846309 20210420152118 45.84.177.62 2 2 12203 20210401194231 79.79.216.1 6 45 10221181 20210428175310 86.155.69.182 35 146 30025401 20210430093508 188.247.39.14 2 2 12203 20210403124428 188.39.62.98 4 41 334846 20210426153510 213.205.197.143 1 18 4920659 20210424215706 199.244.88.132 5 5 0 20210429225640 42.236.10.77 1 3 26924 20210430142641 213.205.200.105 1 18 4920403 20210407173009 162.244.146.182 0 1 654 31.54.189.253 2 27 9786170 20210409160536 82.132.225.172 4 22 4988597 20210425204330 77.103.202.107 2 34 9841048 20210412185739 176.25.102.123 1 18 4920493 20210404161357 2.96.163.236 12 135 34638196 20210412151801 63.141.246.66 2 2 12197 20210427170905 31.134.125.80 2 2 12197 20210407071907 95.144.92.72 9 22 4901766 20210404071629 13.66.221.165 2 2 37958 20210428190703 157.90.175.71 41 45 640794 20210404215719 176.26.168.66 1 1 3381 20210424144354 45.235.99.82 1 1 12126 20210429161338 188.138.192.154 2 2 5910 20210402133346 109.155.112.95 1 1 3660 20210419083626 188.222.47.149 5 25 5065330 20210413223355 82.21.163.113 1 20 4942986 20210411080915 86.180.120.164 1 20 5036746 20210411071711 90.205.190.230 1 10 202339 20210426225336 213.205.240.78 1 1 11392 20210425143645 89.46.62.18 2 2 6530 20210417151544 180.163.220.60 1 2 23727 20210423134349 188.166.249.33 1 1 3575 20210417121851 85.255.235.180 4 12 9910680 20210411112309 186.42.175.138 2 2 12203 20210429101235 82.132.225.110 3 7 33985 20210406221026 217.44.255.179 1 2 4835319 20210409171016 144.76.102.243 89 89 1748193 20210430144624 92.40.186.205 1 1 5320 20210414081144 220.64.106.7 1 1 3513 20210430051531 203.133.180.32 0 2 250760 148.252.133.193 4 23 5046257 20210411150826 91.122.167.107 4 4 36455 20210413191408 72.212.63.101 4 4 24406 20210419060223 51.6.73.245 1 24 5354033 20210424224346 36.94.40.99 19 19 73422 20210404092346 2.123.72.173 19 35 5080629 20210414163001 92.40.169.149 6 25 4940276 20210401124743 109.152.191.5 1 1 3641 20210414180006 125.209.235.169 0 1 283 197.210.120.77 2 2 12203 20210420221445 86.142.47.111 1 14 4650 20210409192451 86.146.183.177 2 23 5035243 20210422194029 90.195.100.92 2 2 6836 20210403194544 82.25.63.111 49 240 54941548 20210430152924 80.5.78.171 1 20 4973511 20210425000553 65.21.61.217 134 139 900328 20210401213958 92.40.190.97 1 3 4927480 20210422184342 79.78.79.187 5 91 20198018 20210424175117 108.51.139.109 0 1 120377 185.220.100.254 8 8 60861 20210421155231 92.40.191.37 1 2 4835381 20210422083221 157.90.175.89 93 94 424552 20210402022214 171.244.1.84 12 12 97316 20210424004924 69.171.251.4 0 1 244872 109.122.80.234 1 1 12126 20210427122112 109.159.51.74 2 15 7460 20210422220750 34.244.3.134 1 1 4040 20210411104313 213.168.210.76 2 2 12203 20210429145658 54.151.184.195 4 4 38052 20210404152935 81.153.144.252 1 19 4956895 20210427212515 82.41.234.170 1 18 4920400 20210411091810 217.42.56.128 1 18 4921526 20210409224654 184.178.172.25 7 7 58427 20210422031958 2.216.121.33 1 8 61403 20210403104238 121.4.163.148 1 3 21326 20210404120546 149.202.238.204 3 3 24329 20210429171310 65.21.60.208 74 77 671522 20210401220344 90.195.102.15 2 37 9999951 20210409205156 121.5.103.58 0 2 7763 82.132.217.149 2 5 52562 20210427091249 51.7.98.243 10 53 24623011 20210430180652 5.188.62.76 1 1 3318 20210407021702 135.181.29.204 37 41 289551 20210401200225 94.130.182.244 58 59 289022 20210401190315 103.141.158.157 2 2 12203 20210409214115 135.181.31.125 1 1 12225 20210403121056 79.64.255.251 1 18 4920357 20210409160932 79.78.86.103 2 42 10029882 20210415170032 54.243.53.148 3 3 9397 20210427230019 117.24.171.251 2 2 12203 20210405153555 35.238.26.35 1 22 5031481 20210416111914 85.109.127.48 2 2 12203 20210401225212 88.99.195.235 1 1 3864 20210422134715 1.20.169.14 2 2 12203 20210401125456 109.200.161.235 2 2 12203 20210421111404 135.181.90.67 91 97 471540 20210402003249 223.199.25.60 2 2 12203 20210430015506 86.186.238.115 1 18 4920749 20210423125436 117.28.133.211 2 2 12203 20210421095133 66.249.93.209 2 7 70011 20210422142553 86.137.29.184 2 2 6746 20210408132921 218.253.5.7 2 2 12203 20210401040758 82.38.239.217 6 50 19712591 20210425161138 157.90.231.139 1 1 3318 20210408210354 86.171.192.160 11 61 9927205 20210401215717 109.155.115.14 1 1 3615 20210420155812 78.86.156.143 1 2 23874 20210419183859 94.6.54.207 1 1 3538 20210409170525 90.206.247.122 3 26 5083618 20210430153138 92.40.190.236 3 3 10634 20210424225428 79.79.165.203 1 17 4893518 20210403142124 117.131.28.25 0 1 185 114.111.32.162 1 1 9271 20210405213250 211.249.46.122 1 1 3543 20210421175745 192.111.135.21 2 2 12203 20210401224135 82.132.238.16 1 16 4911948 20210409160506 144.217.255.152 2 2 15880 20210424213019 87.81.82.32 1 18 4920498 20210403121241 90.206.242.79 5 7 63101 20210426130454 144.168.213.52 1 1 8039 20210430032841 183.88.1.248 2 2 12203 20210423112142 86.184.87.27 3 21 4930102 20210410220310 81.102.176.168 1 18 4920351 20210405141633 72.206.181.103 3 3 24323 20210427162431 41.141.251.30 1 1 12126 20210430185020 52.56.62.197 4 4 14315 20210417225703 85.255.234.162 1 2 4835702 20210422134741 5.141.86.233 1 1 12126 20210427154940 59.63.111.134 2 2 12203 20210425001042 81.129.192.77 8 69 15171234 20210414084033 177.101.125.251 2 2 12203 20210415093035 213.205.194.197 1 1 3373 20210407203345 86.133.2.23 5 8 4885976 20210406202433 81.158.56.137 18 33 14704273 20210430192754 216.213.29.143 0 2 14460 84.65.99.155 1 1 12719 20210402212010 150.143.183.242 14 16 167738 20210411214705 51.19.172.76 1 14 3690 20210406072853 109.155.112.131 1 3 6310 20210426123717 86.129.229.56 1 1 3597 20210418095309 95.151.84.145 1 18 4920542 20210406152349 209.250.250.157 2 2 12203 20210406155249 86.183.11.155 1 18 4921799 20210413075503 82.25.55.112 1 18 4920559 20210405150355 42.192.184.76 1 3 28189 20210405055532 2.27.127.23 51 68 234838 20210430082718 109.156.11.234 1 8 156813 20210412152237 195.175.42.18 1 1 12126 20210411173733 23.228.109.147 1 1 3583 20210414102117 163.156.209.144 7 28 5066657 20210420125407 31.13.115.116 0 9 133102 5.133.11.119 2 2 26279 20210425090223 109.148.133.152 1 1 3617 20210403123428 160.238.227.153 1 1 12126 20210414094522 86.155.113.154 1 1 3530 20210405150032 18.208.195.79 1 5 24398 20210405163059 213.205.194.178 1 18 4921799 20210412203537 34.234.172.14 1 5 24398 20210412100101 84.45.127.113 42 394 94430571 20210429100426 79.66.48.74 1 16 4891789 20210423235532 2.25.42.104 2 2 7144 20210404164429 178.239.168.238 24 43 4998406 20210409100246 180.163.220.46 1 5 43462 20210423134349 86.177.208.242 1 18 4920786 20210406214629 114.111.32.31 0 1 33787 148.251.50.77 54 54 1080265 20210430140653 72.217.216.239 6 6 36609 20210423031808 69.61.200.104 2 2 12203 20210420124635 65.21.50.220 141 143 984334 20210402015359 3.8.17.232 1 18 4920566 20210405181924 82.36.139.135 1 1 3527 20210402204939 54.167.255.218 1 1 12854 20210401134122 103.224.103.116 4 4 24406 20210414105325 2.96.171.206 2 23 5036872 20210415101223 78.32.132.249 1 18 4922251 20210402214846 109.155.112.223 1 1 3615 20210420121124 109.152.97.205 1 1 3462 20210409210118 88.99.195.212 1 1 3467 20210402180605 116.226.103.220 3 3 37516 20210418122603 86.184.132.29 2 23 5236231 20210425190516 85.203.46.67 5 58 15084157 20210428183836 31.54.81.216 1 20 4973448 20210425133721 82.3.44.139 1 1 3524 20210402180635 66.249.93.33 6 6 52568 20210430012755 90.192.42.231 2 6 228287 20210416104310 81.150.9.67 1 1 9362 20210414150852 139.59.102.4 1 1 3495 20210429213225 217.158.203.67 8 59 10331798 20210421152706 110.93.150.46 0 1 25919 90.255.44.126 1 18 4923583 20210424112432 2.96.166.226 5 68 15102181 20210422013840 211.249.46.86 0 1 13806 72.221.232.155 2 2 12203 20210403095125 90.216.207.181 11 54 514492 20210430090948 86.157.106.245 3 3 11021 20210418145824 193.117.234.138 1 18 4920740 20210422143033 85.255.234.204 1 2 12300 20210405144906 195.27.18.67 1 18 4920749 20210423102734 88.99.195.217 2 2 7161 20210422181306 211.231.106.23 0 1 62287 85.203.46.13 1 18 5010070 20210418181803 86.158.156.142 1 19 4956900 20210425125152 90.214.133.88 1 18 4920406 20210405152539 109.155.112.69 2 2 6680 20210405125351 177.22.111.246 1 1 12126 20210430172504 186.0.239.140 2 2 12197 20210428232848 109.249.185.19 1 18 4920743 20210419220006 3.92.42.60 45 65 412026 20210406004407 92.40.180.167 1 1 3549 20210430081434 80.43.237.182 1 14 3930 20210422220119 52.156.127.202 0 1 66769 86.150.169.210 1 1 3551 20210410144056 213.205.240.90 3 8 11088 20210424095617 51.19.177.56 1 18 4920357 20210409160358 86.148.239.151 1 1 3641 20210413192121 90.243.57.213 1 7 25249 20210403130114 91.132.147.168 2 2 12198 20210419181131 80.42.80.134 1 18 4925399 20210416211555 70.166.167.36 2 2 12203 20210424202632 165.225.17.40 1 18 4921743 20210416171353 180.251.81.224 1 1 3572 20210413024130 86.154.151.145 110 117 714337 20210408064203 47.187.103.209 1 1 12786 20210405171246 109.249.185.64 2 21 4977126 20210424215158 5.65.15.211 13 13 45331 20210428210655 132.185.161.125 2 23 5034823 20210423123933 109.249.185.23 6 6 26523 20210413143728 213.205.200.62 1 1 3783 20210425145004 82.129.46.187 2 16 4902333 20210403203655 90.208.59.91 7 38 9923825 20210415070726 86.190.236.179 2 6 11744 20210403153528 86.165.64.113 8 54 10182480 20210430173930 185.192.70.165 1 21 5183423 20210414164719 185.69.144.228 1 18 4920905 20210418223814 189.57.121.10 1 1 12126 20210420095301 148.252.132.75 1 18 4920357 20210409194417 181.31.151.245 2 2 12203 20210423092322 110.93.150.174 0 1 654 82.132.233.20 1 18 4920806 20210422195500 23.129.64.236 3 3 24329 20210415105001 81.157.118.248 5 23 4937516 20210403151030 78.86.63.228 10 29 9791920 20210428135646 95.147.146.236 13 185 49913843 20210430174354 211.249.46.25 1 1 10091 20210409212147 109.158.94.96 109 132 5470801 20210430183918 128.199.214.87 3 3 24329 20210415213740 81.110.56.24 2 19 4927548 20210422193844 93.114.92.80 1 1 3278 20210403123814 92.40.174.234 1 18 4920493 20210404170445 90.216.16.251 4 27 5094673 20210430132332 34.105.83.189 2 2 0 20210409122812 86.150.252.21 1 20 4973506 20210425210555 213.205.200.113 1 20 5036805 20210412133805 81.91.137.42 1 1 12126 20210430115820 94.1.185.38 2 19 4925390 20210430204704 13.66.139.108 0 1 2151 92.40.176.212 2 2 7251 20210423083756 211.249.46.201 1 1 4157 20210415223929 94.195.19.16 1 15 4864906 20210405141802 147.161.167.25 2 23 5035178 20210423161854 149.12.8.12 1 1 3530 20210430204941 88.99.195.197 1 1 3190 20210429174717 86.31.112.96 2 19 4925462 20210410205010 86.188.23.142 1 16 119927 20210410220822 113.64.140.157 2 2 12203 20210420120303 213.205.198.190 1 1 3541 20210429085215 86.175.5.195 1 18 4920406 20210405142134 129.146.43.53 3 3 26368 20210420215828 110.93.150.163 0 1 4831838 94.4.59.138 1 18 4921639 20210419131826 5.69.222.26 1 18 4920414 20210409161036 90.195.227.90 2 15 7321 20210425140632 110.93.150.27 2 2 6881 20210412162902 213.205.194.24 1 18 4927486 20210426144548 89.35.196.229 1 15 82083 20210414063206 82.21.160.128 4 39 14679683 20210425084310 92.6.250.86 6 40 19725474 20210414181329 86.190.208.224 3 47 10123661 20210429193553 167.86.94.107 3 3 24329 20210426005645 109.156.96.242 2 20 4907677 20210409204843 35.225.43.239 1 1 11338 20210424213011 86.183.194.163 1 22 5031513 20210419165951 182.52.51.101 2 2 12203 20210412015743 90.203.81.152 1 1 3602 20210420095210 176.251.66.59 1 1 3617 20210403204629 135.181.41.20 55 56 473424 20210401213747 92.40.175.206 2 22 5069038 20210425060437 190.210.3.210 2 2 12203 20210430061201 86.151.77.211 22 22 75635 20210409142747 81.104.46.96 1 18 4921799 20210413081645 60.2.44.182 2 2 12203 20210408125742 5.159.108.15 2 2 12196 20210421060704 144.76.22.142 1 1 9341 20210421090849 109.157.37.54 2 20 5019977 20210416201427 42.236.10.69 0 3 15295 141.98.100.88 2 2 12197 20210424145527 151.224.34.162 1 18 4923121 20210405233423 86.156.95.66 1 1 3690 20210405195601 197.221.90.54 2 2 12203 20210419072210 213.205.194.15 1 18 4922142 20210416203036 212.129.152.41 2 11 29019712 20210420100104 2.31.204.132 3 26 5064672 20210430002642 185.220.100.243 3 3 24329 20210404144643 185.169.233.79 3 7 101126 20210425104258 94.11.178.151 1 18 4920509 20210405200023 107.175.230.178 0 1 568 92.18.194.92 4 28 9875199 20210415202317 180.163.220.42 0 3 8622 185.69.144.153 1 9 13252 20210415135150 90.221.37.112 4 28 9868314 20210425220332 23.229.65.222 0 1 1286 165.227.14.151 1 1 12684 20210404174022 165.227.177.113 2 2 12203 20210407193800 47.241.183.10 1 1 3487 20210428015644 185.226.144.52 1 1 3290 20210403065132 86.177.188.153 1 20 4973509 20210424214022 94.7.173.132 1 21 4972916 20210423113400 94.4.132.14 1 18 4920406 20210405171508 23.90.43.89 2 2 7413 20210430190755 94.1.161.36 2 19 4925618 20210429221333 109.147.80.101 5 72 19947045 20210417194816 86.186.198.202 1 1 3495 20210430154118 86.190.228.75 9 107 24980848 20210413081852 90.252.36.29 1 18 4920614 20210422183847 86.8.47.249 2 21 4977004 20210424233038 110.78.186.190 2 2 12197 20210414002425 82.37.25.136 1 18 4920493 20210404071229 31.50.153.140 2 4 60416 20210424221014 198.46.145.40 0 1 654 18.191.52.65 3 3 13734 20210409191716 85.247.6.52 12 66 19944351 20210424180415 84.71.117.50 1 19 5013669 20210424132622 90.221.39.165 24 400 95063520 20210429192845 144.76.162.206 70 70 1359318 20210430003430 86.147.221.225 2 34 9810588 20210409110745 185.69.145.89 2 19 4950493 20210404101011 92.40.175.210 1 1 3495 20210430121529 82.132.226.44 5 26 5046211 20210419102734 45.56.150.189 3 3 35535 20210409173707 90.206.92.163 6 64 10123034 20210425074728 125.163.170.229 2 2 12203 20210409161727 93.174.176.103 1 1 12126 20210413183424 82.3.45.213 1 18 4920740 20210422135002 86.184.226.80 1 1 3538 20210409165621 134.249.199.113 2 2 12203 20210411093051 86.28.237.252 1 20 4973511 20210425102754 157.90.175.31 91 91 440147 20210401213808 90.207.0.203 1 19 4998905 20210411220008 34.228.25.81 1 1 3212 20210411151908 106.54.171.3 0 1 6415 188.221.225.36 4 4 13968 20210405185902 92.40.172.157 1 2 4268 20210403105854 173.44.166.205 2 2 6530 20210417042836 86.140.215.34 1 20 5017483 20210426101342 36.72.90.92 2 2 12203 20210402104614 67.195.161.55 0 1 243068 120.41.248.94 2 2 12203 20210406055646 94.13.228.109 1 10 4880911 20210403131037 89.240.129.125 6 27 5049706 20210421153638 89.139.21.117 2 2 12203 20210418202527 79.71.53.39 1 17 4963801 20210424215920 82.132.236.7 1 16 4908975 20210405144003 86.145.11.38 2 23 5035836 20210416201156 51.77.52.160 2 2 6979 20210419234723 162.210.192.116 1 1 3489 20210427030831 66.249.93.207 1 3 17042 20210421103637 34.216.25.72 1 1 3494 20210410012142 94.16.121.91 3 3 24329 20210407161550 213.205.200.66 4 30 14662813 20210424151512 86.186.250.252 1 18 4921154 20210421204733 86.24.229.94 1 18 4920493 20210403124742 157.90.175.153 100 103 666675 20210402020138 176.103.109.101 2 2 12203 20210415113957 86.190.46.111 1 20 4920726 20210406174204 86.151.13.113 1 18 4921841 20210401213245 82.34.195.164 1 18 4921228 20210411183648 125.27.157.168 2 2 12203 20210401063335 82.23.64.175 3 21 4930487 20210411171104 213.205.240.139 1 20 5028712 20210421092038 125.27.198.165 2 2 12197 20210408094602 119.8.121.188 2 2 12203 20210421125359 54.39.50.78 5 5 22522 20210412175830 82.132.213.226 1 18 4920796 20210422134721 149.56.25.49 4 4 13676 20210412175338 114.111.32.216 0 2 1940 65.21.61.40 153 158 797015 20210401195747 109.145.101.79 1 15 99484 20210401112537 193.113.57.167 4 44 59023 20210429082823 2.97.44.59 1 17 4904109 20210403184050 90.211.224.60 2 2 6757 20210403114449 88.145.180.223 32 207 78847233 20210417155416 86.186.83.181 4 7 39644 20210416213406 183.128.33.106 2 2 12203 20210423155957 213.205.240.100 1 1 3530 20210405142659 66.102.8.212 0 2 128752 165.231.45.247 3 3 6609 20210413131945 114.111.32.130 0 1 18496 79.78.95.41 2 42 10029860 20210413092944 45.61.162.250 2 2 6233 20210404000523 212.129.11.42 1 14 4898900 20210409105357 2.28.163.203 1 18 4920493 20210403123331 69.157.60.177 1 18 4923046 20210420021818 109.155.112.183 2 2 6746 20210407191053 82.114.253.137 1 1 12126 20210419080115 81.68.110.5 0 1 1286 5.149.253.253 2 2 12203 20210411035859 168.205.217.81 2 2 12203 20210410160055 82.132.229.171 2 2 7090 20210429193556 85.255.234.140 3 12 54926 20210414183241 94.13.161.247 1 18 4921124 20210402161035 86.21.198.95 2 19 4924110 20210404080708 80.6.103.61 1 20 4973448 20210425142651 END_VISITOR # Date - Pages - Hits - Bandwidth - Visits BEGIN_DAY 30 20210401 13960 16038 609157537 818 20210402 2293 4460 751609218 441 20210403 810 3977 976189163 460 20210404 1519 3244 572457678 318 20210405 6227 9774 1141134592 542 20210406 4102 6183 693999419 362 20210407 6119 7711 567128970 311 20210408 499 2095 518047825 307 20210409 1644 5019 1071253062 512 20210410 1224 3907 852915925 395 20210411 828 3549 769020358 411 20210412 876 3368 723983032 406 20210413 704 2902 671654244 337 20210414 590 2630 636550660 323 20210415 646 2450 554770005 310 20210416 677 2861 666636834 326 20210417 606 2045 474535033 276 20210418 533 2174 555479711 298 20210419 565 2656 627149376 330 20210420 605 2378 509433113 310 20210421 3378 5451 593535243 344 20210422 1290 4655 1024884704 465 20210423 1252 3630 727606842 354 20210424 2094 5630 966470653 426 20210425 2149 6643 1147464158 462 20210426 688 3349 734750064 374 20210427 891 2735 540233938 335 20210428 1097 3265 621391252 334 20210429 566 2511 550142793 339 20210430 597 3441 762345767 322 END_DAY # Session range - Number of visits BEGIN_SESSION 7 15mn-30mn 207 5mn-15mn 298 0s-30s 8902 1h+ 170 30mn-1h 315 2mn-5mn 416 30s-2mn 1240 END_SESSION # URL - Pages - Bandwidth - Entry - Exit # The 25 first Pages must be first (order not required for others) BEGIN_SIDER 18005 / 8099 30928191 5950 4485 /contact/ 1502 10748177 797 770 /home 788 2780096 444 373 /latest-fixtures 452 2169963 116 236 /news/peckcroy240421 408 4391313 243 284 /news/lukerooney030421 359 1331006 211 269 /news/SCEFL090421 311 1184547 176 205 /isthmian-league 290 1320508 41 69 /news/FAStatement120421 287 1311067 124 183 /news/dealbinf100421 271 2191277 105 180 /news/ramsgate050421 258 928210 154 163 /news/lewes240421 233 906623 98 151 /news/dealtown050421 203 766461 101 146 /news/crayvalley220421 202 835264 130 157 /news/SCEFL130421 188 1030251 11 105 /news/holmesdale020421 187 683406 86 122 /southern-counties-east-football-league 186 978399 9 28 /contact 183 783407 49 84 /news/VCDAthletic170421 159 636464 4 82 /news/craywanderers100421 142 512881 18 64 /national-league 131 599540 4 26 /news/glebe110421 128 449927 41 64 /kent-invicta-league 126 621912 10 27 /news/dealtown090421 118 559548 65 79 /news/margate290421 104 343498 39 78 /news/greeniesfridaypreview-willthefleetmakeitagreateight 2 12839 0 0 /news/tonbridgeangels2-0walthamabbey-sixteengoalmidfielderleeminshullcanturnpro-warrilow 1 5968 0 0 /news/jenkinslooksforwardtowokingtest 1 3457 0 0 /news/beckenhamtown3tunbridgewells0exclusiveinterviews 2 13130 0 0 /news/23rdsept03.html 1 0 0 0 /archive-2006-2014/219 2 8666 0 0 /news/ivegottohaveplayerswhoaregoingtoworkfor90minutessaysbeckenhamtownbosshuntley 1 3810 0 0 /news/cugleylookstoremovestaines 2 9372 0 0 /news/greenwich200519A 4 17770 0 0 /news/551bc99b39646 1 3472 0 0 /news/rickybennettcharity190117 3 11660 0 0 /news/budgetcutsforcewalkertoquitstones 2 7382 0 0 /news/erithbelvedere4-1corinthian-thehardgraftspaidoffsaysdoublewinnermickycollins 3 34872 0 0 /news/dartsbossburmansignsqualitymidfielderberquez 1 3333 0 0 /news/dealvslade030404.html 2 0 0 0 /news/playingrymanleaguefootballisagoalofoursrevealssevenoakschief-exclusiveinterview 5 26777 0 0 /news/ebbsmaid070618 3 10398 0 0 /news/fisher041215 3 11046 0 0 /news/551a979806bd0 4 19573 0 0 /news/othernews/AEI251004.html 1 0 0 0 /news/tompkinsineedmenaroundme-exclusive 3 14186 0 0 /news/551a9797c748a 1 3225 0 0 /news/thepitchwasplayableagreedisappointedbosses-exclusiveinterviews 1 4751 0 0 /news/20thdec05.html 3 0 0 0 /news/wefaceourtoughtesttesttodatewarnsford-exclusiveinterview 3 11051 0 0 /news/londonersreleasedbyramsgate 5 15855 0 0 /news/551a9250e78aa 2 12932 0 0 /news/stonesshockitsnotthebeginningoftheendinsistsbowden-brown 2 8112 1 0 /news/eastbourneborough0-3maidstoneunited-winningtrebleisanoutstandingachievement-parkinson 4 32618 0 0 /news/31stmar05.html 1 0 0 0 /news/kentleague/cray/crayvdeal200304.html 1 0 0 0 /news/NationalLeagueStatement290920 4 13572 0 0 /news/othernews/kentcupdraws0405A.html 1 0 0 0 /news/tunwells050216 4 15910 0 0 /news/ramsgate161020 3 14245 0 0 /news/551bc5dcd9683 1 3514 0 0 /news/drmartens/premier/dover/8thoct04.html 1 0 0 0 /news/angelsinheavenihadatearinmyeyeattheendadmitsproudlocalherosonnymiles 2 11366 0 0 /news/wevegottodowhateverittakestowinthetiesaysdoverathleticbosschriskinnear 3 16241 0 0 /news/551bc5e77f8c1 1 4473 0 0 /news/ashfordunitedmustplaythewaitinggame 1 3913 0 0 /news/magicwandstaketotheroadtocelebratesuccess 1 3911 0 0 /assets/uploads/content/Crockenhill_pitch%20-%20Copy%202 1 238894 0 0 /news/folkestone040318 2 8341 0 0 /news/drmartens/eastern/sittingbourne/erith&belvedere111204.html 1 0 0 0 /news/wewillcomeoutstrongerfromourfinancialconcernsvowsdormantcugley 2 9246 0 0 /news/551a931d9d7f9 1 3457 0 0 /news/551bc99aea666 1 3924 0 0 /news/princesparktelluswhatyouthink 1 3446 0 0 /news/minorworkathartsdownparkwillensuremargategainpromotion 2 7443 0 0 /news/maidstoneunited0-1waltoncasuals-alltheywantedtodowaswastetimesaysjaysaunders 1 6389 0 0 /news/rymanleagueinsistfanshavetopaytowatchrearrangedkentderby 2 7526 0 1 /news/theicingonthecakewouldbetoreachthelondonseniorcupfinalsaysstevechapman 2 8586 0 0 /news/gormancondemnsmartinovercareerthreateningtackle-exclusive 2 9991 0 0 /news/crayvalley231015 3 10137 0 0 /news/othernews/19thoct04.html 1 0 0 0 /news/charltonathleticunveilbobpeetersastheirnewboss 4 15098 0 0 /news/551bc99e3e57a 1 4670 0 0 /news/craywanderersnewstadiumwillbeeco-friendly-andbuilttoconferencestandards 1 4370 0 0 /news/kentfootballfixtureswc230106 2 7164 0 0 /news/wembleyisadreamforanyoneinvolvedinfootballsaysashfordunitedcoachjohnovard 2 9621 0 0 /news/weneedtoimproveifwearetogetclosetolandingthetitlesayslyddtownbossdavesmith 1 3489 0 0 /news/jamiehandsinrequesttoleavestonebridgeroad 2 13792 0 0 /news/551a956b990c3 3 10701 0 0 /news/eastleigh250904.html 2 0 0 0 /news/fromtheeditor 1 2792 0 0 /news/phoenixsports4-1fisher-wevecomeawayfromapotentialbananaskinunscathedsaysbeckingham 5 50032 0 0 /news/7thjuly04.html 2 0 0 0 /news/dolbypiscinaisahellofaplayertobringoffthebench 2 8649 0 0 /news/30thaug03.html 2 0 0 0 /news/ryman/bromley/dulwichvbromu18210304.html 1 0 0 0 /news/deresbidforcountycupdouble 2 8062 0 0 /news/551a96db48256 1 4056 0 0 /news/tenyearsofwembleymemoriesiwillfightmywaybackintofootballvowssampson 1 6494 0 0 /news/phoenixsports220219 2 9048 0 0 /news/stanflac121220 17 163078 3 5 /news/wardimhappywithmybudget-exclusiveinterview 1 3596 0 0 /news/iveworkedhardtobearymanleaguemanagersaysvcdathleticbosstonyrussell 4 17920 0 0 /news/9thjune04A.html 1 0 0 0 /news/huntleyandmehmetarestayinghereinsistsbeckenhamsecretary 1 4618 0 0 /news/tonbridge300817 1 4064 0 0 /news/551a979a74192 1 3992 0 0 /news/ithinkwevegotenoughinourlockertogetaresultathanworthvillasayssimonhalsey 2 9576 0 0 /news/551a95b3dbf43 3 12765 0 0 /news/crockenhill110617 4 17477 0 0 /news/stanfarn050515 4 37982 0 1 /news/canterbury130715 5 22397 0 0 /news/bromebbs010118 4 38318 0 0 /news/stonesbeginsearchforanewsponsor 1 3480 0 0 /news/19thjuly05.html 2 0 0 0 /news/drmartens/premier/welling/15thmar04.html 1 0 0 0 /news/551a979ac4a14 1 4837 0 0 /news/551a96785e3c2 1 4831 0 0 /news/551a9c0e490e6 1 4289 0 0 /news/october2011results 1 9733 0 0 /news/facarlsbergvasefourthrounddrawitsasclearasblackice 1 3373 0 0 /news/watcheuro2008atyourfootballclub 1 2952 0 0 /news/sportingclubthamesmead280719 3 10823 0 1 /news/drmartens/premier/dover/slough140804.html 1 0 0 0 /news/tonbridge151105.html 2 0 0 0 /news/waltvbrom030404.html 1 0 0 0 /news/favershampasskentleaguegroundgrading 1 3637 0 0 /news/crowborough160717 2 7026 0 0 /news/ebbsfleet310120 2 7752 0 0 /news/resultsdecember2008 1 4892 0 1 /news/551bc99cd77c6 1 5370 0 0 /news/dartssignbarnesfromrivalsmaidstoneunited 1 3501 0 0 /news/wellgotoramsgateingoodspiritssayswhitstabletownbossjustinluchford 1 3506 0 0 /news/erithbelvcroy010116 3 11124 0 0 /news/theleaguemustawardusthepointssaysyorath 2 7173 0 0 /news/trottinastateofshockasmargatelosesevengoalthriller 1 5383 0 0 /news/ithinkwevehadagreatseasonsayscorinthianbossmattlonghurst 3 14231 0 0 /news/wewanttoputinagoodperformanceforourhomecomingsaysmaidstoneunitedbossjaysaunders 1 6047 0 0 /news/ibelievethatwecanturnthisaroundinsistsrusthallbosspaulmcdonagh 2 8128 0 0 /news/551a9799a1d75 2 9399 0 0 /news/franniecollinisnotgoingtodartfordconfirmstonbridgeangelsbosstommywarrilow 1 4274 0 0 /archive-2006-2014/175 3 12869 0 0 /news/theresalotoftalentinthislevelandtheyrenotreallyseenorreallyappreciatedsaysrose 3 13075 0 0 /news/soccershortsfisherathleticunveilplansfornew35mstadium 2 22047 0 1 /news/canterburycitychairmanplotspromotionintokentleague 1 3654 1 0 /news/warrilowthreatenstowieldtheaxe 2 9424 0 0 /news/itwasmenagainstboysadmitsbaldacchino-exclusive 1 3686 0 0 /news/doverathletic3-1cambridgecity-itsnicetoseejonwallisbackonsongsaysmartinhayes 1 7407 0 0 /news/othernews/3rdmar04.html 1 0 0 0 /news/borehamwood121105.html 1 0 0 0 /archive-2006-2014/287 3 12042 0 0 /news/dulwich170915 3 11325 0 0 /news/theclubisdefinatelygoingtherightwaysaysmaidstoneunitedacademymanagerjackparkinson 2 10604 0 0 /news/croydon1-3hendon 2 10904 0 0 /news/gormangivesreservesthechancetoimpresshim-exclusiveinterview 2 9434 0 0 /news/thamesmeadtown1-2maldontiptree-wejustdidntperformadmitskeithmcmahon 1 7303 0 0 /news/camberley110904.html 1 0 0 0 /news/maidstone301004.html 2 0 0 0 /news/greenmill290716 2 38744 1 1 /news/sevenoaks031205.html 2 0 2 0 /news/injuryravagedstonesawaitclearanceforirishmidfielder-exclusive 2 9672 1 0 /news/weredefinatelycomfortableenoughtoremainintheleaguesaysbromleyskippertutuhenriques 2 11396 0 0 /news/551bc5e806841 2 10862 0 0 /news/commerciallyitsextremelyimportanttoreachfacupfirstroundsaysbromleybossmarkgoldberg 3 11633 0 0 /news/first50fanswatchfisherforfreethankstopopularyoutubechannelcopa90 3 14339 0 0 /news/signingexperiencedplayersisdifficultadmitssladegreenboss 1 3545 0 0 /news/harrysmith100816 2 8312 0 0 /news/eritwhit210118 1 5566 0 0 /news/welltaketonbridgetoanotherlevelinsistsskipperaris-exclusive 1 4995 0 0 /news/thefoundationshavetobeinplacefirstsaysbeckschairman 1 5035 0 0 /news/551bc99d7f217 2 19679 1 1 /news/lovellwantstoendcampaignonastrongnote-exclusive 1 4244 0 0 /news/nextseasonwillbeafreshstartsayscraywanderersbosskeithbird 2 7730 0 0 /news/551bc99b0ab56 1 4301 0 0 /news/2ndnov05.html 1 0 0 0 /news/drmartens/eastern/sittingbourne/walthamforest231004.html 1 0 0 0 /news/dockersunveilhugginssigning 1 4701 0 0 /news/AFCWimbeldon041204.html 2 0 0 0 /assets/images/email/ 7 2868 0 0 /news/nickreevesoptsformovetomaidstoneunited 1 3048 0 0 /news/weredesperatetogetbackinactionsaysfolkestoneinvictabossneilcugley 1 4433 0 0 /news/holmwell061119 3 38278 1 0 /news/othernews/seal260904.html 1 0 0 0 /news/lovellvowstoturnaroundashfordsfortunes 1 4526 0 0 /news/welldart221116 3 30147 0 0 /news/bromley070716 3 12045 0 0 /news/551a931de3281 1 3327 0 0 /news/orpington200720 2 6944 0 0 /news/kentleague/ramsgate/25thjan04.html 1 0 0 0 /news/kentleague/whitstable/7thnov03.html 1 0 0 0 /news/sheppey200820 3 9856 0 0 /news/thefa.com. 1 0 0 1 /news/551a96778c233 1 3784 0 0 /news/551a9c0e374ce 1 3907 0 0 /news/chathamtown4-1fleettown-wegotalittlebitoftherubofthegreenadmitspaulfoley 4 60296 2 1 /news/ryman/bromley/epsovbrom061203.html 1 0 0 0 /news/551a956c134ec 2 6570 0 0 /news/ashford041215 3 9864 0 0 /news/actordyernolongerourchairmansaysborosecretary 1 3288 0 0 /news/ebbsfleet250720 2 8286 0 0 /news/craywands161116 1 3628 0 0 /news/ourleaguepositionisgoodontheeyesaysjenkins 2 9497 0 0 /news/corbvsitt131203.html 2 0 0 0 /news/soccershortsramsgateopendoorsforgodalmingvisit 1 4582 0 0 /news/holmesdale180920 2 9128 0 0 /news/wevegottobecompetitiveineverygamesaysfrancis 1 3474 0 0 /news/phoenix271017 2 9009 0 0 /news/fishersaytheyoweusonewarnshernebaybosssimonhalsey 1 3727 0 0 /news/551a9250ceb94 1 3480 0 0 /news/ifwegettheperformancesrighttheresultswillpickupsayswhitstablebossjustinluchford 1 3858 0 0 /news/beaconsfield190205.html 2 0 0 0 /news/cugleythreemorewinstobeentirelysafe 2 8808 0 0 /news/ourpitchresemblesthickchocolatesauceadmithernebay 1 3084 0 0 /news/erithphoe110418 4 42572 0 0 /news/iwanttofinishthejobistartedsaysdolby 1 4698 0 0 /news/ashfordtownsyouthsidesneedtosecurefinancialpackagetoplayathomelands 2 7686 0 1 /news/doverathletic2-1brackleytown-hessenthalerwantsperfectiondespitepremierscalp 1 6816 0 0 /news/eritchat250220 4 47456 0 0 /news/wecouldvegotsomethingfromthegamesaysmcmahon 1 4211 0 0 /news/rosethestandardofkentleaguefootballishighexclusiveinterviews 1 5346 0 0 /news/drmartens/eastern/sittingbourne/sittingbournevfleet060903.html 1 0 0 0 /news/551a956beff28 2 5662 0 0 /news/gillsratcliffe040615 7 70724 5 2 /news/fisher0-0corinthian-idlovetowinsomethingforbosstonysitfordsaysmattlonghurst 3 55436 1 2 /news/soccershortsbromleypulloffcoupbysigningstarstrikeradambirchall 4 27881 0 1 /news/hessenthalerlookstobringinprolificstriker 2 8523 0 0 /news/iwanttotestmyselfallthetimesaysdartfordbosstonyburman 4 18177 0 0 /news/princesparkopenerisallticket-exclusiveinterview 4 15652 0 0 /news/2ndjuly03.html 3 0 0 0 /news/551a956c04cc1 2 6352 0 0 /news/drmartens/premier/welling/grays091004.html 1 0 0 0 /news/8thsept04.html 1 0 0 0 /news/hernebay3-2favershamtown 4 18092 0 0 /news/fhp040317 4 11909 0 0 /news/abbottfeelswoundupoveribrahimagreement 2 11080 0 0 /news/551a931e6fdcc 4 26158 0 0 /news/minshullwantsgoodformtotakeintotheplay-offs 2 7286 0 0 /news/dartbrai231217 9 173482 4 4 /news/iwantambitiousplayersthatarenotinitforthemoneysaysdoverathleticbosschriskinnear 6 26918 0 0 /news/mitchellmakeshernebayskipperoconnorhisfirstsigning-exclusive 3 13057 1 2 /news/theresnoreasonwhywecantremainunbeatensaysabbott 1 3885 0 0 /news/kingstonian2ashfordtown4 4 12589 0 0 /news/sheppey260617 1 4054 0 0 /news/phoenixsports6-1sevenacresidcup-thisclubisgoingtogetbiggersayssteveoboyle 3 30614 0 0 /news/gravesendreleasesixplayers 1 3237 0 0 /news/fleetshareholdersagreefanswebsitedeal 1 3024 0 0 /news/woking2-0maidstoneunited-imimmenselyproudofmyplayers-hume 2 11966 0 0 /news/wemustputourchancesawaysaysgaryabbott 2 9468 0 0 /news/9thjune04.html 1 0 0 0 /news/whitvtham251003.html 1 0 0 0 /news/lordswood280420 3 10537 0 0 /news/gravesham080917 4 17090 0 0 /news/phoenix210217 1 3412 0 0 /news/lawsonreplaceswingsstalwartgreen 6 18222 0 0 /news/beckenham231020 6 23688 1 0 /news/tonbridgeangels0-2bromley-warrilowruesfinanciallossfollowingfacupexit 1 6092 0 0 /news/whitstablebossmarklanegiveshissquadthreegamestomake18-mancut 1 4156 0 0 /news/551bc5e3de50e 1 3127 0 0 /news/bromley120618 3 15132 0 0 /news/wingsnetyoungfree-kickspecialist 5 18390 0 0 /news/17thfeb05.html 2 0 0 0 /news/thefacupthirdqualifyingrounddraw 2 6080 0 0 /news/551a95b3e489d 4 17374 0 0 /news/551bc99b2dccc 1 3294 0 0 /news/resultsoctober2014 3 37727 0 0 /news/skipperpaullorrainecommitsfuturetoebbsfleetunited 1 3522 0 0 /news/fleetsscreentestcouldbringinatleast155000 1 4409 0 0 /news/aaronperryrelishesnewchallengeattudorsports 4 17958 0 0 /news/sittingbourne3-1whyteleafe-ourpoorhomerecordhascostusadmitsabbott 2 11428 1 0 /news/dannywakelingkfuwellingtown040719 5 18546 0 0 /news/snodland030217 3 10848 0 0 /news/551a97b0c259b 3 14670 0 0 /news/551a931dbfda3 4 15918 0 0 /news/fleetflyinghighastheyunveilnewsponsor 4 17356 0 0 /news/stansfeld070220 3 11678 0 0 /news/humewehadtheedgeovertonbridge 1 5262 1 0 /news/resultsnov2015 4 43822 0 0 /news/bromley1-0burgesshilltown-wemadehardworkofitadmitsbromleybossmarkgoldberg 5 40958 0 0 /news/hollgleb250215 3 30221 0 0 /news/deres160705.html 2 0 0 0 /news/greenoptsformovetohome-townclubdartford-doversigninnocentstriker 1 6448 0 0 /news/551a92504acac 1 3307 0 0 /news/fanshelpfolkestonespromotionbid 1 4026 0 0 /news/551bc5e7e4e88 1 4137 0 0 /news/dartford1-2gillingham-sawyerpleasedwithgoalscoringtrialistbonner 1 6807 0 0 /news/wevegottomakeournexttwohomegamescountsaysbutler 1 3693 0 0 /news/551bc5dd2979c 3 14116 0 0 /news/ebbsfleet021119 2 8620 0 0 /news/maidstoneunited0-1dartford-welackedpassionandfightfumesangrystonesboss 2 11554 0 0 /news/bromley0-1dagenhamredbridge-werestillputtingallthejigsawpiecestogethersaysgoldberg 4 31786 0 0 /news/resultsfebruary2009 1 5049 0 0 /news/resultsfeb2016 4 40321 0 0 /news/chelmsford200905.html 2 0 0 0 /news/551a97b1d3334 1 4928 0 0 /news/wedofancyourchancesagainsthorshamsaysvickersassistantandysilk 1 5120 0 0 /news/551bc5dd1bcd2 1 3402 0 0 /news/werepunchingaboveourweightadmitshigh-flyingjones 2 7025 0 0 /news/suttonunited1-0doverathletic-wevegotmoreimportantthingstoworryabout-exclusive 1 6544 0 0 /news/kentleague/lordswood/26thjuly04.html 1 0 0 0 /news/whitehawkisatoughtieatthisstageofthefacupsaysfolkestoneinvictabossneilcugley 1 4588 0 0 /news/eritbeck300418 2 19860 0 0 /news/crowcole280117 2 20854 0 0 /news/wellstal231119 3 25453 0 0 /news/craywanderersrelishprestigiousvisitfromgbdeafsquad 1 13281 0 1 /news/tonbbren250815 5 47567 0 0 /news/messagefromtheeditor 1 2637 0 0 /news/wecantlettheoccasiongetthebetterofussaysdulwichhamletbossgavinrose 4 15448 0 0 /news/folkestone061219 2 6952 0 0 /news/drmartens/premier/dover/calaisreport.html 1 0 0 0 /southern-counties-east-football-league/26 10 48326 0 1 /news/551a96dc907df 1 4236 0 0 /news/28thjune04.html 2 0 0 0 /lordswood-2003-2006 12 36842 0 0 /news/27thoct04.html 1 0 0 0 /news/resultsmarch2016 3 30979 0 0 /news/havantvfolkfat291103.html 2 0 0 0 /news/kentleague/beckenham/27thaug03a.html 1 0 0 0 /news/551a9c0ee7494 4 61406 0 0 /news/14thmar04.html 1 0 0 0 /news/bromley211119A 3 16817 0 0 /news/soccershortsstoneslaunchcarshareschemetogettohomelands 2 20992 0 1 /news/tonbgill110715 5 46010 1 1 /home/ 1 3583 0 1 /news/thamesmead171205.html 1 0 0 0 /news/idsayweredarkhorsesforthekentleaguetitlssayserithtownbosstonyrussell 1 5309 0 0 /news/dulwphoe050916 6 115882 4 3 /news/angelsreleasewattstocuttheircloth 1 4296 0 0 /news/ashford281016 2 6820 1 0 /news/angelsallgearedupforpromotionpush 1 4793 0 0 /news/cantlord210417 2 9060 0 0 /news/wellingunitedfacewinding-uporder 2 6796 0 0 /news/551a931e0624d 1 3268 0 0 /news/soccershortssladegreenmustraise40000tomaintainkentleaguestatus 1 8584 0 0 /news/gillsfanswillgivehessawarmreceptionatdoversaystaylor 1 4846 1 0 /news/vcdathletic0beckenhamtown2 4 16618 0 0 /news/croydonchiefhashighhopesforleworthy 2 20547 0 1 /news/cumberbatchwecannotaffordtolose-exclusiveinterview 2 8304 0 0 /news/milestargetsfourwinstomaintainrymanleaguestatus-exclusiveinterview 2 9186 0 0 /news/551bc5e403395 1 4404 0 0 /news/aylesburyunited4-2favershamtown-itsnotbeenagoodweekfortheclubadmitsrayturner 5 44857 0 0 /news/soccershortsfisherunveilmarcbirchamtransfercoup 5 30290 0 0 /news/551a9797c9082 1 3806 0 0 /news/551a96779274b 1 4245 0 0 /news/walkerifeelthepressureontheseladsissometimestoomuch 3 16994 1 0 /news/551a967774333 3 12105 0 0 /news/peckham241116 2 7542 0 0 /news/ryman/bromley/bromvdulw261203.html 1 0 0 0 /news/fivekentleagueclubsapplyforrymanleaguestatus 1 2968 1 0 /assets/select2/tests/selection/single.html 1 272 0 0 /news/erithtownre-signlondonolympicgamesmedalhopeful 1 5225 0 0 /news/erithtown021015 4 17214 0 0 /news/lordswoodvvcd160803.html 1 0 0 0 /news/weresorrytoseeyouleavesayschatschairman 2 7201 1 0 /news/551bc5de6a43f 3 25984 0 0 /news/drmartens/eastern/sittingbourne/6thfeb04.html 1 0 0 0 /news/beckenham181019 2 8460 0 0 /news/551a9c91f1d96 1 4565 0 0 /news/kentleague/thamesmead/19thsept04.html 1 0 0 0 /news/crayareahardsidetobreakdownwarnsbutler 1 6083 0 0 /news/551a99e3f04b9 1 4234 0 0 /news/551a9c0e791ae 4 16626 0 0 /news/werenotgoingtostandstillinsistshessenthaler 1 3929 0 0 /news/bromleyt020419 3 30564 0 0 /news/metrogas060616 2 9520 0 0 /news/ashford100818 4 13454 0 0 /news/551a92508bafe 2 9879 0 0 /news/myyoungsterswillgetachancesaysdockersboss 1 5558 0 0 /news/bromvcroyath240204.html 1 0 0 0 /news/afcwimbledon3-4craywanderers-iwanttogettoacupfinalsaysianjenkins 3 28378 0 0 /news/bowden-brownyouthsidessuccessbodeswellforthefuture 5 17706 0 0 /news/12thsept04.html 1 0 0 0 /news/bromstoc291019 5 44541 0 0 /news/haveyoujoinedthecenturyclub 1 2696 0 0 /news/FAStatement260820 3 14366 0 0 /news/drmartens/eastern/sittingbourne/Salivsitt100104.html 1 0 0 0 /news/551bc5db58460 3 14216 0 0 /archive-2006-2014/272 2 8429 0 0 /news/othernews/KYLFIX010304.html 1 0 0 0 /news/tonbridge250915 3 10311 0 0 /news/ofcoursewecanclosethegaponrunawayleadersfavershaminsistshalsey 1 3697 0 0 /news/bromley290321 50 201481 14 25 /news/rymanpaircountthecostofbrokendreams-exclusive 2 11996 0 1 /news/craywanderers1-2maidstoneunited 1 6959 0 0 /archive-2006-2014/149 2 9402 0 0 /news/chatbeck140419 4 49986 0 0 /news/kentleague/VCD/6thdec04.html 1 0 0 0 /news/wereacoupleyearsintoourfive-yearplantogetintothekentleaguesayspiggott 1 4008 0 0 /news/551bc5e768691 1 4269 0 0 /news/551a95b383db6 4 19542 0 0 /news/551a931de166d 1 3571 0 0 /news/551a9250c99c8 1 3695 0 0 /news/iwillnotputnewmanagementtriounderpressuresayscroydonchief 3 13754 1 1 /news/theleagueisourpriorityinssistswhitstablebosspeternott 2 8065 0 1 /news/kentleague/ramsgate/27thoct03.html 1 0 0 0 /news/lordswood220917 1 3444 0 0 /news/x-4 1 2505 0 0 /news/hythe230916 3 20096 1 0 /news/stonesfanswalk14milestotonbridgetoraisefundsforhomecoming 1 4895 0 0 /news/whitstabletownunveilmajorsponsorshipdeal 1 3800 0 0 /news/hessenthalerrelishingspicydartfordreturn 1 4531 0 0 /news/beckseven270318 1 10033 0 0 /news/2ndapr04.html 2 0 1 0 /news/551a9b481d9ed 4 13438 0 0 /news/chatswillspoilsomeonesparty-obrienpledges 1 4671 0 0 /news/bromley290418 4 18346 0 0 /news/thefleetatwembleyfeelthefleetprideandpassion-letsbringthattrophybackhometokent 1 3019 0 0 /news/afccroydonathletic221218 2 7920 0 0 /news/shorts230615 6 75494 3 2 /news/551a9250c1004 3 13605 0 0 /news/lovellreleasespairtoplaymoregames 1 3226 0 0 /news/551bc5e42b439 3 14439 0 1 /news/chipstead3-0whitstabletown-itwasdiabolicaladmitsupsetmunday 1 6596 0 0 /assets/select2/component.json 1 475 0 0 /news/hopefullywecancomehomefrombromleywithsomepointssayswellingbossjamieday 3 14546 0 0 /news/551a95b470977 1 4235 0 0 /news/ineedtonaildowntheplayersiwanttostaysaysebbsfleetunitedbossjamieday 2 8802 0 0 /news/551bc99e199b8 1 4635 0 0 /news/waltoncasuals1-2thamesmeadtown-ithoughtwewanteditmorethanthemadmitskeithmcmahon 2 17506 0 0 /news/margateprepareformakeorbreakshowdowns 1 3766 0 0 /news/dartscontentwithaperiodofconsolidation 1 3895 0 0 /news/lewisham220917 3 12747 0 0 /news/25thmar04.html 1 0 0 0 /news/wevecertainlygotroomforimprovementsaysmargatebosssimonosborn 5 22587 0 1 /news/551bc5e319245 2 8858 0 0 /news/sevenoaks240717 3 19104 1 2 /news/bromspen240218 5 44792 0 0 /news/551bc5e1cfe9f 2 10414 0 0 /news/551a979a945a5 1 4683 0 0 /news/drmartens/premier/welling/18thjuly03.html 2 0 0 0 /news/sittingbourne180219 3 15471 0 0 /news/21staug05.html 2 0 0 0 /news/bromley210618 4 14716 0 0 /news/maldontripwasourworstperformanceoftheseasonadmitsmcmahon 1 4243 0 0 /news/551a9678127b5 4 21121 0 0 /news/kentleague/sladegreen/6thaug04.html 1 0 0 0 /news/jenkinsunveilsbremnersreturn 1 5237 0 0 /news/bromley2-1dorchestertown-jamiebutlerhasthepotentialtohaveanexcellentfuturesaysbird 2 14282 0 0 /news/hollands&blair120920 5 18346 1 2 /news/everybodyattheclubhasbeenfantastichailsdealtownbossderekhares 1 5079 0 0 /news/margatelaunchgatechatservice 6 18817 0 1 /news/portermustdeliverpromotioninsistshythechairman 1 3983 0 0 /news/angelsbeatcrawleytosigngoalkeeperreed 1 3230 0 0 /news/othernews/5thfeb04.html 1 0 0 0 /news/chathamtown1-0godalmingtown-mileshailshislyonsking-exclusiveinterviews 1 7235 0 0 /news/551bc5e00f0fc 2 7826 0 0 /news/nationalleague110318 4 14674 0 0 /news/petershiltonsignsforfolkestoneinvicta 1 3713 0 0 /news/wemustfinishoffthejobinsistspennock-exclusive 2 8515 0 0 /news/sheringhamsbeckenhamdebutputonhold 1 5385 0 0 /news/illneverwalkawayfromtheclubilovesayscraywanderersbossianjenkins 3 13783 0 0 /news/myplayershavetoconcentrateongettingintomy18-mansquadsaysnott 2 9228 0 1 /news/drmartens/premier/dover/wimbledon180904.html 1 0 0 0 /news/hernebay0-3favershamtown-ithinkwewillstarttogetmorerecognitionsaysrayturner 3 23534 0 0 /news/tonbridge110618 4 14062 0 0 /lordswood-2003-2006/2 4 12178 0 0 /news/thesquaditgoingtobetestedsayswellingunitedbossjamieday 2 7934 0 0 /news/551a95b3e8241 4 17334 0 0 /news/soccershorts241215 4 23494 0 0 /news/drmartens/cupdraw.html 2 0 0 0 /news/chathamtownbosskevinwatsonbringsinjonpilbeamfromtunbridgewells 2 7652 0 0 /news/theresnowayweretakingthefootofthepedalsayswarrilow 2 8712 0 2 /assets/smartmenus/css/sm-clean/ 5 1828 0 0 /news/tunwells150105.html 2 0 0 0 /news/margateshowinggreenshootsofimprovement 3 10489 0 0 /news/551bc99c3673f 1 5175 0 0 /news/kentclubsleftfrustratedascoldsnapwipesoutentirefootballprogramme 1 6179 0 0 /news/sykochallengechriskinnearsreds1clivewalkersblues3-kentstarstributes 1 7524 0 0 /news/dartford0-1hythetown-hopefullywecanwinmanymorethingssayshythetownbossscottporter 1 9386 0 0 /news/webelieveintheboysthatwecandoitsaysbromleycoachneilsmith 2 10760 0 0 /news/margate031117 2 7539 0 0 /news/lovellwemustkillteamsoff-exclusiveinterview 3 12115 0 0 /news/dartford1-2borehamwood-wevebeentopallyearandthingsaregettingnervyadmitsburman 1 5332 0 0 /news/wemustavoidwoodenspoondemandsashfordchiefexecutive 2 7022 0 0 /news/thebigkickoffwereontherighttracktowintitleinsistsmcmahon-exclusive 1 5538 0 0 /news/hendonquitsafter18daysshockergillinghamhavecrossedthelinefumesdoverchairmanparmenter 2 8206 0 0 /news/kinnearsignsthurrockgoalkeeperonloan 3 8842 0 0 /news/vickerscancausevaseupset 4 20045 0 0 /fisher-2003-2006/2 4 10901 0 0 /news/551bc5e161f6e 1 3389 0 0 /news/551bc99d33019 1 4209 0 0 /news/margate2folkestoneinvicta1 3 13081 0 0 /news/rusthall300418 3 9453 0 0 /news/sevenoakstown1-0tunbridgewells-roughdiamondshinnerscanplayhighersaysjones 1 6640 0 0 /news/551a9c92a9fed 2 6856 0 0 /news/fanswebsiteagreesebbsfleetunitedtakeover 1 4782 0 1 /news/bromchip301017 3 25373 1 1 /news/canterbury201016 2 7678 0 0 /news/15thaug05.html 2 0 0 0 /news/craywanderers2-3tootingmitcham-concedingheadedgoalsareaconcerntomesaysianjenkins 2 13154 0 0 /news/kentfootballunited090919A 4 18621 0 0 /news/551bc5dfec943 1 5800 0 1 /news/19thfeb04.html 2 0 0 0 /news/vcd080818 3 11922 0 0 /news/tonbridge160620 3 10387 0 0 /news/myplayersowemeawinningperformance-abbott 2 9061 0 0 /news/burgesshilltown2-1chathamtown 2 7560 0 0 /news/kswillbeabigscalpifwecollectthreepointssayswarrilow 1 4297 0 0 /news/ivgottomakesurewegetitrightathastingssayshume 1 4466 0 0 /news/weymouthrobberykicksdaishintheteeth 2 9312 0 0 /news/kentleague/cray/keynvcray070204.html 1 0 0 0 /news/sladevwhitstable111003.html 2 0 0 0 /news/fleetmarchingtothewembleyarchletsmakeitadaytoremember-daish 1 4920 0 0 /news/kentleague/thamesmead/13thaug04.html 1 0 0 0 /news/weacceptourswitchtothenortherndivisionsayschathamchairman 2 7451 0 0 /news/crayvrams081103.html 2 0 0 0 /news/underestimateusatyourperilmcmahontellstitlefavouritesware 1 4425 0 0 /news/sct030816 4 16946 0 0 /news/551bc5e84e4fe 2 7142 0 0 /news/cash-strappedsittingbournefacefighttokeeptheirbestplayers 2 6709 0 0 /news/stonesbidfarewelltobourneparkaftereightyears 2 6770 0 0 /news/tonbridgeangels3-0heybridgeswifts-bosspleasedwithpowellsswiftfinish-exclusive 2 12996 0 0 /news/itsprobablythefirsttimewevegoneintoagamethisseasonasunderdogssaysjaysaunders 2 9362 0 0 /news/20thoct05.html 2 0 0 0 /news/kentleague/cray/crayvtunb271203.html 1 0 0 0 /news/othernews/16thfeb04.html 1 0 0 0 /news/hythe171016 1 3942 0 0 /news/551bc5e601a19 1 5581 0 0 /news/kentleague/lordswood/beckvlord270304.html 1 0 0 0 /news/weneedtostickawayourchancessaysfavershamtowncoachclivewalker 1 4445 1 0 /news/kentleague/beckenham/8thaug03.html 2 0 0 0 /news/tonbridgeangels250720 3 9529 0 1 /news/wereamatchforanyonewarnsmetcalf 1 3837 0 0 /news/wereinafantasticpositionbutwehaventreallystartedyetsaidbromleyherodannywaldren 2 8038 0 0 /news/ebbsbrom290415 6 90334 1 0 /news/thelocalsshouldcometowatchoursuperbqualityoffootballsayscraywanderersstarjoevines 1 3616 0 1 /news/bromley181120 2 7580 0 0 /news/551a9799a7113 2 9828 0 0 /news/soccershortstunbridgewellslaunchsupportersdeal 2 11742 0 1 /news/10thjuly05.html 1 0 0 0 /news/suttonath030617 3 9927 0 0 /news/551a9250f260d 2 13302 0 0 /news/purcellwillhelpusclimbthetablesaysward 1 4389 0 0 /news/551a95b3ef1cc 3 12066 0 0 /news/fisherfacupreplay210904.html 1 0 0 0 /news/tunwells020916 2 6828 0 0 /news/doverathleticprepareforbarnettest 1 4170 0 0 /news/theweekahead-12 1 3976 0 0 /news/wellbetreatinghollandsblairseriouslysaysramsgatebosstimdixon 3 16524 0 0 /news/lordswood080917 1 3390 0 0 /news/crowrust070917 2 22618 1 0 /news/drmartens/eastern/ashford/16thoct04.html 1 0 0 0 /news/southallpleasedwithmargatesresponse 1 4359 0 0 /news/shockasmrtonbridgeangelscharliecoleresignsfromclub 3 11504 1 1 /news/551a95b3a1a49 1 5705 0 0 /news/haworthturnsdownlucrativeoffertostaywithdarts 2 7218 1 1 /news/iminlimboduringjanuarysalesadmitsdaish 2 8640 1 0 /news/sceflstatement131120 2 6504 0 0 /news/ramsgate1-0margate-fansturnontrottafterderbydefeat 2 10622 0 0 /news/bearsdeal231018 4 43450 0 0 /news/wealdart030819 4 38200 0 0 /news/pre-seasonsummer2013-resultsfixtures 5 37760 0 0 /news/wellingtown301119 2 8978 0 0 /news/fisktellshistable-toppingsidetocopewiththepressure 1 4745 0 0 /news/letsfinishtheseasononahighsaysbaker-exclusiveinterview 2 8568 0 0 /news/24thaug05.html 2 0 0 0 /news/warrilowplaysthewaitinggameintransfermarket 2 10172 0 0 /erith-belvedere-2003-2006/2 4 12122 0 0 /news/erithtown191004.html 1 0 0 0 /news/3rddec05.html 1 0 0 0 /news/sittingbourne1-0hythetown-abbottintwotug-of-warfightsthispre-season 2 13791 1 0 /news/4thsept03.html 1 0 0 0 /news/folkestoneinvictafc.co.uk 2 0 0 0 /archive-2006-2014 27 144941 1 3 /news/ashford191115 3 13890 0 0 /news/551a9798757ad 1 3730 0 0 /news/2ndnov05A.html 1 0 0 0 /news/551bc5dee08c8 2 10106 0 0 /news/mittenlossesracetofaceymcaincupclash 1 5315 0 0 /news/soccershortsrobbinsrelishingtelfordshowdown 1 8558 0 0 /news/coldsnapwipesoutalloftonightsfootball 2 5749 0 1 /news/claptonorientladies1gravesendnorthfleetladies2 1 4592 0 0 /news/wemustbouncebacksaysplay-offchasinghume 2 7450 1 0 /news/lovellkeepsfaithwithtrabelsi-exclusiveinterview 5 18055 0 0 /news/angelstransferlisttwokeyassetstobringinextrafunds 2 12992 0 0 /news/crayvalley090417 9 45426 2 2 /news/pennockwemusttakeourchancesagainstweymouththechelseaofconferencesouth 2 7392 0 0 /news/551a9c914f572 2 9939 0 0 /news/551a99e445f0b 1 3154 0 0 /news/shepcray011218 3 33429 0 0 /news/turningpattersonfromclaretintoawhitewilladdspicetofacuptieatchelmsfordsaysbird 2 10689 0 0 /news/doverathletic2-0lewes 2 10476 0 0 /news/551bc5dbdf448 3 11543 0 0 /news/wemusttreatstrugglingsideswithrespectsaysburman 1 4800 0 0 /news/stonessignnorthwoodtocompetewithmullin 1 3408 1 0 /news/arleseytown1sittingbourne3 4 19657 0 0 /news/resultsjanuary2020 4 38541 1 1 /news/margatedirectorpipertargetsplay-offplaces 2 7922 1 0 /news/wewillbemakingsometoughdecisionsoverthenextweeksayswellingunitedbossjamieday 1 3522 0 0 /news/metpolice190405.html 1 0 0 0 /news/holmesdale311218 3 9170 0 0 /news/thamestilb070316 6 94177 0 2 /news/wortvbrom081103.html 1 0 0 0 /news/otfocroc211020 13 156708 4 5 /news/erith070205.html 3 0 0 0 /news/jonesbreakshissilenceandadmitshefearshytheopener 1 4178 0 0 /news/weregoingintherightdirectionsayshalsey 1 3531 0 0 /news/kcl090817 2 7082 0 0 /news/hernebay091004.html 2 0 0 0 /news/tunwells191105.html 1 0 0 0 /news/551bc5e0ba55e 1 5580 0 0 /news/tunbgleb250220 2 5918 0 0 /news/551bc5e15743d 1 5518 0 0 /news/luchfordbacktofull-strengthforhernebayshieldclash 1 4816 1 0 /news/imquietlyconfidentwecanpullitoffsaysford 2 7912 0 0 /news/kentleague/sladegreen/11thmar04.html 1 0 0 0 /news/551a931e54622 1 4381 0 0 /news/walton&hersham111005.html 2 0 0 0 /news/hythe311216 2 6924 0 0 /news/brommaid020917 1 11488 0 0 /news/sittingbourne1-3craywanderers-thetitleisinourhandsnowsaysjenkins 2 11096 0 0 /news/erithtownsincomingchairmanrevealsnamechange 1 5254 0 0 /news/othernews/9thsept04.html 1 0 0 0 /news/everyonehasaparttoplayinourpromotionpushsayswarrilow 1 4759 0 1 /news/kentleague/cray/crayvpaghamfac310803.html 1 0 0 0 /news/sittvsali240404.html 2 0 0 0 /news/551a924ff2c10 2 9734 0 0 /news/22ndjune05.html 1 0 0 0 /news/margate2stainestown5-includessaturdaysresults 4 43541 1 1 /news/drmartens/eastern/erith&belvedere/wingatefinchley301004.html 1 0 0 0 /news/punjab090218 3 12549 0 0 /news/kentleague/sporting/sportvtun081103.html 1 0 0 0 /news/ibelievewewillbeatthedrop-nott 1 3803 0 0 /news/othernews/coneyhall040304.html 1 0 0 0 /news/lanesettosignhissquadatendofseasonbash 1 3818 0 0 /news/theweekahead-3 1 4202 0 0 /news/551a931dc66b8 2 8076 0 0 /archive-2006-2014/101 3 15043 0 1 /news/itsimperativethatwewinatchipsteadsaysmunday 2 9990 1 0 /assets/select2/docs/_layouts/default.html 1 412 0 0 /news/theresnoformguideinthekentleaguesayserithbelvederebossmickycollins 3 12272 0 0 /news/kentleaguescenewhosebeenmakingthenewsthisweek 1 5301 0 0 /news/vcdathletic2-0tunbridgewellsfordaskshowcanwellsbeinthebottomthree-exclusives 1 6256 0 0 /news/551a99e3896e4 1 3465 0 0 /news/thamesmeadinvestigateillegalapproachforskipperkearley 8 37913 3 3 /news/vcdvcray240404.html 2 0 0 0 /news/doverathletic2-3basingstoketown-hessenthalerblamesschoolboydefendingforfirsthomeloss 3 18161 0 0 /news/551a99e37e08c 1 3614 0 0 /news/551bc99a8e511 1 4299 0 0 /news/sladegreensigndartfordquartet 1 5160 0 0 /news/551bc5da7a5a2 2 11814 0 0 /news/kentleague/cray/crayvchesfav221103.html 1 0 0 0 /news/rusticsentersideinkentyouthleague 1 2933 0 0 /news/fixturessaturday14thjanuary2006 3 9931 0 0 /news/lewisham111119 5 15502 0 0 /news/fisher181016 2 7877 0 0 /news/suttonathletic220517 3 10335 0 0 /news/551a931d9f28b 2 6740 0 0 /news/thepfa040517 1 4559 0 0 /news/idbemadtoleavemaidstoneunitednowadmitswalker 1 3775 0 0 /news/gillingham160615 4 17526 0 0 /news/ashfordtown2-2corinthiancasuals 1 3827 0 0 /news/vcdath030417 1 3530 0 0 /news/favershamprovidelocalkidsaplatform 1 3964 0 0 /news/thefleetatwembleymadrushforfivethousandticketsonmatchday 1 3184 0 0 /news/iwanttojumpstraightbackintothestrainsofmanagementsaysaxedkevinharris 3 12105 0 0 /news/matchreports-2 1 11670 0 0 /news/tonbridgeangelspartcompanywithdolby-exclusiveinterviews 2 13918 0 0 /news/thisisagoodtimeinmycareertomoveintofull-timefootballadmitsminshull 2 10234 0 0 /news/4thjuly05.html 2 0 0 0 /archive-2006-2014/85 1 5176 0 0 /news/27thfeb05.html 2 0 0 1 /news/fisherathletic3-1maidstoneunited-friendlyfinishesasanine-a-sidefarce 1 5210 0 0 /news/holmesdale2-4craywanderers-jenkinswantsmorecashtokeepnewfaces 1 6586 0 1 /news/tunbridgewellspartcompanywithfarnie-exclusive 2 5625 1 0 /news/hythevslade081103.html 1 0 0 0 /news/vcdhar020416 5 68053 1 1 /news/faversham120517 2 8012 0 0 /news/maidstone180619 3 10398 0 0 /news/sykochallengewebsitelaunched 3 8673 0 0 /news/3rdfeb05.html 1 0 0 0 /news/551a9c91dc71f 2 13268 0 0 /news/iamveryproudthattunbridgewellsareplayingatwembleysayskentleaguechairdeniserichmond 2 8028 0 0 /news/31staug04.html 2 0 0 0 /news/ashfnorw200115 4 32773 0 0 /news/ebbsfleet210820 3 10321 0 0 /news/tobehitwitheliminationsoclosetoacupfinalwasashocktoeveryonesaysandyconstable 1 5709 0 0 /news/551bc5e7ea10d 1 4643 0 0 /news/margate060716 3 9594 0 0 /news/holmbans240916 5 92093 0 0 /news/therewillbemoretocomefromuswarnshernebaybosssimonhalsey 1 4537 0 0 /news/doverssecondstringrelishmidweekaction 5 22142 0 0 /news/ryman/bromley/18thsept04.html 1 0 0 0 /news/holmbrid090915 6 104452 2 1 /news/orpington191115 4 16294 0 0 /news/551a97981a8d1 4 19105 0 0 /news/gillingham030117 3 10481 0 0 /news/kentleaguenewsinbriefeaglescanjumpaboardtramsforhalfprice 1 3129 0 0 /news/smellsliketeenspiritatchatham-exclusiveinterview 1 4315 0 0 /news/icantdefendtheboysafteranightlikethatfumesangelsbosstommywarrilow 1 5135 0 0 /news/craywands061017 1 3407 0 0 /news/doverreceive3000fromsupporterstrust 1 3736 0 0 /news/551a9250030e1 1 3418 0 0 /news/kentleague/whitstable/18thsept03.html 1 0 0 0 /news/glebe130417 4 17474 0 0 /news/thamesmald150216 5 46592 1 1 /news/wereequippedforpromotionsaysashfordunitedbosspaulchambers 1 4660 1 0 /news/rusthallsignbalmertoaddsomesteel 1 3565 0 0 /news/ebbsfleetunited1-2salisburycity-daishwevegottosticktogether 2 10728 0 0 /news/551bc5df3cff1 1 6290 0 0 /news/yorathstransfertargetstrainwithmargate 1 4019 0 0 /news/bromley021117 1 5980 0 0 /news/fisher250518 2 8546 0 0 /news/ifwerenotchallengingthenimnotdoingmyjobproperlysaysramsgatebosstimdixon 5 26135 0 0 /news/fisher1-10barnet-mybiggerandbetterplayersdidntshowuptonightadmitsperryhanifan 2 16392 0 0 /news/wehavetomakesurewefocusontheleaguenowsaysbeckenhamtownbossjasonhuntley 1 4118 0 0 /news/maidstone040619 4 15050 0 0 /news/cheatclaimsforcesearlyfinishtokentleaguematch-exclusive 1 3857 1 0 /news/craywanderersp-pchipstead 1 2943 0 1 /news/midweekmatchreports 2 16113 0 0 /news/iwillbringthestonesbackhomevowschairman 1 3489 0 0 /news/theladscantwaittopitthemselvesagainstbetterplayersandabetterteamsaysmattlonghurst 4 22385 0 0 /news/dartford1-0basingstoketown-weverodeourluckalittlebitadmitsdartsbosstonyburman 2 13440 0 0 /news/ifweconductourselvesproperlyweshouldhavetoomuchforlittlehamptonsaysjackparkinson 3 14693 0 0 /news/sponsorpullsthenetfromunderneathhernebay 1 3623 0 0 /news/littlehampton280804.html 1 0 0 0 /news/crownalexandramovingagiantstepclosertobeingacceptedintokentinvictaleaguenextseason 2 9101 0 0 /news/ashford271115 3 10440 0 0 /news/551a9798675f7 1 3341 0 0 /news/scefl210720 6 20714 0 0 /news/551a97190438c 4 25702 0 0 /news/lukeblewden280517 2 7632 1 0 /news/orpington041015 14 161314 9 8 /news/551bc5e488e67 1 5076 0 0 /news/chairmancallsforsupportaswhitstablebidtobeatthedrop 1 4916 0 0 /news/theboardaregoingbackwardsratherthanmovingforwardclaimsscottporter 4 16274 0 0 /news/kingstonian300405.html 2 0 0 0 /news/regularpersonnelbringsinvictasuccess 1 5825 0 0 /news/551bc5e6729d8 1 4832 0 0 /folkestone-2003-2006/ 1 3050 0 0 /news/bromleytitleslabber190415 4 16661 0 0 /news/551a967854e7b 2 6934 1 0 /news/vcd190205.html 2 0 0 0 /news/staplehurst170620 2 6954 0 0 /news/craywanderers3-2wingatefinchley-therewontbeabettergameineuropetonight-jenkins 1 8565 0 0 /news/551bc5e6a760b 3 22096 0 0 /news/lordswoodbeginsearchfornewmanageraftersimonhalseyquits 2 6824 0 0 /news/17thaug05G.html 4 0 0 0 /news/LondonFAStatement050321 6 26010 0 0 /news/551bc99d4816e 1 6618 0 0 /news/folkestoneinvicta0-0horsham-itsimportantwelookabitmoredangerousupfront-cugley 1 6407 0 0 /archive-2006-2014/153 3 14154 1 0 /thamesmead-2003-2006/ 1 3025 0 0 /news/551a931e92fa0 4 26834 0 0 /news/dartford0-3crystalpalace 4 55021 3 3 /news/kingstonian1-2sittingbourne-wecangoonandwintitlesaysabbott 2 15924 0 0 /fisher-2003-2006/ 1 2984 0 0 /news/551a9250562dc 6 28561 0 0 /news/doublewinningminnowswewanttomoveonfurther-exclusiveinterview 6 30050 0 0 /news/ryman/bromley/bromvthurrockfac111003.html 1 0 0 0 /news/milesruesbadluckwithcupdraws-exclusiveinterview 1 5224 0 0 /news/lewisham290116 4 16518 0 0 /news/doverbeginworkonnewcentrespot 1 3656 0 0 /news/hythetown040919 5 19432 0 0 /news/humelooksforwardtodartsderbyshowdown-exclusiveinterview 1 6145 0 0 /news/551bc5e867d0f 2 7322 0 0 /news/13thapr05.html 1 0 0 0 /news/dolbymakesstoreyhisfirstsummersigning-exclusive 3 11203 2 2 /archive-2006-2014/128 9 45078 0 0 /news/englandsnumberonecontinuestoimpresshereinkent 1 4987 0 0 /news/thisisabigclubthatneedsabigjobdoneonitsaysfisherco-bossmartinford 2 7252 0 0 /news/kentleague/greenwich/ramsgate231104A.html 1 0 0 0 /news/kentseniortrophyfinalimtheavramgrantofthekentleaguesaysfirkins 2 9826 0 1 /news/551a97984f136 2 9232 0 0 /news/beckenham250919 3 10722 0 0 /news/whitstable090316 4 15173 0 0 /news/wellingunited110520 2 6160 0 0 /news/mygreatteamwillwintheleagueinsiststrott 2 10103 0 0 /news/folkestoneinvicta1-2stainestown 2 9144 0 0 /news/551a9c0f050b4 3 13356 0 0 /news/551bc5dd1ea23 1 4396 0 0 /news/551bc5de54fb2 1 4475 0 0 /news/soccershortserithbelvedereunveilthearrivalofplayer-jointassistantaaronlacy 3 29039 0 0 /news/sct230518 3 14355 0 0 /news/kentleaguesearchfornewsponsors 2 15232 0 0 /news/fleetwoodtownunveilbarryfergusonloansigningaheadofbromleyfacuptie 2 9458 0 0 /news/folkestoneinvicta3-1gravesendnorthfleet 5 24908 0 0 /news/dealtown301216 2 6403 0 0 /news/thamesmead170817 1 3619 0 0 /news/matchreportsfolkestonesbarrenruncontinues 1 11202 0 0 /news/wehavetotakethebullbythehornsandgetoutofourlittlerutsaysjoefrancis 1 4180 0 0 /news/doverathleticnetkeistercoup 1 3581 0 0 /news/itsgreatforustohaveollieschulzbackhomesaysramsgatebosstimdixon 6 24602 0 0 /news/aclondon170416 3 17199 0 0 /news/551bc5de40b76 1 4957 0 0 /news/dartfordunveil30000sponsorshipdeal 6 18581 0 5 /news/thekeywillberecreatingtheintensityofplayingagainsttheholderssaysmartinlarkin 3 14384 0 0 /news/edgardavidsturnsdownambitiousgreenwichboroughapproach 4 14062 0 0 /news/29thjuly05.html 1 0 0 0 /news/551a9cf52c047 2 15578 0 0 /news/tonbbogn230216 4 34946 0 0 /assets/ckeditor/plugins/link/images/ 1 391 0 0 /news/hollands120319 4 18826 0 0 /news/whitstabletown2-0harrowborough-onourdaywefearno-onesayswhitstablebossjustinluchford 3 19613 0 0 /news/kentleague/deal/Sampson14.html 1 0 0 0 /news/iwantamassivereactionfrommyplayersinsistsdartsbosstonyburman 1 4266 0 0 /news/wearereallyexcitedaboutthecrowdsizefordartfordsaysbromleyco-chairmanashleyreading 4 16478 0 0 /news/kentleague/lordswood/lordswood.html 1 0 0 0 /news/551bc99b3ac2d 1 3549 0 0 /news/hollashf130116 4 35342 0 0 /news/drmartens/eastern/sittingbourne/sittvbanb130304.html 1 0 0 0 /news/stevefirkinsquitsbottomsidefisherthroughfamilycommitments 2 7426 0 0 /news/vcdathletic301020 3 11169 0 0 /news/tunbridgewells2-0hadleighunited-wevereachedsemiswithoutspendingapenny-martinlarkin 2 19042 0 0 /news/margate140119 4 13561 0 0 /news/wevebroughtasquadintohaveagosaysmickycollins 2 7309 0 0 /news/wemustknuckledownforfavasetieathernebaysaysproudporter 1 3944 0 0 /news/thepowerandtheglory 2 11110 1 0 /news/woking3-0dartford-thepressureisonmeadmitsdartfordbosstonyburman 2 16624 0 0 /news/31staug04A.html 1 0 0 0 /news/19thoct05.html 2 0 0 0 /news/weregoingtoenjoyourlastninegamessaysramsgatebossjimward 1 12367 1 1 /news/bromley110619 4 12589 0 0 /news/stoneschairmanclearsupstadiumconcerns 2 8108 0 0 /news/therecorddoesntreallymeanmuchifwedontgetoutoftheleaguesayswellingbossjamieday 2 8952 0 0 /news/maidstruro080516 6 91344 2 2 /assets/images/site/social/Thumbs.db 1 4096 0 0 /news/drmartens/eastern/fisher/6thoct03.html 1 0 0 0 /archive-2006-2014/133 3 14106 0 0 /news/sampsonexpectedtomakefullrecoverysaysward 1 3143 0 0 /news/doverathletic220920 2 6904 0 0 /news/bromleysgoingtobeatoughtaskbuthopefullywecanshowourtruecolourssaystonyburman 2 8770 0 0 /news/ascottonb040916 4 81424 0 2 /news/werelookingadifferentsidenowsaystonbridgeangelsbosstommywarrilow 1 4735 0 0 /news/concord040618 3 11811 0 0 /news/dealvlord230304.html 1 0 0 0 /news/faversham110920 2 8742 0 0 /news/othernews/coneyhall110804.html 1 0 0 0 /news/countdowntoprincespark15days-latestpicturesofdartfordsnewhome 1 3345 0 0 /news/hendon260205.html 2 0 0 0 /news/wewillflypasttheangelssaysburman 2 9210 0 0 /news/chipstead090716 3 10271 0 0 /news/551bc99b74d8c 2 8994 0 0 /news/551bc5e3e5b17 2 9951 0 0 /news/kentleague/whitstable/27thnov03.html 1 0 0 0 /news/hernebay0vcdathletic1exclusiveinterviews 1 6274 0 1 /news/hollands290718 2 9704 0 0 /news/borehamwood0-2bromley-wevegotateamthatshoulddobetterintheleagueadmitsneilsmith 3 23750 0 0 /news/folkestoneinvicta3-2hastingsunited-wegaveiteverythingsaysplay-offfinalistneilcugley 3 25992 0 0 /news/dulwichextremelyconfidentthatshowdownwithdoverwillgoahead 1 3499 0 0 /southern-counties-east-football-league/2 4 34723 1 1 /news/supportersruelastminutevenueswitch 1 4550 0 0 /news/craywands260317 1 3864 0 0 /archive-2006-2014/66 2 9824 0 2 /news/otfordunited1-2kentcountyleague-nothingsinkedinontheteamsheetsaysdarrenphillips 3 25850 0 0 /news/551bc5e5a269b 1 3686 0 0 /beckenham-2003-2006/ 1 3018 0 0 /news/crayvalley240817 1 3951 0 0 /news/sittingbourne1-0waltoncasuals-lovellnotpleasedwithperformanceashissidegojointtop 1 5701 0 0 /news/551a97b070b12 3 12882 0 0 /news/promotionracewillgorighttothewiresayslovell 1 3729 0 0 /news/lordswood100719 4 14658 0 1 /news/craywanderers2-2harlowtown-imsoconfidentweaintgoingtogetrelegatedsaysgaryabbott 2 16288 0 0 /news/551a99e376154 1 4404 0 0 /news/aclondon180915 3 12189 0 0 /news/wewontstandincableswaysaysmcmahon-exclusive 1 4181 0 0 /news/hessenthalertargetstwoloansignings-exclusive 1 4209 0 0 /news/551bc99b60da4 1 2917 0 0 /news/ivegotagoodenoughbudgettowinpromotionnextseasonrevealswarrilow 1 4071 0 0 /news/ashbyaddstomargatesnew-looksquad 1 3873 0 0 /news/hythetownlaunchinforaquidschemetoincreasegates 2 8148 0 0 /archive-2006-2014/282 4 17322 0 0 /news/ashford270805.html 2 0 0 0 /news/ResultsOctober2020 4 43785 0 1 /news/wellingunited1-1doverathletic-everyoneinvolveddeservesapatonthebacksaysjamieday 3 25252 0 0 /news/resultslockdown2020 3 10166 0 0 /news/doverathleticbookplaceinlastsixteentokeepwembleydreamalive 1 3236 0 0 /news/dulwilson160515 4 19566 0 0 /news/warrilowhavefaithinrook 2 10715 0 0 /news/thamesmeadtown4-1maidstoneunited-wellfightourwayoutoftroublesayskeithmcmahon 2 21644 0 0 /news/551bc99e1c7fd 1 4786 0 0 /news/folkestone150205.html 2 0 0 0 /archive-2006-2014/83 1 5145 0 0 /news/glebe170120 2 7294 0 0 /news/cablebrothersaimtobebrightsparksfortitlechasingwells 2 10999 0 0 /news/letusdefendourtrophypleadsmcmahon-exclusiveinterview 1 3586 0 0 /news/tonbridgeangels3-3chathamtown-milesitsgoingwell-exclusiveinterviews 5 29850 0 0 /news/stoneschairmanstampsdownonill-discipline 1 3522 0 0 /assets/smartmenus/demo/bootstrap-navbar.html 1 2544 0 0 /news/551bc5e852909 2 9278 0 0 /news/theplayersarenotrobotsandthefixtureback-loghasbeenruthlesssayssamdenly 3 14763 0 0 /news/wecancausetonbridgeproblemssaysupbeatbutler 1 4590 0 0 /news/hessenthalermakeschangesforleaguecupclash-exclusive 1 3540 1 0 /news/corinthian060418 2 7473 0 0 /news/vcd220305.html 1 0 0 0 /news/iliketothinkwellachieveourtopsixtargetbutwemustbemoreconsistentsaysstevechapman 3 11606 0 0 /assets/select2/tests/vendor/ 5 1925 0 0 /news/551a979887949 4 19001 0 0 /archive-2006-2014/164 4 17314 0 0 /news/wewanttolayamarkerdownfortherestoftheleaguesaystunbridgewellsskipperjasonbourne 3 12061 0 0 /news/lordswood150520 6 20168 1 0 /news/ashfordenticedefensivepairawayfromhastings 2 7889 0 0 /news/kentleague/maidstone/maidvwhit170204.html 1 0 0 0 /news/vcd110904.html 2 0 0 0 /news/29thjune03.html 2 0 0 0 /archive-2006-2014/150 4 18738 0 0 /news/chathamtownbosskevinwatsonunveilstwonewdefenders 1 4030 0 0 /news/sevenoakspairquitduetolackofbackingfromclub-exclusive 1 3602 0 0 /news/551bc5e72df65 2 9296 0 0 /news/ebbsfleetunitedre-namestandtohonourmanagerliamdaish 1 3483 0 0 /news/favershambosscopleyunveilseightnewsignings 1 4101 0 0 /news/drmartens/eastern/sittingbourne/arlesey140804.html 1 0 0 0 /news/bromley020920 6 64519 3 3 /news/kentleague/sporting/sportvslade181003.html 1 0 0 0 /news/drmartens/premier/welling/preseason.html 2 0 0 0 /news/551a97b2707dd 1 4702 0 0 /news/maidstone181204.html 1 0 0 0 /news/itsabouttimeweplayathome-itfeelslikeweretheharlamglobetrotterssaysfisherboss 2 8410 0 0 /news/gormanbeginssalvageoperation-exclusiveinterview 1 5163 0 0 /news/FAStatement180720 5 25111 0 0 /news/crocksitt040715 3 34752 0 0 /news/551bc99cb5351 1 6509 0 0 /news/craykspo241018 4 38774 0 0 /news/vcdathletic2-0corinthian-wethoroughlydeservedtogetsomethingsaysvcdbossrickybennett 1 9070 0 0 /news/bumpercrowdwillhelpoutcash-strappedfolkestoneinvicta 2 11264 1 0 /news/ashfordtown2tonbridgeangels3 2 11530 0 0 /news/wemustnotbecasualinfrontofgoalsaysburman 1 3891 0 0 /news/dartford070618 3 9477 0 0 /news/551a99e4e98a4 1 6284 0 0 /news/551bc5e338493 3 14030 0 1 /news/seasonhasbeenalearningcurveformeadmitsmcmahon 2 8716 0 0 /news/ryman/bromley/windsor050804.html 1 0 0 0 /news/14thjan04.html 2 0 0 0 /news/eastbourneborough0-1dartford-whoknowswhatwecanachievenowsaysdartfordbosstonyburman 1 6480 0 1 /news/551bc5e847686 3 11108 0 0 /news/collinsbeatsoffcompetitiontolandstrikerpowell 2 6996 0 0 /news/hollands190216 4 15330 0 0 /news/drmartens/premier/dover/8thsept04.html 1 0 0 0 /news/akindeearnstransfertobristolcity 1 3716 0 0 /news/dulwichhamlet1-1favershamtown-itwasimportanttocarryonourunbeatenrunsaysrayturner 3 24041 1 0 /news/margatelaunchyouthacademy 1 3511 0 0 /news/wehopeevenmorenewfanswilldiscoverthegreatfootballweareplayingsayschairjackpayne 3 15032 0 0 /news/dartford121115 4 15049 0 0 /news/canterbury100119 4 17969 0 0 /news/craywanderers2-5afchornchurch-myworstopeningdaydefeatadmitswandsbossianjenkins 1 7298 0 0 /news/551a9250a00f3 2 8440 0 0 /news/theclubhasbeenstarvedofsuccesssaysnewly-appointedwhitstabletownbossjimward 3 14418 0 0 /news/bromley170616 6 44483 2 2 /news/allwereaskingtheplayersistogiveusaperformancetokeeptheirshirtssaysgerrycox 2 7997 0 0 /news/maidstoneunited2-1burgesshilltownweneedyoursupportathomeinsistsstoneschairman 5 31855 0 0 /news/othernews/AEI270904.html 1 0 0 0 /news/551a9798a9264 4 21813 0 0 /news/suspensionscouldcostustheleaguewarnsfrustratedtrott 1 3592 0 0 /news/faversham240619 3 10266 0 0 /news/drmartens/eastern/folkestone/windsor300804.html 1 0 0 0 /news/dartford041116 3 12252 0 0 /news/foleyexpectstoughopeneratwells 1 3848 0 0 /news/ebbsfleet050520 2 9546 0 0 /news/ryman/bromley/romfordvbromfr120803.html 2 0 0 0 /news/ramsphoe161018 5 52347 0 0 /news/551bc5e575781 2 7838 0 0 /news/14thaug05.html 3 0 0 0 /news/crayvhern121103.html 1 0 0 0 /news/551a956c36bee 2 6644 0 0 /news/doverathletic2-2dartford-debutantsmakedreamstartsaskentderbyendsall-square 1 7361 0 0 /news/fisherannounceprofitsdespitesufferinglossesonthefield 1 16401 1 1 /news/doverathletic0-1bathcity-wewerewellbelowourbesttodayadmitsnickyforster 1 5799 0 0 /isthmian-league/17 6 29540 0 1 /news/ifwearetoachieveanythingathuddersfieldtheresgoingtobeelevenheroessaysmartinhayes 1 5676 0 0 /news/drmartens/premier/dover/kingstonian060904.html 1 0 0 0 /news/wellpunj110320 3 32444 0 0 /news/healthmatters070915 4 17338 0 0 /news/soccershorts010616 4 22574 0 0 /news/holmesdale281018 4 14061 0 0 /news/favershamtown0-3dulwichhamlet-wehaventputaperformanceintodayadmitsrayturner 1 6907 0 0 /news/illbepleasedwithmidtableadmitsboroughbossmiles-exclusive 1 4311 0 0 /news/551a9677e6947 1 3574 0 0 /news/551bc5e8eb4a2 3 15563 0 0 /news/ebbsfleet230720 2 5950 0 0 /archive-2006-2014/59 2 10041 0 0 /news/kentclubssearchforsponsors 2 8961 0 0 /news/theresmoreexpecationsonusthisyearsaysbromleybossmarkgoldberg 5 23961 0 0 /news/craywanderers5-1dulwichhamlet-hopefullywellmoveonfromthissteppingstonesaysmikepaye 2 18479 0 0 /news/551a99e3d0f03 1 4513 0 0 /news/maidstoneunited3-0wingatefinchley-wecanplaybetterthanthatsaysjaysaunders 3 26596 0 0 /news/551bc5e2e6c56 2 9500 0 0 /southern-counties-east-football-league/22 8 40337 0 0 /news/kentfootballunited070719 4 13804 0 0 /news/551bc5dc71e10 2 9922 0 0 /news/551a97b0a7c27 1 3463 0 0 /news/30thdec04.html 3 0 0 0 /news/551a931e7ac7f 3 9234 0 0 /news/westdeal231019 4 44188 0 0 /news/folkestone220719 3 11247 0 0 /news/folkestone270320 3 12263 0 0 /news/hayesyeadingunited3-2tonbridgeangels-imnotthrowinginthetowelsaysdefiantwarrilow 2 19138 0 0 /news/wewanttocontinuethatwinningmentalitysayshythetownbossscottporter 1 4661 0 0 /news/rymanleaguecupfinalramsgatechairmanreadytostepdownafter20yearsatthehelm-exclusive 2 12040 1 1 /news/wevegottomakesurethatwekeepprogressingsayssuttonathleticbossjamescollins 3 15066 0 0 /news/2ndsept05.html 2 0 0 0 /news/25thjan04.html 2 0 0 0 /news/drmartens/eastern/erith&belvedere/erith&belvedere.html 3 0 0 1 /news/wevegottobeupforthebattlesayslane 2 7275 0 0 /news/chatham210417 2 8638 0 0 /news/551bc99aa82d8 1 4215 0 0 /news/10thoct05.html 1 0 0 0 /assets/ckeditor/plugins/wsc/LICENSE.md 1 1474 0 0 /news/551a931e46d49 1 3659 0 0 /news/dartford0-0grimsbytown-thedamagewasdoneineightminutesofmadnesslastweeksaysburman 3 24257 1 0 /news/wallishasafutureatvcdinsistsford-exclusiveinterviews 3 15739 0 1 /news/margate180620 6 19869 1 1 /news/bromley0-1doverathletic-itwasbackstothewallbutweweremagnificentsaysnickyforster 1 8134 0 0 /news/immorethanwillingtorepaybromleysfaithinmesaysryanhall 1 4255 0 0 /news/chelmsfordcity3-2bromley 2 8180 0 0 /news/myplayersneedtostartwinningtheirownpersonalbattlesfumesnott 1 4787 0 0 /news/goalkeepernorthwoodbeginssearchforanewkentclub-exclusive 1 4337 0 0 /news/phoenix240818 3 12693 0 0 /news/551bc5e452fa0 1 3148 0 0 /news/551a9c0e70081 1 4420 0 0 /news/marghornc181218 4 33432 0 0 /news/kentleague/maidstone/23rdjuly03.html 2 0 0 0 /news/dartbrai060518 6 55420 0 0 /news/20thjuly05.html 1 0 0 0 /news/werebuildingforthefuturesayssittingbournejoint-managerjimward 3 15062 0 0 /news/wellingownersseekfanshelptopaycrippling85000taxbill 1 6049 0 0 /archive-2006-2014/20 4 20001 0 0 /news/arisrelishinghomeplay-offlottery-exclusiveinterview 1 4619 0 0 /news/weretheunderdogsforthethirdyearrunningclaimscorinthianbossmattlonghurst 4 23749 0 0 /news/551bc99b7cfe8 1 4162 0 0 /news/resultsnov301116 3 32744 0 0 /news/everythingsinplaceforustodeliversaystunbridgewellsbossmartinlarkin 5 28280 0 0 /news/wevesetourselvesalittlechallengeandwevegottocrackonnowsayspaulchambers 2 7846 0 0 /news/551bc5e2292af 1 4480 0 0 /news/lordswoodbeginsearchfornewbossasjasonlillisstepsdownatendofseason 2 7508 0 0 /news/chatham151015 7 38012 3 2 /news/crayvalley190519 3 15051 0 0 /news/bromley030617 2 7563 0 0 /news/sevenoaksleague100120 2 7966 0 0 /news/kentleague/beckenham/6thjuly03.html 2 0 0 0 /news/vanaramaunveiledasfootballconferencetitlesponsorinthree-yeardeal 4 17264 1 1 /news/hbaybirchard130515 4 15296 0 0 /news/thebreakwilldousgoodsayscugley 1 5396 0 0 /news/staines291005.html 1 0 0 0 /news/551bc5ddd0ae8 2 24621 0 1 /news/fisher091118 4 13686 0 0 /news/fansloseconfidenceinmyfcaschairmanstepsdownatfleet 1 4896 1 0 /news/threepointsaremoreimportantthanfacupwin-porter 1 4277 0 0 /news/ashbytakesurchinsdefeatonthechin 2 7365 0 0 /kent-invicta-league/11 5 39244 1 1 /news/wehavecharacterinabundancesaysfocusedhessenthaler 1 3635 0 0 /news/551bc5de30125 1 3244 0 0 /news/daishpromiseschangesforweymouthtrip 2 8462 0 0 /news/25thaug05.html 2 0 0 0 /news/aclondon130615 4 22658 1 1 /news/millwallstatement081220 2 8066 0 1 /news/concussionarticle021218 3 17230 0 0 /news/tunbridgewells230918 4 16294 1 0 /news/sevenmaid250717 2 22678 0 0 /news/sittvdart141003.html 2 0 0 0 /margate-2003-2006/2 4 12117 0 0 /news/29thfeb04.html 1 0 0 0 /news/sittingbourne171217 1 4420 0 0 /news/tomparkinsonfacesmake-or-breakfortnight 2 10004 0 0 /news/ryman/bromley/10thnov03.html 1 0 0 0 /news/burgessvsittfat011103.html 2 0 0 0 /news/eastthurrockunited0folkestoneinvicta2 2 8580 0 0 /isthmian-league/5 5 34884 1 1 /assets/fileman/lang/de.json 1 3592 0 0 /news/welldoourselvesjusticesayssevenoaksbossjones 1 3604 0 0 /news/icanabsolutelyguaranteeoursupportersthatourperformanceswillbebettersaysfisherboss 1 3817 0 0 /news/cumberbatchsurplustorequirements 2 7184 0 0 /news/wevegottostartperformingsayshessenthaler 1 4444 0 0 /news/thefacupbringsupitsownromancewhichhastingsexperiencedlastyearsaystimdixon 4 23040 0 0 /news/sevenoakstown3-1lordswoodmoorewarnshissidenottocrashandburn-exclusiveinterview 5 26721 0 0 /news/551bc5e1bd340 2 11110 0 0 /news/rochches140916 4 68936 2 1 /news/551a956baf59c 1 3294 0 0 /news/551a979a00f12 2 9226 0 0 /news/greenwich130815 4 16202 0 0 /news/23rdnov05.html 1 0 0 0 /news/551bc5e86c3eb 1 3297 0 0 /news/afcwimbledon291105.html 1 0 0 0 /news/551a96dbed70c 1 3985 0 0 /news/551bc5db864c5 4 39512 0 1 /news/kentfainsurancestatement190320 3 9880 0 0 /news/551a979a11816 2 10820 0 0 /news/KSTSF080304.html 2 0 0 0 /news/wevegottobeonourtoesorlordswoodwillbiteusonthebacksidesayshythebosstimdixon 3 12473 0 0 /assets/fileman/php/deletefile.php 1 45 0 0 /news/skippersaunderscontentwithstarttohisseason 2 8658 0 0 /news/canterburycity221220 2 9292 0 0 /news/greenwich190216 4 13286 1 0 /news/holmesdale0-3wellingunited-daysetforbudgettalkswithchairmanonfriday 2 14544 0 0 /news/sevenoakstown0-2corinthian-wereonasteeplearningcurveadmitssevenoakscoachferguson 1 7529 0 0 /news/05thapr04.html 1 0 0 0 /news/ashford170716 4 16076 0 0 /news/551a9798c2421 2 11190 0 0 /news/ryman/26thjune03.html 2 0 0 0 /news/peckham280417 3 10973 0 0 /news/fleetsmarchtothewembleyarchwemustmakeourhomeadvantagecountsaysdaish 1 4408 0 1 /news/wellsblondeambitiontochangetheirfortunes-exclusiveinterviews 2 9978 0 0 /news/sevenwhit050219 4 38804 0 0 /news/fleetforcedtomakebudgetcuts 2 9611 0 0 /news/isthmianleague290620 4 13749 2 1 /news/trottsaysasmargatemanagerbutwithaslightlyreducedbudget 1 3068 0 0 /news/bromley300519 6 20569 1 0 /news/coneyhallsearchfornewreserveteammanager 1 3142 0 0 /news/wehavetobeatthebigboyssaysjones 2 9583 0 0 /news/ipleadforeveryonetodoasundanceinwhitstablesayschairmangaryjohnson 2 13923 0 0 /bromley-2003-2006/3 3 9507 0 0 /news/ramstoot150417 2 19708 0 0 /news/resultsoctober2012 2 18016 0 0 /news/5thoct05G.html 3 0 0 0 /news/punjab201218 3 11202 0 0 /news/ashfordtownunveilrecordsponsorshipdeal 2 7222 0 0 /news/iveseentheclubgrowoverthelastcoupleofyearssayscrayvalleybossstevechapman 1 5410 0 0 /news/folkestoneinvictasignbrendoncassfromchathamtown 1 3988 0 0 /news/bromleyfc.tv/site/bromley-fc-join-junior-premier-league-young-players-apply-now/ 2 0 0 0 /news/punjab310820 3 10945 0 0 /news/551bc5dd2523e 1 4832 0 0 /news/wingsreleasevines 2 7013 0 0 /news/whitstabletown3-0ashfordtown-welackedfightbemoanslangton 1 6794 0 0 /hythe-2003-2006 12 36470 0 0 /news/tudorsports071018 6 43543 0 1 /news/ramsgate0leatherhead0 3 9557 0 0 /news/22ndjuly03.html 1 0 0 0 /news/wecanstillreachtheplay-offssaysdoverathleticbosschriskinnear 1 4140 0 0 /news/dannywardwevegotthebestadultplayersinthanet 1 3720 0 1 /archive-2006-2014/185 5 22137 0 0 /news/551a95b389c04 1 5277 0 0 /news/no-onesplaceinthesideissafesaysinvictabosscugley 2 11234 0 0 /news/13thmay05.html 2 0 0 0 /national-league/29 2 9008 0 0 /news/foresthillpark271020 3 12770 0 0 /archive-2006-2014/277 4 17338 0 0 /news/15thmar04.html 1 0 0 0 /news/favershamtownbossjustinluchfordtargetsthe50pointmarktomaintainrymanleaguestatus 3 15862 1 0 /news/kspofish130318 4 39494 0 0 /news/craywarrilow100415 3 17996 0 0 /news/551bc5de60a56 1 2856 0 0 /news/allourmemberclubsbackednortonspromotion-sayskentleague 2 7058 0 1 /news/drmartens/eastern/folkestone/folkvcorb210204.html 1 0 0 0 /news/dartswelcomenewboardmember 2 7783 1 0 /news/551a9c92085b4 2 17231 0 0 /archive-2006-2014/7 5 25122 0 0 /news/faversham231019 4 13716 0 0 /news/bromvleat240104.html 1 0 0 0 /tunbridge-wells-2003-2006/2 3 9028 0 0 /news/welling281217 3 11904 0 0 /archive-2006-2014/130 5 24286 0 0 /news/dover080216 4 14546 0 0 /news/craywanderersagreeloandealtobringstrikerlewisperkinsbacktohayeslane 2 9372 0 0 /news/returningtostoneswasano-brainersaysroyston 2 8338 0 0 /news/barking170905.html 2 0 0 0 /news/551a956c71203 1 3175 0 0 /news/conference/gravesend/17thoct04.html 1 0 0 0 /news/wewillgivewhitehawkarunfortheirmoneysaysfavershambossjustinluchford 2 9353 0 0 /news/ashfordathletic111218 3 12404 0 0 /news/soccershortsifeelverypassionatelyaboutrebuildingtheclubinsistsashfordowner 1 11385 0 0 /news/crayvalley130815 4 15722 0 0 /news/maidstoneunited1-1hythetown-maybethiscankick-startourseasonsaysscottporter 3 21854 0 0 /news/werenottakingthisgamelightlysayswhitstabletownbossnickysouthall 4 17600 0 0 /news/27thaug03.html 3 0 0 1 /news/chathamtown0-2graysathletic-werenotabadteamonthebackofoneresultsayskevinwatson 1 6142 0 0 /news/31stJan04.html 2 0 0 0 /news/margate261216 4 15386 0 0 /news/ifwehaveambitionstogetintotheplay-offswemustwinourhomegamessayskeithmcmahon 1 4915 0 0 /news/sladegreen1erithbelvedere2 3 10370 0 0 /news/soccershortsihadtothinklongandhardaboutleavingchathamforfolkestonesayscass 2 25230 1 1 /news/551a9718b8c1f 1 3310 0 0 /news/bearsted050817 1 3966 0 0 /news/drmartens/premier/welling/7thjuly03.html 2 0 0 0 /news/hernvlords111003.html 1 0 0 0 /news/ebbsfleetconsiderrevertingtopart-timestatus 2 6510 0 0 /news/someofourplayershavegottostarttoimproveorwellhavetodosomethingaboutitsayscugley 3 11390 0 0 /news/wevegotaverygoodchanceoffinishingwherewewanttobesaysnickyforster 1 4450 0 0 /news/fisher260819 3 10470 0 0 /news/ijustwanttofinishashighaswecansaystonbridgeangelsbosstommywarrilow 1 4427 0 0 /news/greenwich270817 2 7021 0 0 /news/stankspo230418 3 28248 0 0 /news/551a95b3f2fed 4 17405 0 0 /news/551a979846192 2 9834 0 0 /news/snodstap040515 3 30707 0 0 /news/phoecor301217 1 8918 0 0 /news/lordswood090218 2 6889 0 1 /news/24thmar04.html 2 0 0 0 /news/eastgrinstead121219 5 16716 0 0 /news/17thoct04.html 4 0 0 0 /news/ebbsfleetunited2-4thatchamtown-weretremendouslyproudofouryoungkidssaysmccarthy 1 5569 0 0 /news/wereinamassivelearningcurvewiththesquadsayscraywanderersbosskeithbird 5 22521 0 0 /news/aveleysexpectationsareashighasourssaysfrancis 2 8228 0 0 /news/invictastarssignonthedottedline 3 11393 0 0 /news/soccershortssupportdoverathleticinsteadoffbeingfleecedbypremierleaguesayschairman 2 14352 0 0 /news/march2007fixturelist 1 5727 0 0 /news/551bc5e752861 2 10398 0 0 /news/bromleians220519 2 7386 0 0 /archive-2006-2014/91 3 14767 0 0 /news/26thjuly04.html 2 0 0 0 /news/wereoneoftensidesgoingforthetopfivesaysdoverbossmartinhayes 2 9200 1 1 /news/wardaimstotakeramstocupfinal-exclusive 1 3695 0 0 /news/letsgetthispartystartedscreamstitle-winningdartfordcaptain 1 3769 0 0 /news/551a97984908c 1 4688 0 0 /news/kentleague/ramsgate/3rddec04.html 1 0 0 0 /news/margatebeginsearchforyorathsreplacement 1 3332 0 0 /news/crayvalley260715 5 18776 0 0 /news/11thjuly05.html 2 0 0 0 /news/soccershortskentclubspleasedwithpre-seasonpreparations 4 81844 3 3 /news/maidstone180320 3 10427 0 0 /news/bromdov070818 4 40942 0 0 /news/cordiceeveryonewillgetachance 5 24266 0 0 /news/551bc5e001b69 1 4109 0 0 /news/wardplotshistoricfatrophygiantkilling 1 4456 0 0 /news/doverarrangefriendlytogetkeyplayersfit 3 9656 0 0 /news/29thfeb04A.html 1 0 0 0 /news/erith231004.html 1 0 0 0 /news/wevegotalongwaytogotobeatourbestsaysbromleybossmarkgoldberg 3 11978 0 0 /news/rusthall4-0bearsted-weshouldvedonebetterreflectsrusticsbossronaldson 1 5503 0 0 /news/holmesdale230916 3 12009 0 0 /news/dartford2-7norwichcity-happyreturnformcdonald 1 7553 0 0 /news/theexcitementaroundtheclubhasbeengreatsaysmaidstoneunitedmidfielderjackparkinson 3 13487 0 0 /news/kentleague/ramsgate/20thoct03.html 1 0 0 0 /news/551bc5e8962a5 1 3022 0 0 /news/ramsgate071018 5 23967 0 0 /news/afcfleyt190519 6 33494 0 0 /news/seagerslamspoordefending 1 3710 1 0 /national-league/8 5 37792 1 1 /news/deal111005.html 1 0 0 0 /news/bromley190318 3 18102 0 0 /news/imsurewecangoontobetterthingssaysbridonropesassistantkrishollidge 2 7516 0 0 /news/thamesmeadtown3-7portsmouth-itwasadreamforustogetthisfarsaysprouddannyharris 3 28241 0 0 /news/sittingbourne3-1chathamtown 1 19545 1 1 /news/bridon150117 5 19280 1 1 /news/551a967807c16 1 3347 0 0 /news/551a9677de9bf 1 3523 0 0 /news/bromley270518 4 18457 0 0 /kent-county-league/2 6 40800 2 2 /news/12thnov04.html 1 0 0 0 /news/folkestone260620 3 9983 0 0 /news/cugleypraisesredbridgeskids 4 20862 0 0 /news/551a9bb0029bc 3 9831 0 0 /news/551bc5e2c9c65 1 2978 0 0 /news/chathamtown0-1ramsgate-millstakestheplaudits 1 17903 1 1 /news/whitstabletown0-1sittingbourne-pulmanwillgetusthegoalsinsistsmunday 1 5588 0 0 /news/blyspartanshasthepotentialtobeakentleagueclubsaysdepartingbossmatthume 1 4540 0 1 /news/kentleague/cray/crayvgree061203.html 1 0 0 0 /news/ebbsfleet020620 3 14043 1 0 /news/ashfordunited020220 3 10330 0 0 /news/kentleague/ramsgate/bengal140804.html 1 0 0 0 /news/551a97b1be795 2 19389 1 1 /news/itwillbenicetoprogressandcontinueourrunsayscrayvalleybossstevechapman 2 7430 0 0 /news/itwontbegrimupnorthsaysbinks 1 4783 0 0 /news/beckgleb210819 3 25416 0 0 /news/551a9250184b7 1 5874 0 0 /news/editorspleafaomrjerrydolkechairmanbromleyfc 1 3582 0 0 /news/sportingbengalunited1-7thamesmeadtown-senegalstopperpreventsfrighteningscoreline 3 43268 2 2 /news/lordswoodplayerscanexpectgruellingpre-seasonwarnsguest 1 3456 0 0 /news/pre-seasonresults-summer2012 1 7501 0 0 /news/dulwich091117 2 7258 0 0 /news/maidstone270618 3 11178 0 0 /news/glebe04062015 3 10126 0 0 /news/ebbsfleet101019 3 10228 0 0 /news/angelsoneofthefavouritesnextseasonsayschairman-exclusive 1 5811 0 0 /news/crayvhythekstfinal170404.html 1 0 0 0 /news/drydenapprovesofkeistersigning 1 3886 0 0 /news/hythes27-goalstrikerpens18-monthcontract-exclusive 2 10266 0 1 /news/iamdelightedtoplayfortheseniorsidesaysloyalfootballertomholmes 3 9951 0 0 /news/sittingbourne1-2chipstead-wevethrownawayourchancesofmakingtheplay-offsfumsabbott 2 12286 0 0 /archive-2006-2014/29 3 15294 0 0 /news/brickiesandramscontinuegoodearlyform 4 28540 0 0 /news/craywanderers2-4kingstonian-theleaguehasntbeenlosttodaysaysfrancis 4 47664 2 1 /news/bromvmetr151103.html 1 0 0 0 /news/romford040321 8 25632 0 0 /news/29thjune05G.html 3 0 0 0 /news/folkestoneinvicta1-5margate 4 18744 0 0 /news/551a979b17d5a 2 9718 0 0 /news/tunbridgewellsbossmartinlarkinhailshisfacupheroes 1 5478 0 0 /news/kentleague/erithtown/31staug04.html 1 0 0 0 /news/craywanderers2-4concordrangers-werebeingpunishedforourmistakessayspaulblade 1 7051 0 0 /news/551a931e64c76 4 13570 0 0 /news/drmartens/eastern/chatham/1stjuly03.html 2 0 0 0 /news/craywands261118 3 9675 0 0 /news/551bc99ab1058 1 4887 0 0 /news/pottersbartown4-1thamesmeadtown-itstimeforafewtomoveonsaysmeadbosskeithmcmahon 1 7665 0 1 /news/drmartens/premier/dover/fgrvdove030204.html 1 0 0 0 /news/551bc5e3a7cc8 1 3887 0 0 /news/551a9799af641 2 9438 0 0 /news/551a967795ad5 1 3857 0 0 /news/fisher081217 4 14461 0 0 /news/roystonmissesdockershomecoming 1 3740 0 0 /news/craywandsredb270915 4 35914 0 0 /news/whitstabletownunveilnickysouthallastheirnewmanager 3 12598 0 1 /news/folkestoneinvicta0-0heybridgeswifts 1 4356 0 0 /news/phoenixsports2-1hollandsblair-wevegottolearnquicksayssteveoboyle 4 39124 0 0 /news/brickiesreleasecdtocelebrate120yearsoffootball 3 9193 0 0 /news/punjab270819 3 10662 0 0 /news/kentleague/tunbridgewells/27thoct04.html 1 0 0 0 /news/bedfont100905.html 1 0 0 0 /news/rusthoun060817 4 86279 2 3 /news/stoneschairmancallsforsupportwithnewstadium 3 13244 0 0 /news/burmandemandspositiveresponseafterwarewake-upcall-exclusive 2 8342 0 0 /news/dannygannon241117 2 9216 0 0 /news/itsachancetobespecialforadaysaystunbridgewellsbossmartinlarkin 3 15077 0 0 /news/vcdhanw131018 3 29409 0 0 /news/craycroy270219 5 49282 0 0 /news/hessenthalerpreparesforbigleap 1 4540 0 0 /archive-2006-2014/50 6 30079 0 1 /news/551bc99d2436b 1 5166 0 0 /news/551bc5e4af58c 1 3202 0 0 /news/myplayershaveapointtoproveagainstinvictaadmitshythebossfisk-exclusive 1 4280 0 0 /news/FAVaseStatements281120 5 19337 1 1 /news/kentcounty/26thjune03.html 2 0 0 0 /news/ashfordtown1-4fleettown-lovelltakespositivesfromfleetfootballlesson 2 13392 0 0 /news/551a9c91b06bd 2 10020 0 0 /news/iloveplayinginthebiggamessaysmcclements-exclusive 1 4510 0 0 /news/551a931e3b03e 2 7395 1 0 /news/551bc5dab54ea 2 6662 0 0 /news/dartford300320 2 8672 0 0 /news/551a97993af77 3 29648 0 1 /news/551a95b36d1f9 1 3166 0 0 /news/margate180519 4 13286 0 0 /news/chathamtownunveilkevinwatsonastheirnewmanager 1 3195 0 0 /news/551bc5e53a87a 5 74410 2 3 /news/yiadompenscontracttocurbderesinterest 1 3872 1 0 /news/thamesmeadtown0-4ramsgate-ramsnegotiatetoextendturnersloanspell 1 6366 0 0 /news/monarchsvowtobringkentleaguefootballtostaplehurst 1 4630 0 0 /news/litttunb010919 3 28947 0 0 /news/arsenal2-0gillingham-ourgirlsstooduptoarsenalsaysproudbossjamesmarrs 4 36870 0 0 /news/holmesdaleelectedintothekentleague-exclusive 1 2727 0 0 /news/corinthian140816 2 8082 0 0 /news/folkestone020518 1 4457 0 0 /news/wemustmaintainourhighlevelssayshessenthaler 1 4464 0 0 /news/551a9718bb07d 4 13110 0 0 /news/tunbridgewells4-1hollandsblair-farniesomeofourfootballwasexcellent-exclusive 4 32693 2 0 /news/craywands130219 3 15129 0 0 /news/551bc5e377227 1 4586 0 0 /news/hernebay140917 1 3688 0 0 /news/werrenotlookingtobuildshort-termwerelookingtothefuturesaysjustinluchford 1 4888 0 0 /news/551a97b0aa631 1 3381 0 0 /news/suttonwillbeatoughgamesayswellingunitedbossjamieday 2 8251 1 0 /news/stansbradley080515 3 12635 0 0 /news/551bc5dfd4136 3 13410 0 0 /news/chatham100219 4 18578 0 0 /news/551a9798e73f9 2 10160 0 0 /news/kentseniortrophyfinalthepitchruinedourpassinggamerageshughes-exclusive 1 5208 0 0 /news/gillingham0-2doverathletic-doverheroesinhessclubheaven 1 6581 0 0 /news/13thaug05.html 3 0 0 0 /news/551bc5dce2ed4 1 4370 0 0 /news/mcmahonreplacesbladetopushthamesmeadalongfurther 1 3198 0 0 /news/bromleytiewelchandfuseinidowntocontractsuntiltheendofnextseason 1 3867 0 0 /news/ebbmaibro310517 10 131080 6 7 /news/lingcant140815 5 66394 1 1 /news/wereconfidentofcausinganupsetinsistshume 1 4643 0 0 /news/551a9718aba4d 4 13822 0 0 /news/erithtown091015 4 20261 0 0 /news/premierleagueplough1minto68bluesquareclubs 2 7741 0 1 /news/warrilowwillbeahugesuccessattonbridgesayshornetsboss 1 3569 0 0 /assets/uploads/content/Greenwich_Borough_s_Travis_Grego.html 1 52120 0 0 /news/faversham270416 4 22554 0 0 /news/billericay260905.html 2 0 0 0 /archive-2006-2014/166 4 18652 0 0 /news/january2007fixtures 1 6065 0 0 /news/drmartens/eastern/sittingbourne/dartford201104.html 1 0 0 0 /news/maidstoneunited0-3folkestoneinvicta-welookbacktoourbestsaysinvictabossneilcugley 1 6378 0 0 /news/cugleyrealisticabouttrophyprogress 1 4917 0 0 /news/ihopewecanmoveforwardandmaketheseplansarealitysayscraywandererschairmangaryhillman 4 32541 1 3 /news/pennockdelightedwithtriplesigning 6 22371 0 0 /news/gillingham110620 3 12856 1 0 /news/mixedfortunesforourconferencepaironopeningdaydaishpennockinterviews 5 25596 0 0 /archive-2006-2014/189 5 22777 0 0 /news/sittingbourneswitchmidweekdatestoenticefanstobournepark-exclusive 2 10107 0 0 /news/corinthian080419 4 18662 0 0 /news/lovellunveilstriplesignings 1 3844 0 0 /news/playersneedtocareaboutplayingfordoversayschriskinnear 2 7522 0 0 /news/551a9cf57e6be 2 8146 0 0 /news/551bc5db42f7f 2 6318 0 0 /news/balhcray090518 11 43642 5 4 /news/drmartens/premier/dover/17thnov03.html 1 0 0 0 /news/maidstone190205.html 1 0 0 0 /news/sceflstatement230720 6 20377 0 0 /news/ashfordtown0croydonathletic1-cumberbatchwerefocusedtomakesurewestayupexclusive 1 6071 0 0 /news/4thoct04.html 2 0 0 0 /news/rusthall070416 3 12303 0 0 /news/ashfordtownsearchfornewreserveteammanagerandphysio 5 14552 0 0 /news/walthamforest270905.html 2 0 0 0 /news/ramsgate050205.html 1 0 0 0 /news/craywanderers3-2waltonhersham-jenkinsrelishingreunionwithabbott 2 9630 0 0 /news/551a96db75893 2 7037 0 0 /news/tommysampsonlaunchessuddenexitbook 2 6875 0 0 /news/drmartens/eastern/sittingbourne/dartford240804.html 1 0 0 0 /news/racistattacks210919 3 16622 0 0 /news/icannolongercommittotherigoursofplayingforramsgateintherymanleaguesaysliamquinn 1 3254 0 0 /news/wellgiveitourbestshotaswealwaysdosayssittingbournebossmattwyatt 3 13665 0 0 /news/lordswood030619 3 12153 0 0 /kent-county-league/12 2 8981 0 0 /news/theicingonthecakeistocomehopefullysayspromotionchasingdartfordbosstonyburman 1 4233 0 0 /news/soccershorts150116 4 36538 0 0 /news/wesfoderinghamisatopmanandanexcellentyoungprofessionalsayshaydenbird 1 3981 0 0 /news/hytheheroestakethebullbythehornsandbecomefacuplegends 1 6410 0 1 /news/28thdec04.html 1 0 0 0 /news/ebbsfleetunited2-1staffordrangers-daishpraisesenergyshownbyhisten-men 1 7047 0 0 /news/551bc5e5834e3 2 9588 0 0 /news/givemechancesandiwillscoreinsistspinnock 1 4168 0 0 /news/sevenoaks241116 2 8066 0 0 /news/itwouldbegoodtostartestablishingourselvesinthefatrophysaysgavinrose 5 21621 0 0 /news/soccershortswehavetobeatourverybesttostunebbsfleetinfacupsayshythebosstimdixon 3 45752 0 0 /news/drmartens/eastern/folkestone/harrow280804.html 1 0 0 0 /news/punjab091020 5 22132 1 1 /news/bromley150718 3 11883 0 0 /assets/uploads/content/Neil_Smith_celebrates_FA_Cup_win%20-%20Copy%202.html 1 44640 0 0 /news/weneedtoputteamstotheswordsaysfleetbossliamdaish 1 4819 0 0 /news/pressrelease 2 7736 0 0 /news/bromley160217 4 15503 0 1 /news/hernebay010718 3 10350 0 0 /news/551bc5df6bea6 3 14867 0 0 /news/ramsgate180915 4 14829 0 0 /news/maidstoneunited0-1croydonathletic-andyfordquitsasmaidstoneunitedboss 1 5634 0 0 /news/25thmay05.html 2 0 0 0 /news/thambren030215 4 29457 0 0 /news/dolbyrelishingdonstrophytussle-exclusiveinterview 1 3520 0 0 /news/ksports220319 4 14997 0 0 /news/humepreparesforhendonbacklash 2 8038 0 1 /news/defenderlloydhasnocommoncourtesyfumesseager 1 3483 1 0 /news/soccershorts010820 3 14183 0 0 /news/afccroydonathletic260720 3 9672 0 0 /news/kentleague/lordswood/deal161004.html 1 0 0 0 /news/551bc5dea7213 1 3463 0 0 /news/pitchwillbeabogmundaywarned 1 3203 0 0 /news/thesquadicurrentlyhaveisthebestsquadihavemanagedsinceijoinedramsgatesaysjimward 1 4003 0 0 /news/kentleague/hernebay/greenwich140804.html 1 0 0 0 /news/551bc5df2dd0d 1 4743 0 0 /news/kentleague/sladegreen/deal061104.html 1 0 0 0 /news/ourbouncebackabilityisasignofourunityandbeliefsaysdoverathleticbossnickyforster 1 3771 0 0 /news/551bc5e196150 2 10634 0 0 /news/craywands250118 1 4584 0 0 /news/longhurstreshuffleshispackforredhilltie 2 8884 0 0 /news/marlonpattersonsharesourambitionsaysbromleyassistanthaydenbird 2 10432 0 0 /news/sceflstatement050121 4 21637 1 1 /news/warrilowplanningspendingspree-exclusive 1 5511 0 0 /news/wewillnotusetheweatherbreakasanexcusesayshernebaybosssamdenly 1 3608 0 0 /news/ramsgate051020 3 12905 0 0 /news/kentleague/ramsgate/15thjuly03.html 2 0 0 0 /news/551a9c9188acb 1 3698 0 0 /news/newpvfolk060304.html 2 0 0 0 /news/ksports030317 4 14860 0 1 /news/HythHast010115 4 37990 0 0 /news/551a9c0f2972b 1 3893 0 0 /news/youcantblamethemforleavingadmitsgibbons 2 7365 0 0 /news/dartfordexplainwhytheyhavescrappedreserveside 1 3515 0 0 /news/stansfeld100919 3 9601 0 1 /news/cugleyintalkswithtwoformerinvictamen 2 22071 0 1 /news/suttonunited220416 3 13956 0 0 /assets/ckeditor/plugins/wsc/ 5 1946 0 0 /news/crowborough190218 2 7802 0 0 /news/551bc5e12e4e7 1 5215 0 0 /news/luckhasntgoneforusthisyearadmitshollandsblairbosspaulpiggott 1 4699 0 0 /news/folkestoneinvicta1hamptonrichmondborough2 2 9402 0 0 /news/551a96dc134c9 3 14517 0 0 /news/18thfeb05.html 1 0 0 0 /news/whitstablepreparedfornewcampaignsaysseager 1 3571 0 0 /news/ivegotatoughawaygametostartoffwithsaysreturningsittingbournebossnickdavis 3 11723 0 0 /news/aslongasweputingoodperformanceswellwinmoregamesthanwelllosesaysvickersboss 1 3957 0 0 /news/itsnicetobeunderdogsittakesabitofpressureofftheboyssaysjaysaunders 3 14497 0 0 /news/wellingcorne051215 3 11943 0 0 /news/craywanderers0-2leytonorient-werehopingtoextendourbudgettosignplayerssaysfrancis 2 13756 1 1 /assets/ckeditor/plugins/youtube/lang/ 1 514 0 0 /news/kentleague/thamesmead/23rdjuly03.html 2 0 0 0 /news/sevtun101017 2 25130 0 0 /news/ashfordsambitionsmatchminesayslovell-exclusive 2 11436 0 1 /news/551a96dc4c6fc 3 14241 0 0 /news/iwantustoplayforthingsandnotmakethenumbersupsaystonbridgeangelsbosstommywarrilow 3 12565 0 0 /news/wellgotherewiththerightattitudeandworkoursocksoffsaystommywarrilow 2 8494 0 0 /news/beck220703.html 1 0 0 0 /news/margate010719 3 9675 0 0 /news/daviespleasedwithlifeatlingfield 1 4058 0 0 /news/27thjune04.html 2 0 0 0 /assets/fileman/lang/ 8 3781 0 0 /news/lifesabeechfornewangelsstopper 1 3928 0 0 /news/sheppey050517 2 8481 0 0 /news/drmartens/eastern/tonbridge/16thfeb04.html 1 0 0 0 /news/wellingtown010218 2 7608 0 0 /news/craywanderers2-1sittingbourne 2 9104 0 0 /news/wearecurrentlyinbudgetdiscussionsfornextyearsayssittingbournebossnickdavis 3 11796 0 0 /archive-2006-2014/117 1 5033 0 0 /news/551bc5e08ee57 1 5590 0 0 /news/keithmcmahonkeepselevenofhismeadfamilytogether 5 19925 0 0 /news/551a97b1a70f9 1 4298 0 0 /news/wealwayssaidwewontstandinanyoneswayofprogressingsayssittingbournebossnickdavis 2 7718 0 0 /news/beckenhamtown0sladegreen0 2 8526 0 0 /news/gov.uk/government/news/small-businesses-boosted-by-bounce-back-loans 2 0 0 0 /news/ivetakensittingbourneasfarasipossiblycouldsaysmattwyatt 3 14839 0 0 /news/theweekahead-7 1 3616 0 0 /news/sevenoaks070719 3 11946 0 0 /news/rustsnod170816 4 37128 0 0 /news/ramsgate050117 1 5211 0 0 /news/doverathletic260519 4 14381 0 0 /news/pre-seasontraininghasbeengoingwellsayscrayvalleybossstevechapman 1 3920 0 0 /news/soccershorts110518 4 29313 0 0 /news/FACupDraws030820 3 12458 0 0 /news/halls290516 2 8178 0 0 /news/folkestone220416 4 16257 0 0 /news/inhindsightimdisappointednottohavesixpointssayselthampalacebossterrynaden 2 10638 1 1 /news/eastvfolk210404.html 2 0 0 0 /news/bridcori201119 5 43967 0 1 /news/beckenhamtown2-1lewishamborough-werestrugglingabitupfrontadmitsjasonhuntley 2 14691 0 0 /news/551bc5e2380f5 1 3529 0 0 /news/folkvhist030204.html 2 0 0 0 /national-league/4 5 37424 1 1 /news/itsimportantjustliketheolympicgamesour130thbirthdayleavesalegacysayschathamchairman 1 3763 0 0 /news/tunbridgewells1-3rusthall-itmeansalottotheladssaysrusthallbosspaulmcdonagh 2 17111 0 1 /news/maidstone190305.html 1 0 0 0 /news/metpolice070106.html 1 0 0 0 /news/kentleague/whitstable/23rdjune03.html 2 0 0 0 /news/551a9250a4cdd 2 6344 0 0 /news/chathamtown170119 4 14401 0 1 /news/craywands170317 1 3756 0 0 /news/brombore101115 3 23112 0 0 /news/littlereturnstohisspiritualhomesladegreen 1 3655 0 0 /news/mckimmihavetheheartanddesiretobemargatesnextboss 1 3385 0 0 /news/weneedmorestrengthindepthsayswalker 2 7939 0 0 /news/ryman/24thjune03.html 2 0 0 0 /news/drmartens/eastern/dartford/erith231004.html 1 0 0 0 /news/551bc99b78194 1 3357 0 0 /news/hernebay1-2erithbelvedere-weveshotourselvesinthefootsayssimonhalsey 1 8060 0 0 /news/dartford2-0tonbridgeangels-iamfocusedtobringpromotiontodartford-burman 2 15527 0 0 /news/ramsreadytoupsetmuch-fanciedtrio 2 8300 0 0 /news/551a967809934 1 4753 0 0 /news/othernews/SECWFL250104.html 1 0 0 0 /news/doverathletic2-3cambridgecity-hessenthalervowstobouncebackfromtrophyexit 1 5404 0 0 /news/gillsatwembleyletsmakeitadaytoremember-fuller 2 7787 0 0 /news/angelsreservesreachsecondcupfinalascasualssurrendertie 1 3452 0 0 /news/holmesdale020518 5 16395 0 0 /news/551a96db8ce5e 1 3569 0 0 /news/barrbrom180120 3 30390 0 0 /news/551a9677ab156 1 3863 0 0 /news/bromhava310115 5 77908 2 2 /news/hythehaveplentyinreserveexclusive 3 13547 0 0 /news/sittingbourne040120 3 16219 0 0 /news/resultsaugustseptember2007 1 7368 0 0 /news/551a979877ebf 1 3402 0 0 /news/theresnopressureonmeormyplayerstogoupsaysneilcugley 1 4100 0 0 /news/28thoct04.html 1 0 0 0 /news/burmandelightedwithbarnescapture 1 3406 0 0 /news/551a9c9154f73 4 14534 0 0 /news/bromley030920 3 12719 0 0 /news/551a96778e771 1 4204 0 0 /news/drmartens/eastern/sittingbourne/KLvsitt210204.html 1 0 0 0 /news/21stjuly04A.html 2 0 0 0 /news/ebbsfleetunited3-1ramsgate-wevegotsomegoodtalentcomingthroughsayskimble 1 6688 0 0 /archive-2006-2014/3 6 30098 0 0 /news/551a9c0ed57a4 3 12543 0 0 /news/thefleetatwembleywinningistheonlythingonourmindssayskimble-exclusive 1 5043 0 0 /news/greenwich221215 12 133193 7 8 /news/551a9c0e5beaa 1 3151 0 0 /news/sevenorp181115 5 95924 2 2 /news/whitespitch-intogettheirhomegamesplayed 2 10558 0 0 /news/kentrivalslockhornstosealconferencereturn 4 18389 0 0 /news/favouritegames180320 3 12707 0 0 /news/551a99e39b626 1 4207 0 0 /news/551a96dbb5ebd 1 3676 0 0 /news/weworkedreallyhardtotrytokeepdaneasonattheclubsayshernebaychairmantrevorkennett 2 7232 0 0 /news/sctelt260816 3 30585 0 0 /assets/select2/LICENSE.md 1 1124 0 0 /news/18thaug03.html 1 0 0 0 /news/newlyappointedsierraleonacoachroseniorselectsbromleystar 1 3050 0 0 /news/551bc99ce0b69 1 4196 0 0 /news/brommaid100218 4 44630 0 0 /news/resultsnovember2017 5 53441 0 0 /news/welling260116 4 15893 0 0 /news/dulwichhamletfansmeetthelandlordstodiscussclubsfuture 1 4013 0 0 /news/FAStatement311220 3 9591 0 0 /news/gravesend010205.html 2 0 0 0 /news/3rdfeb04.html 2 0 0 0 /news/hythe231004.html 1 0 0 0 /news/chatcori040519 5 58055 0 0 /news/tunbridgewells2-1sevenoakstown-wewantedtoputtherecordstraight-larkin 1 7588 0 0 /news/vcdathletic280320 2 8116 0 0 /news/lewrams061116 1 9662 0 0 /news/maidstoneunited0-1tonbridgeangels-angelsstoptherotwithsmash-and-grabvictory 2 10563 0 0 /news/tonbridge230218 1 3838 0 0 /news/beckenham020420 3 15263 0 0 /news/551a92502acab 5 29974 1 1 /news/franciswantstoavoiddefeatathigh-flyinghastings 1 3732 0 0 /news/551a9718d6d9b 4 14537 0 0 /news/suttonathleticgiventhegreenlighttodeveloptheirlowerroadground 3 10524 0 0 /news/fleethoppingmadwith10-cardtrickofficial 1 5652 0 0 /news/itsobviousweneedtoimproveasateamsayshythetownbosstimdixon 3 12199 0 0 /news/soccershortsdagenhamredbridgesnapupformerangelsdefendernathangreen 4 28530 0 0 /news/fcelmstead130815 3 14235 0 0 /bromley-2003-2006/7 3 9090 0 0 /news/ramsgatepartcompanywithtimdixonafterbeatingtootingmitcham 1 3689 0 0 /news/551a97b0e1952 3 15069 0 0 /news/professionalperformanceputsdartfordwithintouchingdistance 1 4098 0 0 /news/kentleague/tunbridgewells/lordswoodu18050904.html 1 0 0 0 /news/craysudb151215 4 37196 0 0 /news/KentFA060820 3 10397 0 0 /news/illhavenoproblempickingtheplayersupoffthefloorsaysebbsfleetunitedbossstevebrown 3 12782 0 0 /news/wevegotourhouseinorderadmitsramsgatebossjimward 2 7486 0 0 /news/wellingunitedbossjamiedaylooksforwardtocharltonathleticvisit 4 13557 0 0 /news/551a99e42dc0a 1 3473 0 0 /news/sheppey310818 1 3767 0 0 /news/551a97999df1e 2 8742 0 0 /news/drmartens/eastern/sittingbourne/hastvsitt201203.html 1 0 0 0 /news/Margatebrownpos110515 4 24158 0 0 /news/hopefullypeoplearestartingtohearofussaysbridonropesmanagerbenkotey 1 6001 0 0 /assets/select2/package.json 1 1430 0 0 /news/horsham0-3tonbridgeangels-warrilowbringontheleagueleaders 3 32518 1 2 /news/dartfordbosstonyburmanreleasesfourplayersfollowingtheirtop-eightfinish 2 7368 0 0 /news/crayvpaghamfac310803.html 1 0 0 0 /news/fleetladiesbolstertheirsquadaheadofcanariesopener 1 3867 0 0 /news/corinthian251218 4 17813 0 1 /news/beckenhamtown4sladegreen0 2 8592 0 0 /news/fordhitsbackatstonescriticism 3 10361 0 0 /national-league/11 5 41158 1 1 /news/saliashf200216 8 159169 3 4 /news/itsdisappointingforeveryonewhoputtheeffortinsayshernebaybosssimonhalsey 1 4987 0 0 /news/facupspecialdoverbossmartinhayestellhissidetogiveitagoandhavenoregrets 1 5938 0 0 /news/dover181005.html 1 0 0 0 /news/tonbridgeangels1-2folkestoneinvicta 1 6349 0 0 /news/lordswood3-0southendmanor-everyoneisbuzzingaroundtheplacesaysjasonlillis 5 50049 2 2 /news/551a956ce6657 1 7597 0 0 /news/gleblydd310117 4 44092 1 0 /news/NationalLeague250320 2 6970 0 0 /news/551a9c92210cb 2 6584 0 0 /news/burnham0tonbridgeangels1-leighwantshisplayerstopushforfirstteamplaces-exclusive 1 5733 0 0 /news/551a956c8b28d 1 3931 0 0 /news/leyton240804.html 2 0 0 0 /news/thesignofagoodsideishowmanypointsyoutakeagainstsidesbelowyousaystonyburman 3 12070 0 0 /news/htyhe220118 3 12642 0 0 /news/chelmsford200805.html 1 0 0 0 /news/soccershortswhitstableplayersoffertopayfansadmissionafterunacceptableawaydisplay 3 21969 1 1 /news/afcwimbledon2-0doverathletic-doverruetheirmissedopportunity 1 7145 0 0 /news/551a97b1953c1 1 4387 0 0 /news/kentleague/cray/leatherhead170804.html 1 0 0 0 /news/thamesmeadtown2-0tunbridgewellsmcmahonwereoneofthreetowinleaguetitle-exclusive 1 5674 0 0 /news/kentleague/beckenham/7thjuly03.html 2 0 0 0 /news/551a97b28f663 1 4394 0 0 /news/lastchancetopurchaseprincesparktickets-davemartintrainswithleagueclub 2 10440 0 0 /news/kentleague/deal/7thjuly03.html 2 0 0 0 /news/gloverrejectsbromleymovetostayatashfordtown 1 3149 0 0 /slade-green-2003-2006/4 3 8608 0 0 /news/hythtilb150717 1 7943 0 0 /assets/select2/tests/ 8 3610 0 0 /slade-green-2003-2006 12 36337 0 0 /news/faversham260620 3 12055 0 0 /news/langton070116 4 15278 0 0 /news/folkestone230916 3 24434 1 1 /news/tonbridge010916 2 7548 0 0 /news/wellseehowgoodgreenwichboroughareonaugust9thsaysphoenixsportsbosstonybeckingham 4 19614 0 0 /news/gravesham071117 3 9846 0 0 /news/statattackrickyfreemanleadsthegoalscoringtablewith22goals 1 5442 0 0 /news/wandsgaveusfootballlessonadmitscordice 4 16884 0 0 /news/burmandelightedwithcasscapture 2 5492 0 0 /news/croydonexplaintompkinsdeparture 2 7590 0 0 /archive-2006-2014/191 4 17770 0 0 /news/doverathletic2-0aldershottown-adambirchallsendsdoverathleticintofacupthirdround 1 6777 0 0 /news/551a925006ece 1 3757 0 0 /news/wellbelookingtofinishtheseasonstroglysayssittingbournemanagerjoedowley 1 4440 0 0 /news/craywort131116 1 9420 0 0 /news/craycroy070218 2 21890 0 0 /news/551a99e55fbf6 1 7236 0 0 /news/folkestone181119 3 11063 0 0 /news/lordswood180119 4 16641 0 0 /news/kerrifeltsorryforthebanburygoalkeeper-exclusiveinterviews 1 6084 0 0 /news/afcwimbledonarefavouritestolandtitleadmitsramsgateboss-exclusiveinterview 1 4614 0 0 /news/folkwalt250316 6 53996 0 0 /news/551a99e502b0d 3 40772 1 1 /news/sevenoakstown1-4dartford 2 24811 0 1 /news/ihaveeverythingittakestomakeasuccessofitsayssimonaustin 5 19085 0 0 /news/hessenthalerruescupshowdownwithkentrivals 1 5635 0 0 /news/thechallengenowistoproducethenecessarilyfundingtomaintaintheclubsstatus-moules 2 7336 0 0 /news/glebedeal220817 1 10671 0 0 /assets/images/icons/Thumbs.db 1 949248 0 0 /news/brombarn040919 4 36378 0 0 /news/vickersmanagementteamjoinfoleyatchathamtown 2 10327 0 0 /news/dartfordryanhayes130518 4 14902 1 0 /news/wemustraisethebarsayspromotionchasingfrancis 1 4361 0 0 /news/eastdart140418 4 33001 0 0 /news/551bc5da16796 2 9900 0 0 /news/ashfordtown2-1metropolitanpolice 2 12342 1 0 /news/25thapr05.html 2 0 0 0 /news/togetsuchaflatrefusalwasremarkableadmitscraywanderersassistantjoefrancis 1 6196 0 0 /news/551a956c4f813 2 6112 0 0 /news/metpolice290305.html 1 0 0 0 /news/drmartens/eastern/erith&belvedere/8thaug04.html 1 0 0 0 /news/551bc5e37fceb 1 4350 0 0 /news/wehavetotrytosavetheclubfromrelegationsayskeithbird 1 4965 0 0 /news/burmanfacesaraceagainsttimetoattendfacuptie-exclusiveinterviews 4 20548 0 0 /news/croygreen200116 4 11605 0 0 /news/551a96dc1f5f6 4 18150 1 0 /news/yourchancetoplayforashfordtown 2 5698 0 0 /news/glebe131219 2 6878 0 0 /news/notmanypeoplearegivingusachanceoutsidedartfordsaystonyburman 3 15682 0 0 /news/illcertainlybemakingabigchargefortheleaguenextyearsaysmickyhazard 4 19776 0 0 /news/corinthian270220 2 11714 0 0 /news/551a97b11bb79 1 4162 0 0 /news/kentleague/VCD/vcd.html 1 0 0 0 /news/ramsplaylocalsideforten-year-oldroadaccidentvictim 3 9271 0 0 /news/keepingussafefromrelegationisthemainaimthisyearsaysfisherbossdeanharrison 4 15872 0 0 /news/bromley020819 3 12689 0 0 /news/margate301116 3 14772 0 0 /news/wejustwanttobecompetingagainlikewedidlastyearsaysbromleybossmarkgoldberg 3 12870 0 0 /news/rymanleague140117 1 3813 0 0 /news/afccroydonathletic170920 4 14671 0 0 /news/drmartens/premier/welling/13thjuly03.html 2 0 0 0 /news/beaconsfieldsycob1-3greenwichborough-theyunderestimatedusandwewillgetbettersaysblade 3 27227 0 0 /news/drmartens/premier/dover/10thnov04.html 1 0 0 0 /news/lordswood111204.html 2 0 0 0 /news/glebwhyt010920 4 44428 0 0 /news/folkestone110805.html 1 0 0 0 /news/mundaythreatenstheaxeashetargetstwonewplayers 1 4735 0 0 /news/beckenhamsufferingfrompitchdisease 2 5808 0 0 /news/iwanttomaintainthemomentumwevehadinthelastcoupleofseasons-favershambossrayturner 1 3575 0 0 /news/holmesdale091020 3 11537 0 0 /news/exgillsaundersenticeshowelltofolkestone 1 4733 0 0 /news/kentyouth/03-04teams.html 2 0 0 0 /news/thamesmeadtownbosskeithmcmahonunveilsmarklaneasgoalkeepercoach 1 3740 0 0 /news/bravestonesfansraisemorefundsforgroundfund 1 4015 1 0 /news/withfinancialbackingcrockenhillcoulddowellsayswilliams 1 4048 0 0 /news/seagerasksforpositivityforwhitstablesmake-or-breakweek 1 4698 0 0 /news/551bc5dd6b7a4 2 7484 0 0 /news/551bc5db52fb1 4 18461 0 0 /news/floodlightingdelaysareholdingusbacksaysholmesdalesecretary-exclusiveinterview 2 9538 0 0 /news/cambridge261105.html 2 0 0 0 /news/551a931e122c6 1 3021 0 0 /news/551bc5e78981d 2 10096 0 0 /news/thetitleraceisnotoverinsistshessenthaler 1 4356 0 0 /news/wecangetsuccessiftheteamstaystogetherinsistsoconnell 2 8303 0 0 /news/doverathletic280320 2 8902 0 0 /news/craygree070419 4 50618 0 0 /news/drmartens/eastern/ashford/8thoct04.html 1 0 0 0 /news/canterbury270817 2 7010 0 0 /news/greenwich281217 1 3672 0 0 /news/vcdathletic0-1gillingham-imgotthebestsquadinsistsfoley-exclusive 2 26983 1 1 /news/stonesapplyforstadiumgrant 1 3434 0 0 /news/ourmaintargetisatopfourfinishsayskentfootballunitedbosssammacneil 1 4237 0 0 /news/dartford121017 1 4358 0 0 /news/thirdcountycupsuccessmeantalottowakeling-exclusiveinterview 1 4648 0 0 /news/welling080416 4 14030 0 0 /news/kentleague/lordswood/15thaug04.html 1 0 0 0 /news/kentleague/tunbridgewells/pagham040904.html 1 0 0 0 /news/heaslewoodweneedtobelieveinourselves-exclusiveinterview 3 13891 0 0 /news/itwillbeagreatopenertotheseasonanticipateshernebaybosssimonhalsey 2 10829 0 0 /news/robcurtis070719 4 17777 0 0 /news/kingstonian100905.html 1 0 0 0 /news/ourenforcedlay-offhascausedproblemsinmanyareassaysdoverathleticbossnickyforster 1 3825 0 0 /archive-2006-2014/247 3 13025 0 0 /news/ramsgate311219 7 28814 0 1 /news/wehaveaspirationstomoveoninthefacupsayschathamtownbosskevinwatson 1 3818 0 1 /news/wellingtown240520 5 26702 0 0 /news/imonlygoingtosettleforfirstplacenextseasonvowslovell-exclusive 2 10115 0 0 /news/hendon3-0maidstoneunited-welackeddesireandweleteveryonedownfumesnott 2 13405 0 0 /news/551a99e4ac81e 3 16053 0 0 /news/uxbridge030105.html 1 0 0 0 /news/hendfolk270118 1 9924 0 0 /news/dagenham291219 4 14040 0 0 /news/seagerrelishestheunderdogtag-exclusive 3 15004 0 0 /news/dovershowinterestinstrikerdimmock 2 19527 2 1 /news/551a99e341f32 3 14625 0 0 /news/ramscupheroesmyplayersstooduptotheplatesaysproudward-exclusive 1 4492 0 0 /assets/select2/tests/utils/decorator.html 1 241 0 0 /assets/pdf/ 5 1543 0 0 /news/bromleians080620 4 19184 0 0 /news/invictastrikerjonestogoundertheknife 4 22153 0 0 /news/oneswallowdontmakeasummersaysdaish 2 8418 0 1 /news/dockersbossoboyleofferstrialistsafleetingchance 1 3661 0 0 /news/wevegotourfeetonthefloorsayscrayvalleybossstevechapman 2 11114 0 0 /news/angelsputpoorepsomewellsideintheshade 4 13052 0 0 /news/preseason2016 4 32091 0 0 /news/nationwide/gillingham/10thjuly03.html 2 0 0 0 /news/windsor031205.html 2 0 0 0 /news/metpolice030504.html 1 0 0 0 /news/wellkeepoutfeetonthegroundsaystable-toppinghessenthaler 1 3369 0 0 /news/kentleague/sladegreen/abingdon231004.html 1 0 0 0 /news/fisher281016 1 4153 0 0 /news/wellholdourowninnewleaguesaysmartin-exclusive 1 4386 0 0 /news/bealeshasgivenusaselectionheadacheadmitsimpressedsawyer 3 41640 2 2 /news/lewestonb300915 5 59338 1 1 /news/fisherinvitesupportersforsix-monthprogressreport 1 3478 0 0 /news/longhurstbringssevennewplayerstosladegreen 1 3321 0 0 /news/551bc5e2d9176 1 3406 0 0 /archive-2006-2014/145 3 14014 0 0 /news/hernebayL260416 4 13061 0 0 /news/itwouldbeanicelittlecatchtowinsomesilverwaresaysbridonropesmanagerdanielfrost 4 18806 0 0 /news/sheppey291217 2 7570 0 0 /news/551a931dddcb9 1 3741 0 0 /news/lewes0-0bromley-theresnowayweshouldbegoinghomedrawingblankssaysbird 1 6803 0 0 /news/kentreliancesponsorkentseniorcupwithprizemoneyupforgrabsforfinalists 3 12879 0 0 /news/whoeverwantstostandinfrontofmeiwanttobeatthemsayssittingbournejoint-bossjimward 2 9206 0 0 /news/551bc5dd09e8f 1 4137 0 0 /news/croydon1-1erithtowncroydonwon3-1onpenalties-weshouldvewonbymore-beckingham 1 7331 0 0 /news/humevowstobethesidethatturnsdoveroveratfortresscrabble 2 9065 0 1 /news/maidstoneunited1-0suttonunited-spotonselleykeepshiscool 1 5038 0 0 /news/tonbridgeangels1-2doverathletic-warrilowblastsrefashissidelosecontroversialbattle 2 15232 0 0 /news/ebbsfleetunitedopentheirgatesfortrophytie 1 3243 0 0 /news/phoenixsports110119 3 13002 0 0 /news/weneedthecrowdstoreturntoseeourpushforthetitlesaysdoverchairman 2 7434 0 0 /news/lovellexpectingtotakehalfadozentrialiststoramsgate 5 16724 0 0 /news/preseason2020 3 22703 0 0 /news/wewanttofinishashighaswepossiblycansayshernebaybosssimonhalsey-1 2 8452 0 0 /news/canterbury080917 1 3603 0 0 /news/bearstedfc.co.uk 2 0 0 0 /news/dartford3-2leiston-burmancannotwaittoentertainportvaleinfacup 2 14838 0 0 /news/whyteleafe4-1beckenhamtown-everythingsgoingtoplansayswhyteleafebossjohnfowler 2 18828 0 0 /news/kentleague/deal/Sampson10.html 1 0 0 0 /news/551bc5ddc1a9c 1 4030 0 0 /news/wereadecentsideandweneedtobewinninggamessaystunbridgewellsbossmartinlarkin 1 3892 0 0 /news/24thmay05.html 2 0 0 0 /news/stoneswelcomemanagerlessfishforfacupclash 1 3771 0 0 /isthmian-league/6 6 41854 1 1 /isthmian-league/44 5 23716 0 0 /assets/ckeditor/plugins/specialchar/dialogs/ 1 390 0 0 /news/drmartens/eastern/erith&belvedere/harlow271104.html 1 0 0 0 /news/551a931e38fb2 1 3357 0 0 /news/551bc99aeec47 2 8278 0 0 /news/551a931dcc6b2 1 3817 0 0 /slade-green-2003-2006/2 2 6132 0 0 /news/erithbelvedere2-0sittingbourne-deresstunoverconfidentbrickies 2 9277 0 0 /news/kentleague/cray/crayvtham291003.html 1 0 0 0 /news/drmartens/eastern/sittingbourne/maldon041204.html 1 0 0 0 /news/dartford2-0mansfieldtown-werethirdonmeritsaysprouddartfordbosstonyburman 3 23914 0 1 /news/craywanderers0-0arleseytown-theirmindswillbeoncoventrysayspaulblade 3 21290 0 0 /news/sheppey100119 4 16906 0 0 /news/rebornsupportersclubissuerallyingcryletshelpashfordtowninapositivemanner 5 26534 0 1 /news/wehavetomakesurewestayinthisleaguesaysblade 2 10577 0 0 /news/hollands280716 2 9253 0 0 /news/folkestoneinvictastatement161220 2 6233 0 1 /news/charlieslocombe240719 3 10696 0 0 /news/absentmilesconfidentofpickingupholidaypoints 2 7757 0 0 /news/klpdcupfinalpreview050504A.html 2 0 0 0 /news/folkvstam221103.html 2 0 0 0 /news/551bc5e496bc4 1 3076 0 0 /news/551bc5e5488ea 2 9034 0 0 /news/wedonthavetherightinfrastructureinplaceforrymanfootballsayssevenoakschief-exclusive 2 11103 0 0 /news/fiskno-oneishappywithourleaguepositionexclusive 3 10325 0 0 /news/drmartens/eastern/folkestone/hastvfolklgecup281003.html 1 0 0 0 /news/hernebay280419 4 15513 0 0 /news/millwallstatement061220 7 24543 1 3 /news/dealtownfc.co.uk 2 0 0 0 /news/fisher1-3tunbridgewells-itwasjustareallygoodawayperformancesaysmartinlarkin 5 50455 1 1 /news/bromley240517 1 4205 0 0 /news/famentalhealthcampaign150519 3 12827 1 0 /news/deresappointnewbackroomstaff 2 5686 0 0 /news/drmartens/eastern/ashford/29thnov04.html 1 0 0 0 /assets/smartmenus/demo/bootstrap-navbar-static-top.html 1 2547 0 0 /news/sladevseven090304.html 2 0 0 0 /news/crowborough120618 2 7374 0 0 /news/551bc5e845c8f 1 3153 0 0 /news/dulwichhamlet2-4ramsgate-zackthomasisanametoberememberedsaysjimward 2 33229 1 1 /news/kentleague/deal/FAV3rewview121204.html 1 0 0 0 /news/soccershortsmanagerstakestockoftheirearlypre-seasonfriendlies 1 4729 0 0 /news/trottwearetreatingwhitstablewithrespect-exclusive 3 12512 0 0 /news/fisher230917 3 10497 0 0 /news/wewanttowinasmanygamesaswecanandclimbupthetablesaysbeckenhamschrishiscock 4 16892 0 0 /news/551bc5de1337b 1 3716 0 0 /assets/images/signpad/ 6 2292 0 0 /news/folkestone110820 4 13692 0 0 /news/kentleague/deal/Samspon11.html 1 0 0 0 /news/wemustplaybettertoprogressinfacupsaysgorman 2 8436 0 0 /news/tonbridge100619 4 14466 0 0 /news/551a99e4796d4 1 3860 0 0 /news/ifweplaytoourfullpotentialthenwevegotachanceofwinningsaysblairbosspaulpiggott 1 4942 0 0 /news/imtryingtoassembleasquadcapableofgettingpromotednextseasonsaysjaysaunders 1 4244 0 0 /news/facupspecialthisisgoingtobeouryearsaysexcitedwalker 1 5359 0 0 /news/wereamatchforanybodyinsistsbaldacchino-exclusive 1 4092 0 1 /news/theboardbackme100insiststhamesmeadbosskeithmcmahon 1 4522 0 0 /news/sutton020218 3 11769 0 0 /news/cugleywelcomesbacktrio 3 17303 0 0 /news/drmartens/premier/dover/25thaug04.html 1 0 0 0 /news/tonbridgeangels5corinthiancasuals1-exclusiveinterview 5 71395 4 4 /news/humelookstogetdefeatoutofhissystem 1 4823 0 1 /news/15thmay05.html 2 0 0 0 /news/balham200520 3 10216 0 0 /news/551bc5e05c171 3 17207 0 0 /news/crow111215 3 11967 0 0 /news/thefootballfoundationhavebeenfantasticforusovertheyearssayswoodstockchiefmauricedunk 3 11519 0 1 /news/mattjohnsonisjoiningusfortherightreasonssaysdoverathleticbossmartinhayes 1 4104 0 0 /news/margate300519 4 13086 0 0 /news/stonereturnstobromley 4 13682 0 0 /news/afchornchurch2-1tonbridgeangels-angelsjobwillgenerateplentyofinterest-exclusive 2 12562 0 0 /news/erithandbelvedere080105.html 2 0 0 0 /news/551a956c3bb7e 4 19590 0 0 /news/eritwhit310118 2 20576 0 0 /news/wellingwellard051215 3 15396 0 0 /news/hessenthalertellsdrydentoshapeup 1 5290 0 0 /news/arnoldsagarumbleson 1 4919 0 0 /news/dartford050205.html 1 0 0 0 /archive-2006-2014/112 1 5012 0 0 /news/fleethanded15214ticketsforfatrophyfinal 2 8534 0 1 /news/ColinBoswell230520 5 21522 0 0 /news/kentleague/ramsgate/ramsgate.html 1 0 0 0 /assets/ckeditor/plugins/pagebreak/images/ 1 374 0 0 /news/craytilbury190415 6 93790 2 0 /news/afccroydonath271115 3 11631 0 0 /news/crayvalley011119 3 10910 0 0 /news/551bc5daba658 2 6044 0 0 /news/anythinglessthangettingpromotedwouldntbeasuccessfulseasonforussayssimonglover 4 16397 0 0 /news/knightreadyforthecalmbeforethestorm 2 11569 0 0 /news/551a95b453342 2 9345 0 0 /news/itwillbealonghardjourneyaheadsaysfcelmsteadbossfabiorossi 6 39614 0 0 /news/551bc99d0d720 2 20645 1 1 /news/drmartens/eastern/sittingbourne/sittingbourne.html 3 0 0 0 /news/wewillbothbeatthedropinsistswalker-exclusive 1 3837 0 0 /news/bromley070218 3 14358 0 0 /news/promotionisourobjectiveinsistshernebaychairman-exclusiveinterview 6 27866 0 0 /news/551a9718b3759 4 12705 0 0 /news/erithtownunveiloboyleastheirnewmanager 1 4174 0 0 /news/cupisnotourprioritysaystable-toppinghume-exclusiveinterview 1 4389 0 0 /news/merstham270805.html 2 0 0 0 /news/551a99e3af401 1 4163 0 0 /news/gillinghamplayfolkestoneinvictaformickydixsbenefitmatch 1 3544 1 0 /news/soccershortsplayingkentleaguefootballhastakenitstollonouryoungplayersadmitsdouglas 1 5309 0 0 /news/iamdeterminedtomakekentfootballunitedasuccessdespitethedoubterssayssammacneil 1 3710 0 0 /news/kentleague/ramsgate/whitstable041204.html 1 0 0 0 /news/greenwichboroughlookforwardtotheirhistoricday 1 3548 0 0 /news/beckenhamtown3-0erithtown-wejustwentthroughthemotionsadmitstonyrussell 1 8288 0 0 /news/551a967849335 1 4182 0 0 /news/bromleytitledolke220415 4 27041 0 0 /assets/smartmenus/LICENSE-MIT 1 1074 0 0 /news/brentwoodtown250720 4 14032 2 1 /news/hernebay130219 3 15786 0 0 /news/ryman/22ndjune03.html 2 0 0 0 /news/chatham041019 10 69332 7 6 /news/favershamaimingfortopfivefinish 5 34027 0 0 /assets/fileman/lang/pl.json 1 3642 0 0 /news/doverathleticsettounveilexcitingappointment 1 2975 0 0 /news/551a931dce714 3 12519 0 0 /news/551a99e4302ef 1 3543 0 0 /news/greenvslade281003.html 1 0 0 0 /news/backingthefleettowembleyglorydaishcallsuponthe12thman 2 8137 1 0 /news/dartford270217 4 14198 0 0 /news/waspsanslow260515 3 14083 0 0 /news/punjab110817 4 15730 0 0 /news/soccershorts110816 4 29270 1 0 /news/cumberbatchmakesquietexitfromashfordtown-exclusive 2 9864 0 0 /news/551a95b44a170 1 4155 0 0 /news/wemustcutoutourmistakessayslovell 2 9268 0 1 /news/551a9c0e7e260 3 14112 0 0 /news/margate290620 4 13686 0 1 /news/shepwhit080418 6 63494 2 2 /news/22stjune05.html 2 0 0 1 /news/binkspleasedwithgoalscoringform 2 8796 0 0 /news/faveeast091018 4 37532 0 0 /news/stainestown2folkestoneinvicta2sat29thapril2006 1 4103 0 0 /news/wellingtown150617 2 6874 0 0 /news/dulwichhamlethalf-priceboxingdayofferforfansofeaglesandlions 1 4192 0 0 /news/playerdidnttellushewascup-tiedadmitrams 1 3697 0 0 /news/margate061215 3 10176 0 0 /assets/images/third-party/ 7 2929 0 0 /news/kentleague/maidstone/maidstone.html 1 0 0 0 /news/beckenhamtown2-0corinthian-werenotgoingtosettheworldonfireadmitsrealisticsitford 2 12138 0 0 /news/warrilowstrikersmuststartdoingsomedamage 1 3790 0 0 /news/whitgraham080515 4 15466 0 0 /news/551a9797f391b 2 11454 0 0 /news/theresnoreasonwhywecantmaketheplay-offs-warrilow 2 9859 0 0 /news/wearesittingokintheleaguesayssittingbournebossnickdavis 3 12944 0 0 /news/wewanttoachievewhatwemissedoutonlastyear-promotionsaysdoverbossmartinhayes 2 7591 0 1 /news/ryman/bromley/westwickvbrom290204.html 1 0 0 0 /news/ramsgate040420 3 10210 1 0 /news/551bc99b53a2b 1 3978 0 0 /news/friendsre-unitedathayeslane 4 11094 0 0 /news/punjab060418 4 13842 0 0 /news/dealtown220319 4 13681 0 0 /news/folkcugley010515 4 20950 0 0 /news/daishaddsloan-signingtohissquad 2 5604 0 0 /news/thefavasefinal2013theresonlyonewaytoenjoyitbybringingthetrophyhomesaysbourne 2 14338 0 0 /news/margate260518 5 20767 0 0 /news/othernews/20thoct03.html 1 0 0 0 /news/weneedtotakeourchancessaysguest 1 4021 0 0 /news/maidstoneunited1-1eastbournetown-wegotwhatwedeservedadmitsjaysaunders 3 25841 1 1 /news/drmartens/eastern/sittingbourne/sittverit181103.html 1 0 0 0 /news/maidbrom260819 3 30010 0 0 /news/folkestone271017 2 7928 0 0 /news/fishcval090215 2 19624 0 0 /news/resurgentfolkestoneannouncedealwitheurotunnel 2 10096 0 0 /news/23thjan04.html 1 0 0 0 /news/conferencesouthisgoingtobeevenstrongerthisyearwarnstonbridgeangelsbosstommywarrilow 5 25905 0 0 /news/conference/margate/29thnov03.html 1 0 0 0 /news/coneyhallappointlong-servingallenasnewmanager 2 7099 0 0 /news/fleetvsitt100404.html 2 0 0 0 /assets/images/print/ 6 2280 0 0 /news/551bc5df195c3 3 14102 1 0 /news/margtonb030118 1 4112 0 0 /news/wardaimingtokeepramsinplay-offspots-exclusive 1 3654 0 0 /news/551a99e423692 1 3574 0 0 /news/waitisalmostoverforkentleagueclubs 5 14449 0 0 /news/thefestiveprogramme 3 14102 0 1 /news/massexoduswilladdspicetobattleofkentsaysdoverbossmartinhayes 2 12795 0 0 /southern-counties-east-football-league/13 4 20308 0 0 /news/ineedtosettledownandplanforlifeafterfootballsaysshanehuke 1 3533 0 0 /news/5thsept04.html 2 0 0 0 /news/hernebay280819 3 11145 0 0 /news/foleyrevealsaplayingbudgetcutof55 1 4788 0 0 /news/whitstabletown300720 2 6348 0 0 /news/551a96dc00a5f 1 4101 0 0 /news/barnet170320 4 16912 0 0 /news/kentleague/thamesmead/21stjuly04A.html 1 0 0 0 /news/sittingbourne021015 4 15017 0 0 /news/charltonathleticsealmovetobaylissavenue 1 4272 0 0 /news/hastings200905.html 2 0 0 0 /news/dealtown070116 7 50595 3 3 /news/551a9cf53dc56 2 17496 0 0 /news/bromley1leyton2 2 16892 0 0 /news/thamesmead020106.html 1 0 0 0 /news/551a97b12e9bb 1 6208 0 0 /news/everyonehasacleanslatetoimpressmeduringpre-seasonsaysseager 2 7187 0 0 /news/hernebay2-2fleettown 5 20719 0 0 /news/chathamtown1-2folkestoneinvicta-wecouldntrunabathatthemomentbemoansobrien 1 6507 0 0 /news/eastwell221019 3 26861 0 0 /news/Hernebay200805.html 1 0 0 0 /news/wellcertainlyhaveateamoutwhowillcertainlydousproudsaysramsgatebosstimdixon 2 9444 0 0 /news/hernebay250519 5 18916 0 0 /news/3rddec04.html 1 0 0 0 /news/551bc5da40d4b 2 8282 0 0 /news/tributesfloodinforerithbelvederestalwart 3 13795 0 0 /news/fisher291005.html 2 0 0 0 /archive-2006-2014/41 5 25254 0 0 /news/glebe210917 1 3651 0 0 /news/dartford3-1charltonathletic-letshaveanenjoyabledaylikewehadlastyearsaystonyburman 1 7175 1 0 /news/551bc99c05cd6 2 9616 0 0 /news/doverathleticunveilbirchallsigning 1 3439 0 0 /news/wecanonlyprogressbyreturninghomeinsistsfisherchairman 1 7073 0 0 /news/551bc5def03af 2 9030 0 0 /news/wellbetryingtowinbothofournexttwohomegamessaysfolkestoneinvictabossneilcugley 3 11447 0 0 /news/551a9c918b565 2 11328 0 0 /news/backingthefleettowembleyglorysupportusandwelldofleetfansproudsaysbarrett 2 8082 0 0 /news/bansteadathletic0-2phoenixsports-ithinkitwastooeasyforusattimessayssteveoboyle 5 43227 0 0 /news/eastbournetown1-0corinthian-itsamissedopportunityfortheclubadmitsmattlonghurst 4 35476 0 0 /news/whenbiggerclubscomeafterourplayersitisdifficulttoturnthemdownsaysjamieday 7 27477 1 0 /news/holmfarn240719 3 32042 0 0 /archive-2006-2014/12 2 9926 0 0 /news/fleetvfolk280204.html 2 0 0 0 /news/tonbridgeangels1-2stainestown-welackeddesireandprideadmitswarrilow 1 6474 0 0 /news/lordswood1-1whitstabletown-wefancyourchancesinreplaysaysmetcalf 2 28346 0 1 /news/clivewalkerreturnstochathamtown-1 1 3253 0 0 /news/thefavaseisamassiveopportunityforplayerstoputthemselvesinshopwindowsayspaulproctor 5 23641 0 0 /news/drmartens/eastern/fisher/28thaug03.html 2 0 0 0 /news/551a95b437fc8 2 9968 0 0 /news/551bc5e43520a 3 13916 0 0 /news/551bc99c6e5f2 1 6814 0 0 /news/ashfordunitedpulloffdoubletransfercoup 1 3738 0 0 /news/kentleague/sevenoaks/hernebay201104.html 1 0 0 0 /news/suttdeal300118 4 38870 0 0 /news/551a99e411be1 1 3194 0 0 /news/improudofmyachievementsonandofftheparkatorpingtonsaysformerbossseanglover 5 25121 1 1 /news/greenwich261020 3 11169 0 0 /news/favegree081217 1 3897 0 0 /news/udbergappointedbrickiesnumbertwo 6 20576 0 0 /news/imkeentogiveyouthachancesaysnewly-appointedrochesterunitedbossdarrenphillips 6 23305 0 0 /news/thamesmead090317 2 14280 0 0 /news/elmscray090719 3 30678 0 0 /news/wecanlastthedistancesaysmarathanmanianjenkins 1 4466 0 0 /news/551bc99c15842 1 5453 0 0 /news/margate070918 3 11859 0 0 /news/woking2-1doverathletic-wevegoteverychanceatourplaceinsistshessenthaler 1 6889 0 0 /dartford-2003-2006/4 3 9003 0 0 /news/glebe161017 2 6570 0 0 /news/551bc5de296fe 2 10600 0 0 /news/therefereewasrighttocallitoffsaysmargatebossiainoconnell 1 4169 0 0 /news/phoenixsports0-3vcdathletic-ouryoungstersaregoodenoughtocompetesaystonyrussell 5 50085 0 0 /news/gillinghamreleaseformerdoverathleticstrikeradambirchall 3 11127 0 0 /news/soccershorts080719 2 7790 0 0 /news/kentishdebatekentcupcompetitions 1 2785 0 0 /news/crawleytown1-2ebbsfleetunited-fleetlovehighly-ratedstrikerakinde 2 12882 0 0 /news/dartford181217 3 13056 0 0 /news/heromcpheehumbledbyfleetreturn 2 7064 0 0 /news/whitstable280815 4 13385 0 0 /news/othernews/2ndaug04.html 1 0 0 0 /news/ashfordtown1-3waltonhersham-wecantmakeanymooremistakessayslovell-exclusive 2 10490 0 0 /news/551bc5e51b985 2 8930 0 0 /news/peckhamambitions100415 7 39194 4 3 /news/551a9c0ea79c3 5 40435 1 1 /news/dartford1-0maidstoneunited-theclockistickingforbidsformcdonaldsaysburman 1 6887 0 0 /news/theboardhavebackedmebrilliantlytobringtomdavistotheclubsaystommywarrilow 1 5753 1 0 /news/summertransfernews 1 2994 0 0 /news/maldfolk131119 5 50065 0 0 /news/drmartens/eastern/sittingbourne/sittveastthurrockfac270903.html 1 0 0 0 /news/bromley0-0ebbsfleetunited-itsbeenagreatdaysaysbromleybossmarkgoldberg 1 9034 0 0 /news/hemelhempstead200520 5 18845 0 1 /news/551a967873562 3 16689 0 0 /news/bromcpal020816 5 77663 0 1 /news/ksports010218 4 13837 0 0 /news/weneedatrainingvenuetoimproveourplaysayshume 1 5091 0 0 /news/leatfolk081117 3 26788 0 0 /news/551a979979b92 2 9385 0 0 /news/holmesdale170120 3 12371 0 0 /news/30thjune04.html 3 0 0 0 /news/craywanderers1-0maidstoneunited-wandsconfirmkinchreleasefollowingwealdstoneshocker 1 6935 0 0 /news/4thmay05.html 1 0 0 0 /assets/ckeditor/skins/icy_orange/readme.md 1 2529 0 0 /news/burmanshowsstar-strikercassthedoor 1 4638 0 0 /news/kennington300819 3 10823 0 0 /news/kentleague/deal/1stjuly03.html 2 0 0 0 /news/wivenhoe271104.html 2 0 0 0 /news/551a9c0e3ff5d 1 5052 0 0 /news/551bc5e66c4d3 3 18068 1 0 /news/cugleywellpullthroughthistogether 2 8846 0 0 /news/551bc5e069aab 3 13553 0 0 /news/ramsgate111218 3 10233 0 0 /news/ramsgate201016 2 7874 0 0 /news/hythetown030220 3 12559 0 0 /news/abbebrom230419 3 26601 0 0 /news/sittingbourne050815 3 12534 0 0 /news/24thapr05.html 2 0 0 0 /news/everybodywillbethrowingmoneytowinthekentleaguenextseasonsaysfisherbossstevefirkins 1 4661 0 0 /news/cantlydn221016 1 9685 0 0 /news/bromdag170418 4 36818 0 0 /news/551a9718c1d28 1 3206 0 0 /news/othernews/charltonladies27thaug03.html 1 0 0 0 /news/playershavetoprovethattheirworthyofwearingtheshirtsaysstonesbossjaysaunders 1 4275 0 0 /news/theresnoreasontopanicsayshappy-go-luckyjenkins 1 4493 0 0 /news/erithtown140815 4 19117 0 0 /news/wellingtown040120 2 9500 0 0 /news/fisher010615 4 16918 0 0 /news/hallspor170519 2 18742 0 0 /news/chelmsfordareaclassabovewarnscugley 1 5786 0 0 /archive-2006-2014/215 2 9182 0 0 /news/kspoholm170719 6 61712 0 0 /news/sammywantsmooregoals 1 3763 0 0 /news/ashfordtownsettounveilnewhighprofilesponsor 6 19009 0 0 /news/551bc99bcde95 2 11708 0 0 /news/551a956c2abc1 1 4297 0 0 /news/werenotfiringonallcylindersandwecanstillplayalotbettersaystommywarrilow 5 27645 0 0 /news/facupspecialwallissitsoutwinnablecupreplay 1 4659 0 0 /news/miltonkeynesdons1-0doverathletic-ithinkwecouldvegotsomethingadmitschriskinnear 1 9212 0 0 /news/ishouldnthavebeenbeatenatmynearpostadmitsholmesdalekeeperdarrenibrahim 2 8565 0 0 /archive-2006-2014/208 2 9184 0 0 /news/forebrid050220 6 49603 0 0 /news/wellingunited2-1concordrangers-concordmadeitdifficultforusadmitsbarryashby 3 23374 0 0 /news/551a99e4d073c 4 35247 1 1 /news/dover170816 3 10950 0 0 /news/drmartens/eastern/chatham/10thjuly03.html 2 0 0 0 /news/resultsjune2018 3 10872 0 0 /news/drmartens/eastern/tonbridge/16thsept04.html 1 0 0 0 /news/sittingbourne2-2chipstead-ijusthopewecanimproveallthetimesaysjimward 3 19091 1 0 /news/favershamtownsearchfornewreserveteammanager 2 6541 0 0 /news/551a99e3ab95a 1 3707 0 0 /news/snodlandtown231010 3 9724 0 0 /news/soccershortsdaishcompletesdoubleswoop 1 3994 0 0 /news/thamesmeadtown1-1carshaltonathletic-werenowhereneartheworstsidesayskeithmcmahon 3 24287 2 0 /news/horsfolk310819 5 53832 0 0 /news/wattscompletsmovetohishome-townclub-exclusive 3 11219 0 0 /news/corinthian281016 1 3610 0 0 /news/craybiller280715 3 25635 0 0 /news/becksenb091015 5 22377 0 1 /news/shorts020715 5 47963 1 1 /bromley-2003-2006 11 33607 0 0 /archive-2006-2014/242 3 13127 0 0 /news/ourstandardsmustnotdropsayswellingunitedbossjamieday 3 12258 0 0 /news/folkevsitt230903.html 2 0 0 0 /archive-2006-2014/179 7 31005 0 0 /assets/ckeditor/plugins/div/ 5 1805 0 0 /news/soccershortskempsterhangsuphisboots 2 10957 0 0 /news/craywabb140415 3 30269 0 0 /news/551a931da303f 4 18274 0 0 /news/wewantplayerswhowanttoplayfortheclubsaysconeyhalldirectoroffootballchristucker 3 14986 0 0 /news/551a9718b66dc 4 13890 0 0 /news/erithbelvederesignstrikermarcuscassiusonfree-transferfrombromley 2 9132 0 0 /news/craywanderers1-2burgesshilltown-francisimproveorfaceeviction 3 48711 1 1 /news/workcommitmentsforcemilestostepdownaschathamboss-exclusive 2 9581 0 0 /news/stonesmanagementduoagreetermstostaywiththeclub 1 3979 0 0 /news/fishtunw050115 4 39210 0 0 /news/corinthian121020 2 7492 0 0 /news/favershamtownyouthgetgoingafterlengthypreparation 5 20259 0 0 /news/551bc99de5b54 1 4654 0 0 /news/folkestone260518 1 3750 0 0 /news/windsor300804.html 2 0 0 0 /news/kentleague/thamesmead/7thjuly03.html 2 0 0 0 /news/ourfinancialsituationremainscriticalwarnsfolkestoneinvictachairman 1 5162 0 0 /news/FAStatement191220 7 42975 2 0 /news/crockenhill110216 4 16734 0 0 /news/isthmianleaguestatement041220 2 7890 0 0 /news/drmartens/premier/dover/23rdaug04.html 1 0 0 0 /news/tootingmitchamunited0-1doverathletic-doverarethekingsofrymanonesouth 1 5890 0 0 /news/551a9cf5891e9 2 11166 0 0 /news/15thapr05.html 2 0 0 0 /news/werestilllookingatthetargetof10winssaysholmesdalebossfabiorossi 1 4174 0 0 /news/551bc5dd8dcf0 3 13040 0 0 /news/moeisa230718 4 14346 0 0 /news/dartfordfansfuryoverwalthamforestpricehike 2 8038 0 0 /news/sittingbourne110818 1 3799 0 0 /news/drmartens/premier/dover/4thoct04.html 1 0 0 0 /news/resultsmarch2014 1 11861 0 0 /news/drmartens/eastern/chatham/chatham.html 2 0 0 0 /news/21stapr05.html 1 0 0 0 /news/tootingmitchamunited2-2sittingbourne 1 4206 0 0 /news/midweekfixtures 2 6170 0 1 /news/kingstonian1-1margate3-2pens-jamieturnermadethebestsaveiveeverseensaysoconnell 1 6787 1 0 /news/kentleague/thamesmead/3rdaug04.html 1 0 0 0 /news/hollgree260316 5 72381 1 1 /news/wemighthaveabetterchanceoffinishinginthetophalfsaysfisherbossbillywalton 2 8298 0 0 /news/wellworkhardonthebitsimnothappywithsayserithbelvederebossmickycollins 1 3520 0 0 /news/itisquiteimportantwefinishsecondsaysdoverathleticassistantjakeleberl 2 7272 0 0 /news/tommysampsonguestofhonouratfacupclashbetweenhernebayanddealtown 2 7504 0 0 /news/itsbeenaremarkableseasonsaysjones 1 4399 0 0 /news/preseason270718 3 25289 0 0 /news/wevegottohitthegroundrunningsaysphoenixsportsjoint-bosssteveoboyle 4 16500 0 0 /news/conference/margate/11thjuly03.html 2 0 0 0 /news/ashfordunited290320 2 7624 0 0 /news/551a9cf58db98 1 5431 0 0 /news/551a967831815 1 5627 0 0 /news/margatebossiainoconnelllwantsgoodpre-seasonhabits 1 4021 0 0 /news/frenchcompanytoinvest25inmaidstoneunited 1 3350 0 0 /news/wehavetobeatourverybesttogetaresultatdoversaysbromleycoachneilsmith 3 16754 0 0 /news/thefavaseisawaytobringinmuchneededfundssayserithbelvederebossmattlonghurst 2 8582 0 0 /news/sladegreenunveilgroundimprovements 1 2924 0 0 /news/hillgoesundertheknife 2 6030 0 0 /news/newchairmanmustputinthegraftsaysingleston 2 9681 0 0 /news/manformanwerebetterthanashfordinsistswalker 2 8064 0 0 /news/551bc5db4d2b6 4 22326 0 0 /news/dulwichhamlet6-1sittingbourne-abbottinsistschangeswillbemadeassittingbournecrash 1 7277 0 0 /news/thekentseniorcupisnotasimportantastheleaguesaysneilcugley 1 4065 0 0 /news/tonbridge100517 2 6568 0 0 /news/maidstone290818 4 14714 0 0 /news/myplayershavesetthebarforwork-rateanddesiresayslarkin 2 8268 0 0 /news/folkestoneinvicta1-0harlowtown-mevdeserveshistestimonialsayscugley-exclusive 2 13420 0 0 /news/551bc5e17d98e 2 14248 0 0 /news/squadsannouncedforsykochallenge 1 3846 0 0 /news/drmartens/premier/welling/11thnov04.html 1 0 0 0 /news/hernebay201104.html 1 0 0 0 /news/tunbridgewellsswiftlyappointnewmanagerfromwithin 2 6944 1 0 /news/drmartens/eastern/sittingbourne/26thjune2003.html 2 0 0 0 /news/551bc5dd15c54 1 4935 0 0 /news/beckenham260320 3 12016 0 0 /news/doverathletic220421 83 303741 37 50 /news/crayhern290317 2 17570 0 0 /news/seagerrelishingderbyclashatfolkestone 1 3593 0 0 /news/awards250417 2 7406 0 0 /news/wedontseethepointthrowingmoneyatitsayserithbelvederebossmickycollins 1 5980 0 0 /news/ashford050718 4 14846 0 0 /news/barrow2-1stevenageboroughaet-walkerdeniesstevenagethedouble 2 10972 0 0 /news/551a956b9d66d 1 3607 0 0 /archive-2006-2014/221 2 8780 0 0 /news/ryman/bromley/fisheru18vbromu18070304.html 1 0 0 0 /news/favershamunveilreardonasnewreserveteammanager 1 4132 0 1 /news/youhavetoworkhardtokeeptheramsgateshirtsaysdannyward-exclusiveinterivew 1 4133 0 0 /news/margate261205.html 2 0 0 0 /news/tonbconc180717 1 9069 0 0 /news/551a9c0eba217 3 24534 0 0 /news/drmartens/eastern/tonbridge/3rdmar04.html 1 0 0 0 /news/551a96775fe0e 1 4959 0 0 /news/sceflstatement060321 12 35596 1 2 /news/resultsseptember2018 4 45034 0 0 /news/drmartens/eastern/folkestone/chelmsford170804.html 1 0 0 0 /news/werebuildingourteamaroundpiscinasaysmoore-exclusive 2 17463 0 1 /news/thebarrhasnowbeenraisedadmitsangelschairmansullivan-exclusive 1 3627 0 0 /news/sydenhamsports041020 7 32608 4 4 /news/3rdaug03.html 1 0 0 0 /news/newunder21leagueinthepipeline 2 6198 0 0 /news/dartford1-1portvale-wegotawaywithmurderadmitsportvalebossmickyadams 1 5636 1 0 /news/drmartens/eastern/folkestone/folkvflee181103.html 1 0 0 0 /news/warrilowseesmingleasareplacementforminshull 1 4061 0 0 /news/crayrams311216 4 50876 0 0 /news/551a97b2334cd 1 3956 0 0 /news/hopefullywecangetafewmorepeoplethroughthegatesaysmattlonghurst 3 12377 0 0 /news/ebbsfleet080616 4 15925 0 0 /news/banbvfolk240404.html 2 0 0 0 /news/sceflstatement110321 12 50691 1 2 /news/3rdjan06.html 1 0 0 0 /news/stoneschairmanreflectsonfifteenyearsatthehelm 2 10204 0 0 /news/551bc99befeb4 5 53374 1 3 /news/dulwichhamlet160320 2 7346 0 1 /news/phoenix261017 3 9647 1 0 /news/28thaug03.html 3 0 0 0 /news/551a97b0770b8 1 4058 0 0 /news/fishmill170718 2 16828 0 0 /news/situationsvacant 4 10654 0 0 /news/FAHeadingGuidance240220 3 12874 0 0 /news/wevegottopickourselvesupsaysbitterlydisappointedyorath 1 3811 0 0 /news/thamesmead021015 4 18961 0 0 /news/fleetladiessearchfornewtalent 1 3128 0 0 /news/greenwich171116 1 3318 0 0 /news/letsgetnewyearofftowinningwayssaysseager 1 4879 0 0 /news/tonbridgeangels7-3gravesendnorthfleet 3 15134 0 0 /news/551bc5dbba792 4 16978 0 0 /news/551a9c0f0bd54 3 12225 0 0 /news/whithern081218 4 47268 0 0 /news/holmchip040815 7 153952 2 2 /news/itisveryclearforalltoseewhereourproblemsliesayswhitstabletownbossjustinluchford 1 3845 0 0 /news/racefortherymansaundersretiresfromplayingkentleaguefootball-exclusive 2 10498 0 0 /sittingbourne-2003-2006/ 1 3040 0 0 /news/551a931e5b944 2 6408 0 0 /news/weregoingtofinishashighaswecansayscorinthianassistantmattlonghurst 3 22374 2 1 /news/wehaveplayerswhocanperformonthebiggerstagesaysfavershambossrayturner 1 3938 0 0 /news/ 9 26478 0 0 /news/551bc99b6c156 1 6572 0 0 /news/gotanynews 2 5490 0 0 /news/551bc5e817a7b 2 16038 0 0 /news/crayvalley101120 3 11618 1 0 /news/erithbelvedere0-2vcdathletic-wedidntwanttoexittwocupsinaweeksaysrickybennett 1 7532 0 0 /news/vcdrussell080415 3 12368 0 0 /news/551bc5e7729b7 2 9088 0 0 /news/histon050205.html 3 0 0 0 /news/cpalace030804A.html 1 0 0 0 /news/551bc5e040f59 2 12564 0 0 /news/takeapuntonsomeonewhoishungrytosucceedsaysstaplehurstthird-teamboss 1 3459 1 0 /news/kentfansraiseover14000forhughes 1 5394 0 0 /news/phoenixsports200819 3 12026 0 0 /news/redbridge0folkestoneinvicta2 3 15028 0 1 /news/kentleague/deal/17thoctZ.html 1 0 0 0 /news/sittingbourne111116 1 3469 0 0 /news/seagerwantsabiggerbudgettomatchhisplay-offaspirationsnextterm-exclusive 1 4904 0 0 /news/holmuckf311020A 9 119162 0 0 /news/doverchairmantellswingerthedealisstillonthetable 5 15678 0 0 /news/dulwich020317 1 4284 0 0 /news/myplansfortunbridgewellsweretotallyhonourablesaysex-englandstar 1 3481 0 0 /news/551bc5dfb5c6d 3 14044 0 0 /news/551a9250099f2 4 17550 0 0 /news/551a96771febb 1 3735 0 0 /news/havingcraigstoneputpentopaperisgreatnewssaysebbsfleetunitedbossliamdaish 1 3478 0 0 /news/beckinghamletsmakeitadaytoremember 2 8412 0 0 /news/canterbury050816 2 7936 0 0 /news/551bc99d8fd07 1 5946 0 0 /news/doverapproachdartsforqualitystrikercass 1 3157 0 0 /news/youliketobetheunderdogssometimesbecauseitgivesyoualiftsaysdartfordbosstonyburman 3 14028 0 1 /news/IsthmianLeagueStatement080121 4 22181 1 1 /news/fisher2-2crawleydowngatwick-wehadtherubofthegreenadmitssimonhalsey 4 37562 0 0 /news/wefinishedinafalsepositionsayslordswoodbossjasonlillis 1 4055 0 0 /news/phoehorn260915 4 37407 0 0 /news/erithbel030317 1 4528 0 0 /news/soccershortsonsongdrydenamajordoubtfordoverathleticstrophytussle 5 64381 1 0 /news/kentleague/cray/francis060804.html 1 0 0 0 /news/551a97b05e359 3 11004 0 0 /news/porterplotsfacupgiantkilling 1 4821 0 1 /news/harrowborough2bromley0 2 6890 0 0 /news/30thjune03.html 2 0 0 0 /news/20thoct04.html 1 0 0 0 /news/stonesunveilthesigningofsimonglover 1 3878 0 0 /news/resultsjanuary2021 4 16350 0 0 /archive-2006-2014/94 1 4655 0 0 /news/craywands250416 4 24954 0 1 /news/551a96dba40bc 1 4004 0 0 /news/wehavetoenjoywherewearesaysdartfordmanagertonyburman 1 3846 0 0 /news/551bc5d9a5d6c 2 8950 0 0 /news/551a931ea03fb 3 17838 0 0 /news/lordswood020818 1 3798 0 0 /news/favershamtowngivengreenlightforpromotion 1 4106 0 0 /news/551bc5e56ad0e 2 11546 0 0 /news/9thnov03.html 1 0 0 0 /news/thamesjersey010815 3 29694 0 0 /news/whitstabletown3-2corinthian-casuals-wemustcomeoutontopinourmini-leaguesaysseager 2 11688 0 0 /news/ithinkphoenixsportshasalotofpotentialsaysjoint-managersteveoboyle 2 9626 0 0 /news/wehaveanoutsidechanceofmakingtheplay-offssayswalker 1 3474 1 0 /news/margate0-3walthamabbey-immoreawareofthesizeofthetasknowadmitsoconnell 2 43968 2 2 /news/maidstone281218 4 14569 0 0 /news/dartford1-1doverathletic 3 15968 0 0 /news/hollandsandblair090421 61 204025 1 21 /news/551a979992a9a 2 9851 0 0 /news/fisherbeginsearchfornewmanagerafterpartingcompanywithgarylisney 1 4375 0 0 /news/margate060718 3 10659 0 0 /news/551a9c923263c 5 56495 2 2 /news/myremitistobuildtheclubsayserithbelvederebossmattlonghurst 4 17362 0 0 /news/sittingbourne1-1waltoncasuals-someofourfansaregettingaheadofthemselves-dannyward 3 17876 0 0 /news/1stnov03.html 2 0 0 0 /news/bromley240818 4 15521 0 0 /news/551a9c92de6e8 2 13034 0 0 /news/551a9798b2c12 2 9494 0 0 /news/thamesmeadtowngivengoaheadfor4mredevelopmentofbaylissavenue 2 7374 0 0 /news/craywandererssigninternationalstar 1 4040 0 0 /news/myambitionisforthestonestoplayinmaidstone-oliverash 1 4903 0 0 /news/gillingham1-1wycombewanderers-comicalowngoalgiftsleadersanundeservedpoint 1 4857 0 0 /news/551bc99d185b4 1 5441 0 0 /news/burmansettomakechangesfortrophytieatsittingbourne 2 8119 0 0 /news/vcdathletic0erithbelvedere1 3 10784 1 0 /news/551a9b481904c 4 12082 0 0 /news/angelssignsecondwingertoenhancepromotionbid-exclusive 1 4742 0 0 /news/videoevidenceprovesofficialsgotitwrong-twice 2 6730 0 0 /news/mckimmisourrockadmitsmargatesplayer-bosstrott 1 3529 0 0 /archive-2006-2014/264 2 8735 0 0 /news/springettboostforlovellfortrophytieatbognorregis 2 8688 0 0 /news/hampton140904.html 2 0 0 0 /news/facarlsbergvasethirdrounddraw-2 1 2826 0 0 /news/7thoct05.html 1 0 0 0 /southern-counties-east-football-league/27 11 56585 0 0 /news/margate220518 1 3135 0 0 /news/15thaug04.html 2 0 0 0 /news/551a956c09b84 2 6600 0 0 /news/tunbridgewells1-0holmesdale-wereveryluckytohavekeelanmooneyadmitswellsbosslarkin 2 16933 1 0 /archive-2006-2014/182 3 12850 0 0 /news/folkestoneinvictaholdingprogrammefaironsunday 1 2760 0 0 /news/cugleytargetsstrikertobecomeaforce 1 5555 0 0 /news/in-formcraywanderersblowlandlordsaparttoreachcountycupfinal 1 3386 0 0 /news/smithiwanttotestmyselfatahigherlevel 1 3857 0 1 /herne-bay-2003-2006 12 36218 0 0 /news/wevedonewelloutofstuartzanonetransfersaysvcdathleticbosstonyrussell 1 4729 0 0 /news/sittingbourne1barkingeasthamunited1 3 13126 0 1 /news/itsinthelapofthegodswhichteamswinssayscorinthianbosstonysitford 2 9922 0 0 /news/wejustneedtobeconsistentsayserithtownbossenniogonnella 3 9799 0 0 /news/551bc99ae4d32 1 3410 0 0 /news/lewisham080319 2 7614 0 0 /news/balhwell160920 6 72482 0 0 /news/wellcori101020 8 103600 0 0 /news/Salivsitt100104.html 2 0 0 0 /news/croydon190305.html 1 0 0 0 /news/shamefulstephensonhastobepunished 2 9518 0 0 /news/phoenix070918 3 10776 0 0 /news/yougettheoddgeminsundayfootballandthisistheirchancetojoinramsgatesaystimdixon 3 11557 0 0 /news/chathamtownlaunchfootballacademy 2 8456 0 0 /herne-bay-2003-2006/2 4 10642 0 0 /news/wearealwayslookingtostrengthensaysdoverathleticbossnickyforster 1 4022 0 0 /news/kilcullenstandsdownasfleetchairman 1 3990 0 0 /news/havefaithinmeandiwilldeliverinsistsdolby 1 3303 1 0 /news/creditcrunchthefashouldhelpnon-leagueclubsmoresaysdartschairman 1 5228 0 0 /news/matatareturnsforvisittohigh-flyingswifts 2 7981 0 0 /news/wellingunited2-1lutontown-forustogetinsecondroundisamassiveachievementsaysday 2 20430 0 0 /news/551a95b3b4329 2 7887 0 0 /news/drmartens/eastern/dartford/12thnov04.html 1 0 0 0 /bromley-2003-2006/6 3 9054 0 0 /news/soccershorts010619 3 17677 0 0 /news/holmesdaleseeknewownertotakeclubtonextlevel 2 9812 0 1 /news/folkestonechairmanweneedmorefundsforstrongerleague 5 25777 0 0 /news/tonbridgeangels2molesey0-angelslooktotheirhomecomforts-exclusiveinterview 1 6073 0 0 /news/reading280804A.html 2 0 0 0 /news/ramswelcomedonswithopenarms-exclusive 1 4511 0 0 /news/woking5-1hythetown-thegamewasnevereasyadmitswokingbossbaker 1 7499 0 0 /news/iwantustopushupthatleaguenowsaystonbridgeangelsbossstevemckimm 3 12623 0 0 /news/kentleague/thamesmead/thamvslad210204.html 1 0 0 0 /news/suttonreplay201004.html 1 0 0 0 /news/theclubsgrownandwevegrownwiththeclubinoursixyearsinchargesaysgavinrose 3 13539 0 0 /news/551a97b1c93c0 1 4668 0 0 /archive-2006-2014/228 2 8942 1 0 /news/551bc5e2d7500 1 3016 0 0 /news/imexpectingustowinbecauseramsareinalowerleaguesayscrayvalleybossstevechapman 5 21507 0 0 /news/bowey301sevenoaks250105.html 2 0 0 0 /news/warrilowtellsrivalmanagersberespectfulwithyourteamselections-exclusive 1 5430 0 0 /national-league/19 2 9560 0 0 /news/craywands310119 3 13848 0 0 /news/thereisnoreasonwhywecantcauseanupsetattonbridgesayshernebaybosssamdenly 3 11422 0 0 /news/princesparkcompletitiondateremainsontarget 2 6536 0 0 /news/merirust180315 5 80991 1 1 /news/wevegotalotofhardworktodosaysfolkestoneinvictabossneilcugley 5 18170 0 0 /news/theultimatedreamistoplayatwembleysaysashforrdunitedassistantmanagerjohnovard 5 25427 0 0 /archive-2006-2014/233 2 8782 1 0 /news/551a9c91d3481 2 8386 0 0 /news/dannyhuntwilldoafantasticjobforlilywhitessaysfirkins 1 5527 0 0 /news/dog-fightwineasedthepressureadmitsmiles-exclusiveinterview 2 7184 0 0 /news/bromley191017 1 4649 0 0 /news/bromley160717 3 29290 0 1 /news/wewanttobetopdogsinthanet-ward 1 4720 0 0 /news/championshessenthalerwillguideustothefootballleague-parmenter 2 10455 0 0 /news/551a931ebd799 2 8798 1 0 /news/dartford2-5gillingham-wegavegillinghamagamesaysdartfordbosstonyburman 8 170728 7 7 /news/goodinggetstheblues-exclusiveinterview 1 4926 0 0 /news/sittingbourne301020 3 12122 0 0 /news/hythetown2-0hastingsunited-itsgreattohavethatwinningfeelingbacksaystimdixon 2 19090 0 0 /news/sheppey220920 2 8798 0 0 /news/drmartens/eastern/fisher/21stjuly03.html 2 0 0 0 /news/kentleague/sladegreen/vcd110904.html 1 0 0 0 /news/551a9c92cae46 2 12599 0 0 /news/6thjune05.html 1 0 0 0 /news/greenwich060418 1 5173 0 0 /assets/select2/docs/community.html 1 1282 0 0 /news/itsafourhorseracesaysmcmahon-exclusive 2 7424 0 0 /news/dartsgivenpermissiontotalktostonesdefender-exclusiveinterviews 2 12545 0 0 /news/cray280816 2 10310 0 0 /news/drmartens/eastern/erith&belvedere/folkestone301104.html 1 0 0 0 /news/ifwecangounbeatenitwillbeagoodchristmasforussayshythetownbossscottporter 1 3955 0 0 /news/lewisham190718 4 17720 1 1 /news/chipsteadmakeyouworkhardtogetanythingdowntheresaysstonesbossjaysaunders 2 8656 0 0 /news/tonbridgeangelssearchfornewbosswhilestevebrownhailsebbsfleetsplay-offspot 3 14010 0 0 /news/ashfordtown1-2metpolice 2 12458 0 0 /news/wellingunited1-1dartford-wevehadarealdisasterousrunadmitsdartsbosstonyburman 1 9585 0 0 /news/20thoct04A.html 1 0 0 0 /news/NationalLeagueStatement180221 8 36177 2 2 /news/sheppey301020 2 8538 0 0 /news/sendusyourmatchreports 2 5575 0 0 /news/551a9c933f5e3 2 8850 1 0 /southern-counties-east-football-league/23 6 29571 0 0 /news/551bc5d9cf63d 2 8661 0 0 /archive-2006-2014/48 5 24421 0 0 /news/tonbridge110817 1 4200 0 0 /news/mypriorityistowinthekentleaguevowshythebossscottporter 1 4023 0 0 /news/drmartens/eastern/sittingbourne/28thaug03.html 1 0 0 0 /news/bromley030417 2 10532 0 0 /news/leatherhead3-3ashfordtown 1 4740 0 0 /news/erithtownbears301117 2 8351 0 0 /news/weneedtostartpickingupresultssayschathamtownassistantpeterhawkins 3 11546 0 0 /news/551bc5e8cd5d3 3 16606 1 0 /news/bromleyt150817 3 33150 0 0 /news/theresnoteamonthisplanetthatareunbeatablesaysgillinghambossjamesmarrs 4 22252 0 0 /news/wewillturnitaroundinsistsmiles-exclusiveinterview 2 9330 0 0 /news/wewanttobetterourselvessayshythetownbossscottporter 4 17584 0 0 /news/dontunderestimateusramswarnpremierleaguerivals-exclusiveinterview 5 25448 0 1 /assets/select2/tests/data/array.html 1 301 0 0 /news/drmartens/eastern/ashford/18thsept03a.html 1 0 0 0 /news/dolbylooksforwardtoreturningtofootball 2 7361 0 0 /news/lordswoodstatement221220 2 19013 1 1 /news/othernews/SECFL220204.html 1 0 0 0 /news/551bc5e1dcd35 2 7712 0 0 /news/chancetoseenewstadiumprogress 3 8959 0 0 /news/sevshep060517 2 22548 0 1 /news/itsamassivegamefortheclubsayserithtownbossmarktompkins 1 5554 0 0 /news/imconfidentthatwellgothroughagainstlancingsaysgreenwichboroughbossianjenkins 3 12736 0 0 /news/14thmar05.html 3 0 0 0 /news/footballassociationliftbeckenhamtownban 2 6990 1 0 /news/sittingbourne0-0fleettown 1 4046 0 0 /news/11thoct04.html 1 0 0 0 /news/551a95b4619eb 2 8408 0 0 /news/27thoct05.html 2 0 0 0 /news/chathamtown1-2vcdathletic-itwasthemostiveenjoyedaresultthisseasonsaystonyrussell 2 20735 0 0 /news/sittingbourne1-1ashfordtown-debollasigningisourbestoneyetsaysabbott 1 6667 0 0 /news/ramsgateteenagestrikerlockyerimpressesonpalacetrial 1 3983 0 0 /news/sevenlewes0070916 2 18676 0 1 /news/14thsept05.html 2 0 0 0 /news/craywanderers0-1wellingunited-impleasedtogetthroughtothenextroundsaysjamieday 3 24705 1 0 /news/fishgleb021119 4 46312 0 0 /news/lovellexpectsatoughchallengefromfolkestonesyoungsters 1 4514 0 0 /news/haworthisourmaninsistsdartfordboss 1 3683 0 1 /archive-2006-2014/253 3 12644 0 0 /news/wellletourfootballdothetalkingsayslewishamboroughbosskevinharris 4 17806 0 0 /news/551bc5e722fe4 2 9246 0 0 /news/vcdathletic2-3bideford-wevemissedagreatchancetoprogressadmitsford-exclusive 2 11316 0 1 /news/crayval160317 1 4214 0 0 /news/17thjuly05.html 1 0 0 0 /news/mysquadarebuildingaterrficdesiretosucceedsayslyddtownbossdavesmith 3 11683 0 0 /news/551a96775af66 4 21045 0 0 /news/551bc99e580c8 1 3720 0 0 /news/othernews/favase4thround.html 1 0 0 0 /news/theresabigjobtobedoneatcrayadmitsnewbosskeithbird 5 20221 0 0 /news/myplayerscanstillturnitaroundinsistscash-strappedfolkestonebossneilcugley 1 5436 0 1 /news/refmarshall230717 3 9766 0 0 /news/chathamtown0-2stalbanscity-ijusthopemorelocalpeoplecomebacksayskevinwatson 2 17596 0 0 /news/margate250118 1 4064 0 0 /news/patchedupangelsconfidentofcausingupset-exclusive 1 4738 0 0 /news/stalbans050405.html 2 0 0 0 /news/ebbsfleetunitedpulloffdannykedwelltransfercoup 4 16908 0 0 /news/rochash180518 2 18082 0 0 /news/mergerwasntgoingtoworkadmitserithtownchief 1 18343 1 0 /news/soccershorts200519 3 15446 0 0 /news/beckenhamtown6-2miltonathletic 2 7367 0 0 /news/tunwells281016 2 8093 0 0 /news/daishcomplainsaboutfixturebacklog 1 4139 0 0 /news/551a96dcad3f7 2 8104 0 0 /news/boroughmaketriplesigning 5 16031 0 0 /news/fcelmstead220917 3 11955 0 0 /news/wearelookingtoemulatewhatcorinthianhavedonesaysholmesdalebossfabiorossi 1 5147 0 0 /news/551a92502d248 5 20900 0 0 /news/facuprunwouldsortthecluboutfinancaillyallyearsaysthamesmeadtownbosskeithmcmahon 3 14804 0 1 /news/thiswillturnouttobethetoughestseasonyetwarnsmunday 1 4415 0 0 /news/bromvkingsfr290803.html 1 0 0 0 /news/NationalLeagueSouth230920 8 90032 6 6 /news/juniordian080715 3 17778 0 0 /news/giveuslucrativekentderbiessaysbinks-exclusive 1 5045 0 0 /news/holmesdale020118 5 17187 0 0 /news/drmartens/premier/welling/4thjuly04.html 1 0 0 0 /news/illbereallypleasedifwereachthefavasequarter-finalssayshernebaybosssimonhalsey 1 4911 0 0 /news/551a956b7163f 1 3177 0 0 /archive-2006-2014/201 2 8610 0 0 /news/wecangothewholehoggadmitsdartsbossburman 1 4090 0 0 /news/551a99e5487b3 1 5330 0 0 /news/daishillhavenosleeplessnightsifwegodown 2 6672 0 0 /news/thefacupsponsoredbyeonfirstrounddraw 2 8694 0 0 /news/kentleague/maidstone/7thjuly04.html 1 0 0 0 /news/wellingunited4-1tonbridgeangels-wevegottotryandwin10cupfinalssaysjamieday 2 20242 0 0 /news/551bc5e87b16c 2 6288 0 0 /isthmian-league/27 8 37269 0 0 /news/creditcrunchfolkestoneinvictafacefinancialmeltdown 2 14272 0 0 /news/theperformancewastotallyunacceptableandnowherenearourstandardssaysramsbosstimdixon 2 7298 0 0 /news/wokinghavewontheleagueadmitswellingunitedbossjamieday 1 4625 0 0 /news/newashfordownersettoannouncethreenewqualitysigningsinmidweek 1 3561 0 0 /news/othernews/youthleaguetables010304.html 1 0 0 0 /news/whyteleafe1-2folkestoneinvicta-myplayersputashirtonwithalotofpridesaysneilcugley 2 42626 2 2 /news/welltavi051019 5 43251 0 0 /news/leyton0-0folkestoneinvicta 2 8846 0 0 /drmartens/eastern/fisher/29thjune05.html 2 12482 1 2 /news/kfuksp030217 4 14716 0 0 /news/seagerexplainsknightdeparture 4 13288 0 0 /news/ifwerenotcarefulwemaygothewayofotherclubswhopushtooearlywarnsbridonropeschair 3 19182 0 0 /news/wivenhoetown1chathamtown0 4 15544 1 0 /news/stainestown4-1sittingbourne-weredisapointedthatwehaventgotadrawadmitsmattwyatt 7 94832 2 2 /news/kentleague/ramsgate/16thjuly03.htm 2 0 0 0 /news/drmartens/eastern/fisher/15thmar04.html 1 0 0 0 /news/wehaveadaptedtorymanfootballsaysseager-exclusive 2 10126 0 0 /news/sportingbengalunited0-5erithbelvedere-newmanagementteamcelebratefirstwin 2 8408 0 0 /news/wereundertheimpressiontakeoverdealisgettingsortedaroundthistimenowrevealsjamieday 1 4678 1 0 /news/551bc99e04820 1 6862 0 0 /assets/fileman/php/ 8 4781 0 0 /news/hessenthaleriwantmoredesirefrommyplayers 1 4027 0 0 /news/charltonathletic1-3gillingham-theywanteditmorethanusadmitsstuartweston 5 51227 0 0 /news/therehavebeenencouragingpositivesfromgametogamesaysdealtownbossdavejohncock 3 11161 0 0 /news/wevecomealongwayinashorttimeadmitsdolby 2 8635 0 0 /news/sampsonreturnshomeandvowstowinatwembleyagain-exclusive 2 7297 0 0 /assets/select2/tests/a11y/ 5 1918 0 0 /news/hytheheroeswearereadytocreatehistorysaysscottporter 2 12253 0 0 /news/doverathletic0-1chelmsfordcity-hessenthalerweletdownthefans 1 6425 0 0 /news/matchreports-1 1 11000 1 0 /news/25thmar05.html 2 0 0 0 /news/otfordunited0-2hildenboroughathletic-wehavegotpotentialinabundancesaysmikecramp 4 69252 2 2 /news/21stjan05.html 1 0 0 0 /news/dartford290618 3 10017 0 0 /news/551a956bbac27 2 6446 0 0 /news/aveley191105.html 2 0 0 0 /news/folkestone140319 3 11946 0 0 /news/kentleague/hythe/7thnov04.html 1 0 0 0 /news/youdonthavetostartwelltowinthisleaguesayswalker 2 7978 0 0 /news/topmanianjenkinsgetsonhismarksforcharitymarathonrun 1 3736 0 0 /news/roystonsignsforcraywanderers-exclusive 1 2691 0 0 /news/doverwillwaitfortheirstarstriker 1 5185 0 0 /news/tunbridgewells0-1nortonsports-iwantclubstostayawayfromjoesandssaysbentaylor 2 17062 1 1 /news/fisherunveilsimonhalseyastheirnewjoint-manager 5 18952 1 1 /news/tunbridgewells1-1vcdathletic-rogersheroicshandswhitstablethetitle-exclusives 1 7313 0 0 /news/chathamtown0-1worthing-wecouldnthavegivenanymoreintermsofeffortsayskevinwatson 1 5405 0 0 /news/wevemissedtheboatadmitswestwickhammanagerkeithdurso 1 5150 0 0 /news/551bc5dae34d4 2 9142 0 0 /news/sittingbournebordenvillage300520 6 22248 1 1 /news/12thsept05G.html 3 0 0 0 /archive-2006-2014/230 2 8474 0 0 /news/551a96dbceb66 1 3146 0 0 /news/silk090504.html 1 0 0 0 /news/weseemtobedoingbetterawayfromhomeadmitsbromleycoachneilsmith 3 13088 0 0 /news/1stjune05.html 2 0 0 0 /news/ashfordtown4-0whitstabletown-wevesetourstandardsnowsayslovell 1 5587 0 0 /news/8thsept05.html 1 0 0 0 /news/551a99e4e31b0 3 20658 0 0 /news/seagerlookingforanunbeatenendtotheyear-exclusiveinterview 3 13951 0 0 /news/hollshep190220 5 57357 0 1 /news/sct171116 4 13823 0 0 /news/lyddhavesamesightsasidosayshughes 2 6255 0 0 /news/angelscompletecadeloansigning-exclusive 2 9543 0 0 /news/551a99e427e0c 1 3509 0 0 /news/9thjune05.html 1 0 0 0 /news/myplayersarehereattheclubtowinsomethingsayserithbelvederebossmickycollins 2 9342 0 0 /news/wevebeentremendoussayschampionshipwinninghessenthaler 2 6599 0 0 /news/551bc5dfc5b01 1 3264 0 0 /news/ramsgateannouncesegregationmeasures 6 19525 0 1 /kent-invicta-league/26 2 9273 0 0 /news/dartford260518 3 9714 0 0 /news/daishmacdonaldcontractshowsourlongertermcommitmenttobringsuccesstotheclub 4 16065 1 0 /archive-2006-2014/36 1 5056 0 0 /news/folkestone130820 4 14052 0 0 /news/551bc5ddb9ded 2 18079 1 0 /news/crockenhillunveilgroundplanstoreturntokentleague 1 4916 0 1 /news/crowbseven020418 2 6516 0 0 /news/dolbymakesdoublesigning-exclusive 1 4426 0 0 /news/welling050216 3 11802 0 0 /news/bromley1-1wealdstone-wevegainedanimportantpointsaysmarkgoldberg 2 16986 0 0 /news/sheppeyunited270519A 3 10695 0 0 /news/drmartens/premier/dover/26thfeb04.html 1 0 0 0 /news/maidstoneunited140920 2 9108 0 0 /news/afccroycor091215 3 33507 0 0 /news/ebbsfleet280619 4 14013 1 0 /news/crowborough040118 2 10676 0 0 /news/icanseeushammeringsomesidewarnsfavershamtownassistantclivewalker 1 4273 0 0 /news/huntleypleatosheringhamweneedyououtonthepitch 1 5396 0 0 /news/ashford180216 4 22286 0 0 /news/ebbsfleetunited1-0weymouth-barretthomesintowardswembley 2 11994 0 1 /news/lordswood1-5pagham-lillislookingforaresponseafterfacupexit 2 9908 0 0 /news/carsvbromfat011103.html 1 0 0 0 /news/cugleyvowstoleadfolkestoneinvictanextterm 1 5985 0 0 /news/kentleague/maidstone/guildford110904.html 1 0 0 0 /news/551a9797d7f16 4 22885 0 0 /news/hythe261105.html 1 0 0 0 /news/ivebeenaskedtosteadytheshipsayshughes 1 4711 1 0 /news/folkestoneinvicta0-0fleettown-invictadrawablank 3 12806 0 0 /news/tonbridge180218 2 8104 0 0 /news/551a956bbfdf0 3 15663 0 0 /news/ivegotnodoubtsofussurviving-mcmahon 1 4535 0 0 /news/hernebaybosssimonhalseywillbecluedupaheadoffacuptieagainstalresford 2 8496 0 0 /news/margate280619 3 9702 0 0 /news/wellbestayinginthekentcountyleagueunlessiwinthelotterysaysbexliansbossdannyhill 6 38749 0 0 /news/sct310818 4 15538 0 1 /news/baldacchinodemandscharacterfollowingunacceptabledisplay-exclusive 1 4458 0 0 /news/favershamtownbossrayturnerpaystributetodepartingstrikerlukeharvey 3 10987 0 0 /news/gillingham0-3coventrycity-ithinktheoccasiongottothemtodayadmitsdeflatedjamesmarrs 3 25851 0 0 /news/sladegreenmakedoubleswoopasfansflocktoseelittlesreturn 1 4168 0 0 /news/bromley1waltonhersham0 4 15214 0 0 /news/wehavesurprisedafewpeoplethisyearsaystonbridgeangelsbosstommywarrilow 1 4876 0 0 /news/mcdonnellreturnisboostforbromley 4 12693 0 0 /news/kentleague/deal/Sampson17.html 1 0 0 0 /news/551bc5e864f4c 1 3770 0 0 /news/luchfordseeksimprovementaheadofwhitethawkopener 3 12674 0 1 /news/kentfascoopstopaward 1 3631 0 0 /news/gillsatwembleystimsonproveshiscriticswrong 2 8738 0 0 /news/lovellsubmitsseven-dayapproachformidfielder-exclusiveinterviews 2 13738 0 0 /news/sevenacre260715 3 12012 0 0 /assets/ckeditor/plugins/templates/ 5 1887 0 0 /news/rusthall140819 3 10208 0 0 /news/wandscouldgooutofexistenceifplanningconsentisnotgrantedwarnssecretarykerryphillips 2 10362 1 1 /news/551bc5e24c385 2 6334 0 0 /news/ourtwocupsemi-finalsareourprioritynowsayssuttonathleticbossjamescollins 2 8449 0 0 /news/weplaysomegoodfootballsohopefullypeoplewillcomeouttowatchussaysjamieday 3 13609 0 0 /news/551bc5e51fcf0 1 3729 0 0 /news/drmartens/eastern/sittingbourne/maldon301004.html 1 0 0 0 /news/brompal300715 4 32062 0 0 /assets/signpad/ 5 1775 0 0 /news/smallingneedstofulfilhisexpectationssayspearce 2 6829 0 0 /news/551a979b05a34 2 9443 0 0 /assets/smartmenus/addons/ 6 2250 0 0 /news/kentfachiefpauldolanexplainsdartfordskentseniorcupwithdrawal 2 6960 0 0 /news/canterbury261218 4 20182 0 0 /news/soccershortslillisstaysatthebay 2 10548 0 0 /news/maidstone020719 6 26744 0 0 /news/credittotheboysforkeepingusintheconferencesayswellingunitedbossjamieday 4 13818 0 0 /news/sittvnewp270304.html 2 0 0 0 /news/551a96781ecce 1 6151 0 0 /news/551a931dd7635 1 3204 0 0 /news/crayvsudb210204.html 1 0 0 0 /news/lordswood180718 8 91441 5 6 /news/dartford150619 3 10014 0 0 /news/soccershorts110116 8 103402 4 4 /archive-2006-2014/285 3 12392 0 0 /news/lordswood110920 2 8342 0 0 /news/tobesuccessfulweneedtomaintainaconsistentsquadsayshernebaybosssamdenly 4 13494 0 0 /news/ihaveenjoyedeightwonderfulyearsatebbsfleetunitedsaysliamdaish 3 11110 0 0 /kent-county-league 95 445689 6 17 /news/fisheru18vbromu18070304.html 1 0 0 0 /archive-2006-2014/177 5 21791 0 0 /news/551bc5dd2ffa0 3 13259 0 0 /news/sampsonretirementsampsonvowstoreturntokentfootballmanagement 1 3906 0 0 /news/lydd190915 3 10497 0 0 /news/afccroydonathletic3-4erithtown-ithinkwemadehardworkofitsaysjamescollins 1 10055 0 0 /news/margate070617 2 6604 0 0 /news/itsbeenagreatyearsaysfavershamtownmanagerjustinluchford 1 4976 0 0 /news/551a97b1aa816 1 4600 0 0 /news/kentcounty/17thdec03.html 1 0 0 0 /news/vcd041215 3 11673 0 0 /news/youcangooutandmakeanameforyourselfinthefacupsaysderesbossmickycollins 1 3661 0 0 /news/maidstoneunited0-2accringtonstanley-humehappywithopeningwork-out 1 5013 0 0 /news/551a956c25cfe 5 39558 3 0 /news/drmartens/eastern/folkestone/hendon121004.html 1 0 0 0 /news/everybodywantstobeatusnowsaysfrancis 2 8927 1 0 /news/fisherathletic1-2eastleigh-ivegotthetoughestjobinfootballadmitsmehmet 2 13052 0 0 /news/551a9b4830545 4 11655 0 0 /news/551a931e43321 1 5653 0 0 /news/itsprobablyourbiggestdayinourhistorysaysphoenixsportsjoint-bosstonybeckingham 5 24401 0 0 /news/canterbury240319 4 19306 0 0 /news/dannywardweareatsouthwood-weexpecttowinexclusiveinterview 4 16184 0 0 /news/charltonathletic180321 3 12168 0 0 /news/551a931e48cea 1 3760 0 0 /archive-2006-2014/10 8 56079 1 1 /news/bromsutt151218 4 41294 0 0 /news/congratulationsdoverathleticfootballclubrymanleaguedivisiononesouthchampions2007-2008 1 2596 0 0 /news/dulwichhamlet121219 3 10176 0 0 /news/itsprobablythefirsttimewevehadtofacehythewhenwevenotbeenthefavouritessayscugley 3 14503 0 0 /news/tunbridgewells110920 3 12053 0 0 /news/elmslewi110919 5 50392 0 0 /news/7thjuly05.html 2 0 0 0 /news/551bc5e62ed1b 1 4108 0 0 /news/westwickhamrelishbeckenhamexamination 2 8482 0 0 /news/soccershorts270617 3 16269 0 0 /news/whitstable130805.html 1 0 0 0 /news/dartfordbegintheirclimbupthefootballladder 1 3825 0 0 /news/ashfordtownunveilnewsignings 1 3134 0 0 /news/doverathleticopenthegatesforchristmasbash 1 3447 0 0 /news/lewishamborough0-1bridonropes-iwanttoturnitaroundsayslewishambosswillieosullivan 1 7503 0 0 /news/551bc5e2cee35 3 12979 0 0 /news/drmartens/eastern/erith&belvedere/29thaug04.html 1 0 0 0 /news/551a956be1361 1 3648 0 0 /news/meridianNHS180320 3 9454 0 0 /news/ashfordtownp-pwhitstabletown-homelandsleftinthedarkaspowerfailurehaltskentderby 1 5812 0 0 /news/551a9bafe534b 3 22212 0 0 /news/551bc5e4d0ba5 1 3005 0 0 /news/erithandbelvedere180620 3 11737 0 0 /news/ashfordgivepetersachancetoimpress 1 2974 0 0 /news/ryman/bromley/whytvbrom060104A.html 1 0 0 0 /news/beckenhamtown1-2fisher-garylisneyadmitsweneededthatwin 1 7410 0 0 /assets/select2/docs/_includes/ 5 2023 0 0 /news/keepingfolkestoneupthisseasonwillbemybestachivementtodatesaysneilcugley 1 3721 0 0 /news/kentleague/lordswood/sevenoaks071204.html 1 0 0 0 /news/rusthall091218 4 14546 0 0 /news/tonbridge221216 1 5092 0 0 /news/havingfiveplayersoutisabitnaughtysaysfolkestoneinvictabossneilcugley 1 4892 0 0 /news/551bc5e664538 2 12100 0 0 /news/greenwich130615 5 40469 0 1 /news/soccershortsbrickiesearlychristmaspresenttofans 1 11981 0 0 /news/ashfordtownmiddx0-1dartford-weveduginandgotaresultaftercriticismsaystonyburman 1 6366 0 0 /news/transferfeadlinedaydeals010221 8 46523 3 4 /news/551bc5dd5138b 2 7902 0 0 /news/resultsaugustseptember2020 3 28445 0 0 /southern-counties-east-football-league/39 3 14971 0 0 /news/favershamstarscomeoutforcharity 2 7142 0 0 /news/crowborough150217 1 3223 0 0 /news/robbinswantstoavoidcuphangover 1 3575 0 0 /news/vcdathletic2-2tootingmitchamunited-smithpleasedwithhisattackingoptions 1 6271 0 0 /news/20thdec04.html 1 0 0 0 /news/ifeltbromleymovewasrightformesaysstarstrikeradambirchall 4 18113 0 0 /news/551a97b12a889 1 4436 0 0 /news/successfulchriskinnearreturnstomargate 4 43145 2 2 /news/wevegottogetourselvesoutoftherelegationmiresaysmunday 2 7842 1 0 /news/crayrams150818 5 51871 0 0 /news/greenwich080419 4 16156 0 0 /news/iamconfidentwecanchallengetoachievetheclubspromotiongoalsaysbearsbosstonycornwell 1 3551 0 0 /news/whuchar060515 3 29147 0 0 /news/ramsgate0-3bishopsstortford-alliaskisforconsistency-ward 1 5546 0 0 /news/31stmar04.html 1 0 0 0 /news/551a931dc3ff8 1 3552 0 0 /news/stroutsisthemissingpieceinthejigsawsaysseager 2 9225 0 0 /news/kentleague/cray/crayvhern121103.html 1 0 0 0 /news/551a9cf5a5358 1 4642 0 0 /news/doverathleticunveilchriskinnearastheirnewboss 2 7376 0 0 /news/rusthall161218 4 15118 0 0 /news/beckenhamtown1-2fisher-billyhensmansgotafantasticfutureinfrontofhimsaysmartinford 2 21622 0 0 /news/familyorientedclubtargetkentleagueinfiveyears 1 4888 0 1 /news/10thfeb05.html 2 0 0 0 /news/chatgill190719 6 62468 1 0 /news/berkhamstedtown1sittingbourne3 3 24780 1 1 /news/hawkingetown241019 2 8304 0 0 /news/551bc5e832612 2 7836 0 0 /news/bromley080220 2 7186 0 0 /news/wellscoachgibbonsreflectsonamixedseason 1 4530 0 0 /news/551a9799872c1 1 5591 0 0 /news/ihopewecangetthejobdoneassoonaspossiblesaysfavershamtownbossrayturner 3 13582 0 0 /news/551bc5deb131d 1 3482 0 0 /news/wewantalloftheboystogivetheirallsaysbromleycoachneilsmith 3 13921 0 0 /news/sct241116 4 13281 1 0 /news/Hernebay231004.html 1 0 0 0 /news/kingshill221118 3 9575 0 0 /news/northwood161004.html 2 0 0 0 /news/551bc5de26471 1 3619 0 0 /news/erithbelvedere3-0lordswood-werenotgoingtomakeiteasyforthemsaysjasonlillis 2 15468 0 0 /news/illsettlefortopfourfinishsaysgorman-exclusive 2 11149 0 0 /ramsgate-2003-2006/3 2 5972 0 0 /news/fridaynightsfixtureleadinggoalscorers 3 11485 0 0 /news/15thJan04.html 2 0 0 0 /news/soccershortswhitstabletowninviteapplicationsforvacantmanagersrole 2 29768 1 0 /news/croydonath020817 1 4196 0 0 /news/werestillnotplayingtoourfullpotentialsayssevenacresidcupassistantmartinreece 3 10631 0 0 /archive-2006-2014/250 3 13310 0 0 /news/maidstoneunited2-3ashfordtownmiddlesex-walkerslamsshockingdefendingfortrophyexit 1 5462 0 0 /news/luchfordwemustcontinueourwork-ethic 1 4632 0 0 /news/wealdstone2-1tonbridgeangels-theseasonsoveradmitsangrywarrilow 2 14834 0 0 /news/fleetchairmanexplainsticketpriceincrease 1 3675 0 0 /news/sheppey110920 3 12410 0 0 /sitemap/news.xml 2 94438 0 0 /news/knightrelishinghisreturntodover-exclusive 2 11883 1 1 /news/19thaug03.html 2 0 0 0 /news/551bc5e313487 2 13460 0 0 /news/551a96779e7ed 3 11298 0 0 /news/BromGoldberg030415 4 21194 0 0 /news/kentleague/deal/Martin1.html 1 0 0 0 /news/wecriedwhenwemissedoutonawembleyfinalrecallsbeatensemi-finalisttommywarrilow 1 4240 0 0 /news/facupfourthrounddraw 3 8645 0 0 /news/ifweplaytoourmaximumpotentialbathwillbeinforatoughgamesaysfleetbossstevebrown 3 11504 0 0 /news/farnobg310716 2 6806 0 0 /news/551a931dd8b42 2 8126 0 0 /news/crayrams291117 2 21856 0 0 /news/arlesey140804.html 2 0 0 0 /assets/ckeditor/plugins/preview/preview.html 1 176 0 0 /news/longhurstringsthechangesforcupreplay 1 3980 1 0 /news/cosgroveconfirmshisinterestinwatts-exclusive 1 4729 1 0 /news/kentcounty/thamespoly20thjuly03.html 2 0 0 0 /news/therewasnomaliceinwattspushinsistsburman-exclusiveinterview 4 15831 1 1 /news/gettingthroughwillbeagreatachievementsaysradbourne 1 3810 1 0 /news/kentfaunveilsponsorshipdealforseniorcup-kentcountycupdrawspublished 2 10368 0 0 /news/cray-wanderers.com 1 0 0 0 /news/crayvalleyB240320 2 8102 0 0 /news/bromley4-0londonbari-weachievedeverythingthatwewantedsaysmarkgoldberg 1 8062 0 0 /news/cugleyremainsupbeatdespitelosingfourplayers 1 5996 0 0 /news/551bc5e760e05 2 9458 0 0 /news/jasonlillisreturnstomanagelordswoodandbringsfamilarfacesbackwithhim 2 9091 0 0 /news/theweekahead-6 1 4233 0 0 /news/alliwantforchristmasaresomemorepointssayswhitstabletownbossnickysouthall 1 4327 0 0 /news/pitchero.com/clubs/afccroydonathletic/ 2 0 0 0 /news/thechairmanwantstogetoutofthisleaguesayshuntley 1 4354 0 0 /news/tonbhamp270216 4 36042 0 0 /news/sheppey021218 4 16626 0 0 /news/551a9798a1e3b 4 20453 0 0 /news/vcdathletic110720 6 20203 0 0 /news/advertisingrates 3 8171 0 0 /news/tonbridgeangels4-2bromleycoxwecancompetewiththeproclubs-exclusive 2 12538 0 0 /news/14thdec03.html 1 0 0 0 /news/whittoot070315 3 24955 0 0 /news/kingstonian5-1sittingbourne-wegiftedthemfivegoalsadmitslovell-exclusive 2 13196 0 0 /news/cheltonb170220 2 12506 0 0 /news/551a9c9176d01 2 7704 0 0 /news/551bc5dfca052 1 4215 0 0 /assets/uploads/content/Woodstock_Sports.htm 1 8930 0 0 /news/metcalfiknowthechallengesthatlieaheadatlordswood 2 8675 0 0 /news/folkestoneinvicta4-1whitstabletown-werenotgoodenoughadmitsafuriouspeternott 2 16203 1 1 /news/erithandbelvedere170120 4 16232 0 0 /news/favershamtown0-1tunbridgewells-teenagestopperhodgsonwinstheplaudits 2 16352 0 0 /news/21stoct03.html 1 0 0 0 /news/lordswood1-2tunbridgewells-thosethatworkhardestgettherewardsinlifesaysmartinlarkin 3 27337 0 0 /assets/ckeditor/plugins/templates/templates/ 1 389 0 0 /news/chatham010516 5 24361 0 0 /news/ourfootballisoutofthisworldsayswelford 2 8948 0 1 /news/doverathleticfreezethecostofseasontickets 2 7079 0 0 /assets/uploads/content/sponsors/ 7 3458 0 2 /news/longhurstwaitsforoffersafterleavingchathamforhavingadifferenceofopinion 2 8598 0 0 /news/15thsept05.html 2 0 0 0 /news/ashford070618 4 13157 0 0 /news/leemorgan280416 4 14726 0 0 /news/iwillnottoleratepoordisciplinenextseasonsaysdolby 1 3996 0 0 /news/sittdavis090415 3 13112 0 0 /news/wevegotanimportantmonthcomingupsaysburman 1 4440 0 1 /news/sevewhit200819 4 37758 0 0 /news/stonesraisefundsthroughsellingcarparkspaceatjameswhatmanway 1 4429 0 0 /news/hopefullystrikerandyconstablecangoonarunandproveeveryonewrongsayskeithmcmahon 1 4204 0 0 /news/551bc5e02ee7e 3 12341 0 0 /news/letsgetintothoseplay-offsurgespennock-exclusiveinterview 2 8848 0 0 /news/invictachairmanhasaclubtobeproudoff 1 4920 0 0 /news/croydon240818 1 4316 0 0 /news/holmesdalewillnotcometohernebayandliedownwarnssimonhalsey 1 3944 0 0 /news/heybridge160405.html 2 0 0 0 /news/erithandbelvedere070804.html 1 0 0 0 /news/erithbelvederebossmattlonghursthailsthetogethernessandmaturityofhisplayers 3 12413 0 0 /news/drmartens/premier/dover/23rdjuly04.html 1 0 0 0 /news/suttonunitedsignramsstrikerballforundisclosedfee 2 6711 0 0 /news/myplayerswouldplayformefornothingsaysthamesmeadtownbosskeithmcmahon 2 9856 0 0 /news/harrysmith210517 2 7297 0 0 /news/beckcrow080317 1 12506 0 0 /news/bromley080216 4 15438 0 0 /news/rusticsdealtstrikerblows 3 8695 0 0 /news/february2010results 2 12948 0 0 /news/stonesdefenderontrialwithpremierleaguemiddlesbrough-exclusive 1 3937 0 0 /erith-town-2003-2006/ 1 2999 0 0 /news/thehardworkstartsheresaystable-toppingburman 1 4319 0 0 /news/chathamtown0-2withamtown-icantreallyfindanythingpositiveaboutgameadmitskeithlevett 4 30120 1 1 /news/lewisham281217 3 11565 0 0 /news/resultsaugustseptember2010 1 7945 0 0 /news/afcwimbledon1margate2 3 19716 0 0 /news/kentleague/tunbridgewells/21stoct04.html 1 0 0 0 /news/bromley270817 2 7675 0 0 /news/551bc5e38b923 1 6366 0 0 /news/551bc5e172656 9 127310 6 7 /news/tonbridgeangels260620 2 6056 0 0 /news/margaterelisheagerlyanticipateddons 3 15175 0 0 /news/lordswood250920 7 25256 0 0 /news/stonebridgeshowdownitsagameforthefanssaysdaish 2 17672 0 0 /news/ourfansbehaviourtowardssuttonmanagerwastotallyunacceptable-saystonbridgesecretary 2 9401 1 0 /news/kentleague/sevenoaks/12thaug04.html 1 0 0 0 /news/whiteunveilsthreetransfertargets 2 7552 0 1 /news/wereaheadofourmonthlytargetrevealshessenthaler 2 8089 0 1 /national-league/31 2 9118 1 0 /news/sittvfish120404.html 2 0 0 0 /news/NationalLeagueStatement200121 3 16990 1 1 /news/holmesdale2-0craywanderers-wecantgettoocarriedawaysaysholmesdalecoachrossmitchell 2 14084 0 0 /news/dealtownhasagreathistoryandiamproudtobemanagersaysalbiebarker 2 12471 0 0 /assets/datetimepicker/screen/ 6 2394 0 0 /news/bromcharl260116 5 44822 1 1 /news/mcmahonverypleasedwiththamesmeadsstart 1 3465 0 0 /news/551bc5d9ef9b0 2 7478 0 0 /news/17thoct05.html 2 0 0 0 /news/drmartens/premier/dover/15thjuly03.html 2 0 0 0 /news/apmcontrast3-3farnborougholdboysguild-thefuturelooksgoodsaysfobgbossdarrenburkett 1 8704 0 0 /news/24thmar05.html 1 0 0 0 /news/elthampalace3-1apmcontrast-sansirotogreencourtroadisadropforwright-terrynaden 2 37613 1 1 /news/soccershortsfleetsettohanddaishanewcontract 2 15377 0 0 /news/chipstead240905.html 1 0 0 0 /news/wellingunited250519 4 13589 0 0 /news/551a9bb000192 3 12354 0 0 /news/margate211120 6 22056 0 0 /news/drmartens/eastern/fisher/19thfeb04.html 1 0 0 0 /news/welling140917 1 3987 0 0 /news/kentleague/maidstone/7thJan04.html 1 0 0 0 /news/rymanpremiertitledeciderwehavetobeatourbesttoremovestainesfromtitleracesaysmoore 2 7455 0 0 /news/facupsecondqualifyingrounddraw 2 8453 0 1 /news/sladegreenpulloffmajortransfercoup 2 6348 0 0 /news/sladegreenconfirmkentleaguewithdrawal 4 35365 0 0 /news/27thjuly05.html 1 0 0 0 /news/onthenightthatwhitstablesecuredrymanstatusseagersayswewillmoveforwardnextseason 1 4470 0 0 /news/551bc99a6c794 1 4402 0 0 /news/thamesmeadeyeingoystercatch-exclusive 2 24820 1 1 /news/itsimportantthatwedontstandstilloffthepitchsayswellinguniteddirectorbarryhobbins 3 12102 0 0 /news/551bc5e7afdf8 1 3539 0 0 /news/erith050205.html 1 0 0 0 /news/551a9250af8d1 1 3148 0 0 /news/tenmorepointswillkeepusuppredictschatsboss-exclusive 2 7898 0 0 /news/bromcrys290717 4 37144 0 0 /news/551a96db5d037 2 6912 0 0 /news/551a97b1988fa 1 4747 0 0 /news/sceflpromotionrace050218 2 7078 0 0 /news/greenwich071218 3 13851 0 0 /news/championsdoverbossstartsplanningforrymanpremiercampaign 1 4416 0 0 /news/maincompletstransfertoafcwimbledon 1 4179 0 0 /news/551a956c5e0d8 2 7796 0 1 /news/3rdjan05.html 2 0 0 0 /news/phoelord290719 4 41590 0 0 /news/ryman/bromley/4thjuly04.html 1 0 0 0 /news/dorkwherne120316 4 35018 0 0 /news/glebe0-2bexhillunited-todaywasthefirstblipoftheseasonsaysglebebossrockymcmillan 3 25460 0 0 /news/551a9c0eaea92 4 19242 0 0 /southern-counties-east-football-league/50 4 30655 1 1 /news/drmartens/premier/welling/8thoct04.html 1 0 0 0 /news/wehavetomakereachfieldsalittlebitmoreofafortresssayshythetownbossscottporter 1 3559 0 0 /news/themostimportantthingistowintheleaguesaysblyspartansbossmatthume 1 4225 0 0 /news/5thapr05.html 3 0 0 0 /news/551a979853f9c 2 8233 0 0 /news/margate250517 2 7154 0 0 /news/doverathleticclosinginontransfertargets 1 3350 0 0 /kent-invicta-league/18 2 9975 0 0 /news/werenotarelegationsideinsistsfleetstoppercronin 2 7386 0 0 /news/theclubfeelproudofadeyusuffsprogressatdaggerssayschathamtownbosskevinwatson 4 17794 0 0 /news/canterbury020817 1 3973 0 0 /news/11thaug03.html 2 0 0 1 /news/551a97b27afd8 1 4464 0 0 /news/lordswood310719 4 18822 0 0 /news/maidstoneunitedareupforsale 2 8118 0 0 /news/kentcounty/30thjune.html 2 0 0 0 /news/wereaimingforashighaswecangetsaysholmesdalebossjohn-paulcollier 3 13440 0 0 /news/otford180617 2 8318 0 0 /news/itwouldbegreatifwecouldmaketheplay-offsagainsaysneilcugley 2 8790 0 0 /news/drmartens/premier/dover/braintree280804.html 1 0 0 0 /news/soccershorts100717 5 36718 0 0 /news/wevegotamassivetaskaheadofussayssittingbournebossnickdavis 5 27707 0 0 /news/daishsuffersmacdonaldblow 2 6540 0 0 /news/551a956cde53f 1 4493 0 0 /news/wellbebetterpreparednextseasonsayslisney 2 8395 0 0 /news/soccershortsworkingfootballerstabbedduringg20protests 2 14280 0 0 /news/maidstoneunited070221 4 13110 0 0 /assets/ckeditor/plugins/image/dialogs/ 1 371 0 0 /news/hitchinvfolkefac270903.html 2 0 0 0 /news/milesimplayingkidstooearly-exclusiveinterview 1 4022 0 0 /news/whitstable060419 4 16618 0 0 /news/tunbridgewells3-4croydon 1 5152 0 1 /news/erithbelvedere1-4withamtown-imprettyconfidentresultswillchangesayschriscosgrove 2 19210 0 0 /news/weranaroundlikeheadlesschickens-seager 2 8711 0 0 /news/drmartens/premier/dover/9thdec04.html 1 0 0 0 /news/longdiggins020615 4 27132 1 1 /news/iwillleavenostoneunturnedtomakesurewerepreparedforknaphillsaysjasonlillis 3 10840 0 0 /news/phoenix160917 2 6430 0 0 /news/gillingham3-1stockportcounty-stimsonpraisesthegillssnowmen 1 5435 0 0 /news/margate040416 4 17610 0 1 /news/itwasaveryharddecisiontoleavecrayvalleysaysjoeford 6 30860 0 0 /news/551bc5e029d65 3 18452 0 0 /news/551a956b7d438 3 14178 0 0 /news/bromwrex300318 4 38606 0 0 /news/showdowntalksforcemundaytolookformorequality 1 4489 0 0 /news/drmartens/premier/dover/15thjuly04.html 1 0 0 0 /news/ebbsfleetunited1-0burtonalbion-battlingfleetseffortsallinvain 1 5950 0 0 /news/551bc5da98614 2 9210 0 0 /news/551bc5db09e5f 2 10778 0 0 /news/551a9799c2ae4 1 5072 0 0 /news/551a95b3cd471 1 6072 0 0 /news/rusthall250518 2 6980 0 0 /news/invicta120615 16 109490 6 6 /news/551bc5e1b2451 2 8448 0 0 /news/x-3 3 7519 0 0 /news/abbottpullsofdebollacoup 1 4630 0 0 /news/barkingside3-0erithbelvedere-pressuremountsonchriscosgrove 4 51176 2 1 /news/hollands281016 2 6751 0 0 /news/ourtargetisnotletthetitleracegotothelastgamesaysmetrogasbossroydavies 1 6370 0 0 /archive-2006-2014/198 5 20592 0 0 /news/metrogas300317 3 11285 0 0 /news/trottfacesinterestingtestagainsthighflyingfleet 2 6286 0 0 /news/551a979a4c026 1 4375 0 0 /news/facupfourthqualifyingrounddraw 3 9966 1 0 /news/tunbridgewells5-2favershamtown 2 5144 0 0 /news/551a925031fd6 2 7076 0 0 /news/fisher170716 3 11862 0 0 /news/7thdec03.html 1 0 0 0 /news/greenwich211218 3 11817 0 0 /news/glebe010516 3 13278 0 0 /news/thereslotsthatcouldhappenbeforewegettomondayskentseniorcupfinalsaysstevebrown 4 19993 0 0 /news/drmartens/eastern/tonbridge/20thaug04.html 1 0 0 0 /news/angelsproberamsgatemisdemeanour 1 3570 0 0 /news/craighollowayisanimportantpartofbromleysfuturesaysassistanthaydenbird 1 4503 0 0 /news/24thoct03.html 1 0 0 0 /news/vcdathletic0maidstoneunited2 2 9920 0 0 /news/551bc5e480ad9 1 4957 0 0 /news/551a956cbe261 2 26571 0 0 /news/wehavetomakeebbsfleetunitedaplacesupporterswanttovisitsayschairmanjessicamcqueen 1 5116 0 0 /news/peteroverton240817 1 4315 0 0 /news/itsoutofourhandsbutwellgiveitagoinsistsburman 1 3470 0 0 /news/blamemeifwedontgetpromotedsayswarrilow 2 10013 0 0 /news/kentfootballunited090919 5 26667 0 0 /news/tonbridgeangels1-3suttonunited-shamefuldoswellsanticsmarsfinewin 2 11148 0 0 /news/rusthallfc.com 2 0 0 0 /news/vcdathletic0-0erithbelvedere-theofficialswereembarrasingsaysmickycollins 3 19106 0 0 /news/14thjan05.html 1 0 0 0 /news/MPStatement271120 4 16688 0 0 /archive-2006-2014/275 4 16406 0 0 /news/weneedasliceoflucksaysmunday 2 8157 0 0 /news/erith147sp270316 5 17463 0 0 /news/punjab290617 3 9891 0 0 /isthmian-league/7 5 41904 1 1 /news/shotsconfidentofbreakingfleetshearts 2 8200 0 0 /news/551a9797d1aeb 2 8182 0 0 /news/wewontbetakinghernebaylightlysaystonbridgeangelsbossstevemckimm 3 14261 0 0 /news/jenkinswantscupcashtostrengthenhisteam 2 7081 0 1 /news/551bc5dc57056 2 10400 0 0 /news/punjab290318 3 12804 0 0 /news/ifeelitsabitofacouptoattractsuchayoungtalentsayswhitstablebossjustinluchford 1 3784 0 0 /assets/images/site/banners/ 5 2458 0 0 /news/photographicevidenceofsuttonmanagerdoswelllashingoutonangelsskipperstorey 2 7558 0 0 /news/551bc5e4939b6 1 4235 0 0 /news/itwouldbegreattotakesittingbournetothefacupfirstroundsaysjoint-managerjimward 2 7564 0 0 /archive-2006-2014/187 4 18042 0 1 /news/favks060416 4 35770 0 0 /news/fisherith071215 3 30897 0 0 /news/bromley070920 3 11215 0 0 /news/wellgiveagoodaccountofourselvessaysdoverathleticbosschriskinnear 3 15603 0 0 /news/551a931db760d 2 8303 0 0 /news/kentrivalsleftinthedark 2 8167 0 0 /news/weveconsolidatedourpositioninthekentleaguesayscrayvalleybossstevechapman 1 4392 0 0 /news/551a931e83070 4 20614 0 0 /news/weneedmoreexperienceintherankssayslarkin 1 4450 0 0 /news/werelookinggoodsayssatisfiedvickersbossfoley 2 9790 0 0 /news/kentleague/thamesmead/14thjuly04.html 1 0 0 0 /news/tunwells210417 2 9149 0 0 /news/mysteryinvestorattonbridgeangels 1 3818 0 0 /news/phoenixsports250920 2 7604 0 0 /news/wevegottogotothreebridgeswiththerightattitudesaysmaidstoneunitedbossjaysaunders 5 19537 1 0 /news/551a96db4d5d9 1 5073 0 0 /archive-2006-2014/119 1 4891 1 0 /news/551bc99aab638 1 4051 0 0 /news/tunbridgewells2-2sevenoakstown-exceptionalczannerdeniesten-mansevenoaks 2 15235 0 0 /news/NationalLeague170620 5 18577 0 0 /news/itsbeenalonghardseasonadmitselthampalacechairmanneilproctor 4 15806 0 0 /news/ryman/bromley/16thjuly03.html 2 0 0 0 /news/canterbury220219 4 18758 0 0 /news/kingstonian2-1dulwichhamlet-iwanttobetopattheendoftheseasonsaysgavinrose 1 9142 0 0 /news/doverchairmanwarnsof33budgetcutsiffansstayaway 2 8536 1 0 /news/551a9cf520792 2 11710 0 0 /news/kentleague/tunbridgewells/tunvlordswood130803.html 2 0 0 0 /news/sceflstatement270221 6 20190 0 1 /news/kentleague/cray/2nddec04.html 1 0 0 0 /news/craywands101116 1 3314 0 0 /news/myplayerswillputthingsrightsaysdartsbosstonyburman 1 4512 1 0 /news/551bc5db700ef 4 26186 0 0 /news/wellingtown.co.uk 2 0 0 0 /news/30thdec05.html 1 0 0 0 /news/ifimtopwithonegametogothenillbeverypleasedsayssittingbournebossmattwyatt 3 12713 0 0 /news/21stsept05.html 1 0 0 0 /news/thisisaperiodthattestsandstretcheseveryonessquadssaysbromleycoachhugolangton 3 10961 0 0 /news/woodstocksports0-1erithtown-thistieisntoversayserithtownbosstonyrussell 2 11480 0 0 /news/21stmar05.html 2 0 0 0 /news/ifeelaresponsibilitytostayandhelpgetdartsbacktowhereitbelongssayselliotbradbrook 3 11934 0 0 /news/thepressuresonwhitstablesayssittingbournebossnickdavis 5 22182 0 0 /news/551a931ddaef3 1 4477 0 0 /news/2ndsept04.html 2 0 0 0 /news/ryman/bromley/3rdaug03.html 2 0 0 0 /news/551bc5e87f7a8 3 11221 0 1 /news/billericay191105.html 1 0 0 0 /news/8thjuly03.html 1 0 0 0 /news/wevegotapointtoproveadmitsshearer 2 7765 0 0 /news/551bc5e4f16ef 2 7148 0 0 /news/othernews/gotravelkentleaguetablesfinal2004.html 1 0 0 0 /news/drmartens/eastern/folkestone/bashvfolk081103.html 1 0 0 0 /news/ithinkitsabitsillytosuggestthisisthetitledecidersaysstonesbossjaysaunders 3 18972 0 0 /news/ebbsfleet240817 1 3538 0 0 /news/551bc5e5ea167 2 6760 0 0 /news/welling270517 1 3191 0 0 /news/hernebayhonourgentlemansagreementwithcanterburycitytosharewinchsfield 1 3175 0 0 /news/sittingbourne2-3whitstabletown-seagerproudofhisplayersaswhitstablestayup 2 10258 1 1 /news/huntleyissuesunder-performingbecksafivematchultimatum 2 8629 0 0 /assets/select2/docs/announcements-4.0.html 1 7248 0 0 /assets/ckeditor/plugins/flash/dialogs/ 1 373 0 0 /news/itwasclearchrissmallinghadthepotentialtoplayatamuchhigherlevelsaysproudlloydhume 1 4785 0 0 /news/paulfoley230617 2 8844 0 0 /news/bromley0-4doverathletic-itsthelowestpointoftheseasonadmitsbromleybossmarkgoldberg 2 18982 0 0 /news/englandinternationalsettleshisfuturehereinkent 2 6991 0 0 /news/rusthall1-3sevenoakstown-itwasagooddayforussayssevenoakstownbosssimonjones 1 8025 0 0 /news/doverathleticunveilmartinhayesastheirnewboss 1 3527 0 0 /news/drmartens/premier/dover/17thsept04.html 1 0 0 0 /news/wegotolordswoodingoodspiritsdespitefirstlossinelevengames-luchford 2 7063 0 0 /news/ebbsfleet140717 1 3406 0 0 /news/551a9c925dcd5 3 15995 0 0 /news/lordswood201016 2 8107 0 0 /news/ramsgateskipperbenlasletthailsfamilyteamspirit 1 3860 0 0 /news/faversham190620 2 7116 0 0 /news/itwouldbeniceifthosetwo-and-a-half-thousandfansreturnsaysdoverathleticchairman 1 3722 0 0 /news/refereekevinwelshformsacademyatfavershamtown 1 4019 0 0 /assets/select2/src/js/ 5 2162 0 0 /news/19thoct04.html 1 0 0 0 /news/myhonestycostmemyplacewithstonesadmitsroyston-exclusive 1 5348 0 0 /news/hernebay190417 1 3167 0 0 /news/551bc5e04a3e7 3 17546 0 0 /news/croydonchairmansu-turnstunstompkins 2 9301 0 0 /news/drmartens/eastern/dartford/26thoct04.html 1 0 0 0 /news/thebudgetsenoughtochallengeagainforpromotionagainnextseasonsaysdoverathleticchairman 2 9326 0 0 /news/crewealexandrareduceticketpricesforfleetsvisit 1 3686 0 0 /news/bromleyacademyachievesuccessonandoffthepitch 6 28178 0 0 /news/IsthmianLeagueStatement150121 6 54480 1 1 /news/mcmahonplaylikethatagainandwellgetknockedout-exclusive 1 4209 0 1 /news/ideotford030515 3 16151 0 0 /news/iknewboydwasdestinedforthebig-timerecallsbinks-exclusiveinterview 1 4921 0 0 /news/drmartens/premier/welling/6thoct03.html 1 0 0 0 /news/eastleigh050205.html 2 0 0 0 /news/20thfeb05.html 2 0 0 0 /news/millwall080718 3 12145 0 0 /news/kentleague/lordswood/7thjuly03.html 2 0 0 0 /news/sevenoakstown1-3whitstabletown-seagersmenpilepressureonvickers 1 5897 0 0 /news/wewanttostayinthiscompetitionforaslongaspossiblesaystommywarrilow 5 24287 0 0 /news/FAStatement090420 5 31427 0 0 /news/moorearnoldgivesuscompetitionfornumberonespot 4 33096 0 1 /news/dartford3-2wellingunited-dartsshininglightsstunwings 2 12758 0 0 /news/werenotlookingforanythingelseotherthanpromotionsaysmargatebossterrybrown 4 19490 0 0 /news/ramsdale050516 4 17362 0 0 /news/idontthinktherewillbeabettercentreforwardinnon-leaguefootballsayskeithmcmahon 5 36077 0 0 /news/bromley140617 2 10076 0 0 /archive-2006-2014/52 2 10191 0 0 /news/beckinghamasksforpatienceashebidstoputtramsbackonrighttrack 1 4856 0 0 /news/hollands230916 2 6854 0 1 /news/doverathletic0-2hastingsunited-doverchairmanpromisesachangeofstructureatcrabble 1 5900 0 0 /news/13thapr04.html 1 0 0 0 /news/apmcontrast110316 8 87775 4 3 /news/551bc99ace1ba 1 5578 0 0 /news/goalscoringmachineabbottgivenall-cleartomakecomeback-exclusive 1 5039 0 0 /news/ireallybelievefavershamwillmaketheplay-offsthisseasonsaysfolkestonebossneilcugley 3 12245 0 0 /news/551a9c929b00a 1 4678 0 0 /news/corinthian-casuals1-2bridonropes-ifanciedustoturnitroundsaysdanielfrost 7 80698 1 1 /news/hernebay3-1lordswood 1 5859 0 0 /news/chathamtownfc.info 2 0 0 0 /news/itsabouttimewebeattheangelssaysward-exclusiveinterviews 2 10935 0 0 /news/iveneverbeeninvolvedinsuchatightleaguesaysangelsstrikeradrianstone 1 4100 0 0 /news/wealdstone121105.html 2 0 0 0 /news/wemustavoidslippingupagainstcasuals-langton 2 7258 0 0 /news/folkve&B120404.html 2 0 0 0 /news/gravholm180917 3 12465 0 0 /news/wehavetogiveravensachancetodevelopsayscouncilleader 2 7650 0 0 /news/soccershortswarrilowblastsrefyousent-offthewrongman-poutonquitsstones 1 10225 0 0 /news/margateunveilterrybrownastheirnewboss 1 5210 0 0 /news/margatewaryofstonesstrikerbeckford 3 11605 0 0 /news/chessingtonvsladefr260703.html 2 0 0 2 /news/ourhomeformisgoingtochangesaysdoverathleticbosschriskinnear 3 18090 0 0 /news/rawplayerslookingtoshineathernebay 1 3515 1 0 /news/kentclubsunveilstadiumplans 1 4444 0 0 /news/abbottsignsformertractorboyintimefortrophytie 1 4679 0 0 /vcd-2003-2006/2 2 5758 0 0 /news/hopefullywecancomeawaywithalionsshareofthepointsoverthechristmasperiod-hayes 2 9250 0 0 /news/551a956cc3825 2 12496 0 0 /news/15thdec03.html 1 0 0 0 /news/lordswood140815 4 17998 0 0 /news/iwillgethernebayintorymansouthsayssimonhalsey 1 5342 0 0 /news/tuncor120816 6 136583 3 2 /news/soccershortsweareableforthefirsttimetoatttractplayerslikeademolasaysbromleyboss 4 27289 0 0 /news/551a97b0b4cec 1 4627 0 0 /index/index/andiro 1 4630 0 0 /news/whitstable120205.html 1 0 0 0 /news/theroadtowembleytimetocastyourvoteonourmainmatch 2 6682 0 0 /news/wereupforthechallengeinsistsseager-exclusiveinterview 3 13705 0 0 /news/idlovetogoupsayslyddtownbossdavesmith 2 9222 0 0 /news/551a9b481acba 4 13102 0 0 /news/ijumpedatthechancetobringshaunwelfordtomargatesaysbossiainoconnell 1 5463 0 0 /news/dulwichhamlet3-1hendon-theresnolimithowgoodtheycanbecomesaysgavinrose 5 39441 0 0 /news/bromleys13-mansquadseekrevengeonharrow 4 15218 0 0 /news/10thdec04.html 2 0 0 0 /news/wevegot12gamestodecideourseasonsaysmaidstoneunitedbossjaysaunders 1 4891 0 0 /news/werealongwayfromthefinishedarticlesaysward 1 5190 0 0 /news/5thnov04.html 2 0 0 0 /news/ramsgate230916 2 6356 0 0 /news/stocthat200518 7 35170 1 1 /news/nowisthetimetostanddownsayshythetownchairmanpaulmarkland 3 11038 0 0 /news/ashbyplaysthewaitinggame 1 3558 1 0 /news/551a931ec327b 2 9472 0 0 /news/thebestisstilltocomeinsistswarrilow 1 4158 0 0 /news/551bc99c2ee8c 1 5215 0 0 /news/obrienhasnoproblemwithchathamtownbudgetcut 2 10047 0 0 /news/croydon230117 1 3376 0 0 /news/iwillnotbeforcedintopanicbuyingsayswarrilow 1 5004 0 0 /news/sevenoakstown3-3sladegreen 6 48154 0 1 /news/bromley010118 3 13872 0 0 /news/tauntontown101220 1 5712 0 0 /news/kentfootballunited081118 6 20456 0 0 /news/30thoct05.html 3 0 0 0 /news/551bc5dde7aab 1 3912 0 0 /archive-2006-2014/47 4 20426 0 0 /news/itswinorbustforramsineasterscrambleforplay-offs-exclusive 2 9770 0 1 /news/wehavethebelieftoqualifyfortheplay-offssaysangelsbosswarrilow-exclusive 1 4578 0 0 /ashford-2003-2006/3 3 8958 0 0 /news/tonbridgeangels1-1bromley-imsurewellcrawlourwayoutoftroublesaysmarkgoldberg 1 8148 0 0 /news/551a9797dc429 4 16077 0 0 /news/ebbsfleetunitedunveiltheirnewmanagementteam 6 23977 0 0 /news/vickersbossfoleyaddsanotherstonetohisranks 1 3996 0 0 /news/hythe021015 12 119832 7 7 /news/fatrophyfirstrounddrawiwanttoleaddoveroutatwembleysayshessenthaler 1 5556 0 0 /news/kfu290617 32 129417 29 29 /news/551bc5e29f8ad 1 3086 0 0 /news/threebridges1-4favershamtown-weveshownagooddegreeofcharactertonightsaysrayturner 2 18920 0 0 /news/ryman/bromley/wortvbrom081103.html 1 0 0 0 /news/daishupbeatgoingintooxfordtrip 1 3834 0 0 /news/551bc5e750ccf 1 3295 0 0 /news/crayafcw160317 2 17358 1 1 /news/551bc5e5d6092 3 13438 0 0 /news/doverathleticsignfive-figuresponsorshipdealwithseafrance 2 16908 1 1 /assets/qz-print/ 8 3237 0 0 /news/corinthian070918 4 15010 0 0 /news/fisher301020 2 7128 0 0 /news/weneedhelptoprogresssaystreblewinningblairboss 2 9150 0 0 /news/tonbridgeangels130720 2 5880 0 0 /news/borehamwood260205.html 2 0 0 0 /news/dartsexpectanothersternfitnesstestagainstgills 1 3869 0 0 /news/glebe100119 4 12554 0 0 /news/imsearchingforfirepowerupfrontsaysoconnell 1 3482 0 1 /news/craywands180118 1 3684 0 0 /news/wehavethemakingsofanexcellentteamadmitslillis 1 3092 0 0 /news/551bc5e242893 1 3022 0 0 /news/eastthurrock031005.html 2 0 0 0 /news/551bc5e1e01fb 2 8472 0 0 /news/suttshep230416 4 40448 0 0 /news/othernews/29thjune03.html 2 0 0 0 /news/thesethingsaresenttotestourresolvesaysfolkestoneinvictachairmanmarkjenner 1 5306 0 0 /news/551bc5e34bcb7 1 4406 0 0 /news/rusthall110520 3 10057 0 0 /news/soccershorts300516 6 52098 1 1 /news/tunwells030915 4 18337 0 0 /news/551bc5e34201f 3 15625 1 0 /news/fisher240417 2 13487 0 0 /news/sevenoakstown2-2sporingbengal-weplayedlikeapubsideadmitssevenoaksbosskeithlevett 1 8354 0 1 /news/551a9c0e66a03 1 3005 0 0 /news/kentleague/sladegreen/7thjuly03.html 2 0 0 0 /news/wearelookingfortheyoungsterstoshowcasetheirtalentssaysfavershambossjustinluchford 1 4362 0 0 /news/leagueformgoesoutofthewindowinthefacupsayshessenthaler 1 4772 0 0 /news/551a956cd4f7b 1 4603 0 0 /news/wellingsignformernorthernirelandinternational 4 12965 0 0 /news/kentleaguetitledualitswhitstablestolosenowsaysfrost-exclusive 2 9142 1 0 /news/kentleague/cray/cray.html 1 0 0 0 /news/551bc5e41fd98 2 9310 0 0 /news/bromalde191019 5 50057 0 0 /news/551a96dc2a751 4 26670 0 0 /news/marglaslett180515 4 23513 0 0 /news/551a99e54237e 1 5302 0 0 /news/sevenacre080416 4 13888 0 0 /news/ramsgate261018 4 19102 0 0 /news/burmanputsdovershowdowntothebackofhismind 1 4029 0 0 /news/wevegotnothingtoproveinsistsholmesdalecoachrossmitchell 2 9201 0 0 /news/kentcountyleague050520 2 8576 0 0 /news/trottsearchesfortrainingbase-exclusiveinterview 2 7778 0 0 /news/551bc5e6c073d 3 19352 0 0 /news/wellingunited221119 2 7454 0 0 /news/kspodeal070920 6 50006 1 1 /news/thisisthestuffthatdreamsaremadeofsaysgarathmccleary 1 3473 0 0 /news/anyonewhocomesinmustbetherightfitfortheclubsayslewishamboroughchairmanraysimpson 1 3885 0 0 /news/frenchpairawaitforcugleysdecision 5 25784 0 0 /news/fisher1-2tunbridgewells-wellkeepgoinguntilthemedalsaregivenoutsaysmartinlarkin 2 18174 0 0 /news/doverathletic140221 4 13726 0 0 /news/27thfeb04.html 1 0 0 0 /news/orpington5-0crockenhill-weknowweregoingtobeupagainstitadmitscrocksbosscraigclark 2 19768 0 0 /news/4thjuly04.html 1 0 0 0 /news/ifeelihavealottoofferchipsteadsaysurbanrapartistmrrootsy 17 280124 11 7 /news/11thfeb05.html 3 0 0 1 /news/551a931d97673 1 3725 0 0 /news/thamesmeadtownbosskeithmcmahonhailsashleyprobetssigning 2 6725 0 0 /news/slouvbrom121103.html 1 0 0 0 /news/551bc99d39af9 1 4873 0 0 /news/wevegotagreatchanceofprogressingsaysthamesmeadbosskeithmcmahon 1 4725 0 0 /assets/images/icons/payments/ 5 2509 0 0 /news/551bc5e71b4a6 3 16321 2 1 /news/eastdart200419 3 30180 0 0 /news/551a967797d54 1 3668 0 0 /news/ianvarley191117 2 7449 0 0 /news/stonesconfirmhomelandsgroundsharedeal 1 3591 1 0 /news/rawlekeentostayonwithfleet 3 9629 1 0 /news/551a97b14712a 1 5278 0 0 /news/dartsfansraise1500frominternetauction-cassrejectsdovermove 1 3536 0 0 /news/kentleague/ramsgate/11thmar04.html 1 0 0 0 /news/rochester310818 4 13602 1 0 /news/tunbridgewells0-4erithbelvedere 2 7764 0 0 /news/551a967895330 3 22434 0 0 /news/31stjan04.html 1 0 0 0 /news/onagooddaybromleywillbeatanyoneintheleaguewarnsdoverathleticbosschriskinnear 3 12283 0 0 /news/wehavetoraisethebaralittlebitagainsayswellingunitedbossjamieday 1 4783 0 0 /news/conference/gravesend/11thaug04.html 1 0 0 0 /news/kentstarscomeoutinforcetohonoursyko 1 3653 0 0 /news/maidstone100519 3 9990 0 0 /news/snodlandtown180920 3 11420 0 0 /news/whitstabletownreceivefifteenapplicationsforvacantmanagersrole 1 3820 0 0 /news/homegrowntalenthaskeptusupsayscugley-exclusive 1 3899 0 0 /news/bromtorq120917 1 9755 0 0 /news/551bc99c7fb39 1 6997 0 0 /news/wellwest251117 3 25770 0 0 /news/punjab111019 3 10482 0 0 /news/phoetonb311015 3 28314 0 0 /news/damiannotabletocommithimselftofolkestone 2 7854 0 0 /news/thamesmeadkick-startspicesfootballingcareer 1 4027 0 0 /news/oneyearsomeonewhospart-timewillgetintoplay-offssaysdartfordbosstonyburman 5 24475 0 0 /news/dagebrom040919 4 36288 0 0 /news/billericay190305.html 2 0 0 0 /news/kentishfootballaresoproudofthefleetdaishhailshismagnificentheroes 1 4697 0 0 /news/wehavealottoliveuptoadmitsfirkins 1 4048 0 0 /news/wandsgiveyoungstersachancetoshine 2 9432 0 0 /news/backingthefleettowembleyglorygettingtowembleyagainwillbeagreatachivement-lovell 2 8167 0 0 /news/wetakeyouthfootballveryseriouslysayserithtownbosstonyrussell 1 4281 0 1 /news/dartford270905.html 1 0 0 0 /news/thefatrophyismassivelyimportantforclubsatourlevelsaysramsgatebosstimdixon 2 9039 0 0 /news/ashfordunited1-2phoenixsports-wevegotachancenowwehavetotakeitsaystonybeckingham 3 28712 0 0 /news/551a97b21f51b 1 4540 0 0 /news/craywanderers4-1corinthian-casuals-jenkinsplansfortitledecider 2 10822 0 0 /news/ksports291216 4 16456 0 0 /news/greeniesfridaypreview 4 25680 0 0 /news/conference/news/29thjune03.html 2 0 0 0 /news/theroadtowembleyitsfolkestoneinvicta 2 5510 0 0 /news/bromley140819 3 13826 0 0 /news/wewanttohaveagoodpositiveendtotheseasonsayschathamtownassistantmanagerkeithlevett 2 8864 0 0 /assets/fileman/tmp/ 5 1573 0 0 /news/wemustlearnfromourmistakessaysseager-exclusive 1 4320 0 0 /news/doverathletic1-0horshamymca-ourworstperformanceoftheseasonadmitshessenthaler 2 10070 0 0 /news/wemustputbarrenspellbehindussayslovell 2 7780 1 0 /news/ihaveaqualitysquadbutitstakingawhiletogeladmitscrayvalleybossstevechapman 1 3606 0 0 /news/551bc5e28f88a 3 15631 0 0 /news/fisher0-1erithtown-everygameisahardgameinthekentleaguesaysraypowell 2 15317 0 0 /news/maidstoneunited0-1afcwimbledon-wegaveitourallsaysaproudhume 2 13000 0 0 /news/hythe19102015 4 13738 0 0 /news/sittingbourne1-0horshamymca-hichamakhazzangotusoutofjailadmitsgaryabbott 1 7349 0 0 /news/abbottwewontbeontheendoffacupshock 2 7827 0 0 /news/rusthall190217 3 17046 0 0 /southern-counties-east-football-league/25 8 38352 0 0 /news/551a925067b79 2 8940 1 0 /news/othernews/coneyhall210804.html 1 0 0 0 /assets/fileman/js/ 8 4627 0 0 /news/wellelms091217 2 21946 0 0 /news/hernvslad061203.html 1 0 0 0 /news/wealdstone1-0margate-welooktowinourlastthreegamestostayup-oconnell 1 5936 0 0 /news/drmartens/eastern/folkestone/hastvfolk151103.html 1 0 0 0 /news/551a97989542e 4 19329 0 0 /news/fleetplanforhattersvisit-1 1 3534 0 0 /archive-2006-2014/249 3 13217 1 0 /news/551bc99cdd1ad 1 4842 0 0 /news/werelookingtogetasmanypointsontheboardearlyonsayshernebaybosssamdenly 3 10853 0 0 /archive-2006-2014/172 3 13358 0 0 /news/injuriestokeydefendersgivesopportunitiestoothers 1 3682 0 0 /news/stonesdropstroutsbombshell 2 7774 0 0 /news/551bc99e38d6d 1 5542 0 0 /news/nuneaton051105.html 3 0 0 0 /news/wedontwantramsgatetobethefirstsidetodothedoubleoverussaysneilcugley 1 4154 0 0 /news/551a956bb6f22 1 3938 0 0 /news/kentseniortrophyfinalmcmahontellsvcdwecanhandlepressurecanyou-exclusive 1 4839 0 0 /news/551a979818094 1 3136 0 0 /news/551a99e4a4b04 4 39165 1 0 /news/croydonchairmandontturnyourbackontheclubforengland-exclusive 1 4264 0 0 /news/itsgoodtohavemorrishbacksaysheaslewood-exclusiveinterview 1 4815 0 0 /news/551a95b42f4b1 1 6667 0 0 /news/inconsistencyseparatesusfromthebigboysadmitsdolby-exclusiveinterview 2 9600 0 0 /news/hemelhempstead091019 6 20150 0 0 /news/551bc5e60c4af 1 3888 0 0 /news/tonbridge260118 1 3816 0 0 /news/bromley230518 3 14592 0 0 /news/staplehurstbossquitsduetoalackofcommitmentfromhisplayers 1 3252 0 0 /news/resultsfebruary2014 2 22152 0 0 /assets/fonts/academy/ 5 2063 0 0 /news/stainestown2-2tonbridgeangels-angelsoutclassstainesinplay-offfinaldressrehersal 2 13634 0 0 /news/itmeansalottotheclubtoremaininthesouthsaysfoley 1 4503 0 0 /news/FACupSecondRoundDraw111119 2 6232 0 0 /news/sittvroth030104a.html 2 0 0 0 /news/fleetladiesarrangefriendlyatstonebridgeroad 5 17659 0 0 /news/551a96788acc7 3 20274 0 0 /news/folkestoneinvictap-pstainestown 1 2646 0 0 /news/matchreportswaitfinallyendsforstroutsandluchford 4 54326 1 2 /isthmian-league/45 2 9358 0 0 /news/myremitisonlytokeepwhitstablesrymanleaguestatussayscaretakerlane 1 4923 0 0 /news/sevenoakstown4-2horleytownsevenoaksdreamoffleetyouthcuptie-exclusiveinterview 2 11390 0 1 /news/dontthinkbecausewehavealittlebitmoremoneywewillbeguaranteedsuccesssaysdannyward 3 11450 0 0 /news/dontruleusoutinpromotionracesaysashfordchief 2 9877 1 0 /news/margate220421 69 286697 3 29 /news/gormandoesntwanthissidetocrackovereasterperiod-exclusiveinterview 1 3837 0 0 /news/sevenoakstown2-4folkestoneinvicta 1 4592 0 0 /news/551a956b8c532 1 3054 0 0 /news/weremoreexperiencedtohandleplay-offssaysdaish 1 3927 0 0 /kent-county-league/9 5 38015 1 1 /news/bromley130217 4 20022 0 0 /news/ramsgate0-1dartford-impleasedwiththedirectionwereheadingsaysburman 1 5426 1 0 /news/weletourselvesdowninthefacupadmitserithbelvederebossmartinford 5 23397 0 0 /news/sctmasonsimms130219 2 6386 0 0 /news/drmartens/eastern/folkestone/8thjuly03.html 2 0 0 0 /news/fordkeepshisnewquartetclosetohischest 1 3924 0 1 /news/ryman/bromley/bromvtilburyfr050803.html 2 0 0 0 /news/wehaventpaidsillymoneytobringfranniecollintomaidstoneunitedsaysbossjaysaunders 5 21150 0 0 /news/kennington030120 3 10736 0 0 /news/kentleague/thamesmead/winchester111204.html 1 0 0 0 /news/551a9cf594e9b 1 4358 0 0 /news/maidstone250517 2 6456 0 0 /news/kentleague/sevenoaks/31stoct04.html 1 0 0 0 /news/ramsgate091218 4 14684 0 0 /news/bromley220715 4 20013 0 0 /news/8thapr05.html 3 0 0 0 /assets/ckeditor/plugins/flash/ 5 1874 0 0 /news/wewanttomoveforwardafterthesuccessoflastyearsayshythetownbossscottporter 1 4128 0 0 /news/westwickhamplotanothertrophyupset 1 3681 1 1 /news/warrilowbutthebottomlineisstillthatthemostimportanttargetistogetoutofthisleague 1 3788 0 0 /news/ourlastfourgameshastakenitstollsayssittingbournebossgaryabbott 2 7203 0 0 /news/cugleyexplainspipersdeparture 1 3541 0 1 /news/thereiscompetitionforplacesupfrontsayswellingunitedbossjamieday 1 3215 0 0 /news/pleaseconsidermakingadonationtohelpwithrunningcosts 2 5406 1 0 /news/tonbridge290916 2 6872 0 0 /news/wellfinishhigherthanmargateforthefirsttimein47yearssaysward 2 10737 0 0 /news/whyteleafe030905.html 2 0 0 0 /news/gravesend170704.html 2 0 0 0 /news/versatilelyebolstersdoversquad 1 3014 0 0 /news/aclublikefishershouldntbebottomoftheleagueinthefirstplacesaysmartinford 2 11714 0 0 /news/craywands241117 2 8095 0 0 /news/551a9cf4ccbaf 1 4264 0 0 /news/humehitwithsix-matchtouchlineban 1 3380 0 0 /news/wellwell060717 3 28891 0 0 /news/kentleague/VCD/29thjune03.html 2 0 0 0 /news/doverathletic3-0tonbridgeangels-doverareunstoppableatfortresscrabble 2 10864 0 0 /news/wevegotplayerswhocanperformonthebigstagesayswarrilow 1 4584 0 0 /news/craywanderers3-1thamesmeadtown-isaidwewouldjustconcentrateonthefootball-joefrancis 3 26285 0 1 /news/dartfordsprincesparkshowcasestopinternationalyouthfootball 2 7628 0 0 /news/iwillnotpayovertheoddsforplayersinsistslovell 2 9298 0 0 /news/551bc5de8b0ea 1 5381 0 0 /news/wecanlookupandfightourwayintothelightssaysbromleydefendertutuhenriques 1 5832 0 0 /news/officialsontheendofcoldblastfromfrancis 1 4868 1 0 /news/551bc5e7a1825 2 8578 0 0 /news/wellingunited1-1woking-forustoimproveweneedmorefanscomingsayswellingbossjamieday 3 25495 0 0 /news/lordswoodu18050904.html 1 0 0 0 /news/cantcray270419 7 76071 0 0 /news/FAStatement040121 6 30155 1 1 /news/chips250515 4 27110 1 1 /news/charltonwomen070618 6 26084 0 0 /news/551a9c9254911 3 14123 0 0 /news/551a9677a6096 1 4812 0 0 /news/551a925059278 2 6955 0 0 /news/kentleague/sevenoaks/dealtown250904.html 1 0 0 0 /news/sevenoakstown1-1maidstoneunited-ivegotreallyhighhopesforusthisyearsaysmickycollins 4 36994 0 0 /news/braintree191105.html 2 0 0 0 /news/roystonreturnstostones 3 9568 0 0 /news/551bc5e1cbaf2 2 9032 0 0 /news/fiskchallengeshisplayersprovetomeweveturnedthecorner 2 7782 0 0 /news/eastthurrock280305.html 2 0 0 0 /news/werenotunderpressuretowintheleaguesaysfolkestoneinvictabossneilcugley 1 4378 0 0 /news/wehavetobereadyforabattlewarnswellingunitedbossjamieday 2 7194 1 0 /news/seldongetsangelsbacking 1 4713 0 0 /news/25thapr04.html 2 0 0 0 /news/wortfolk190316 4 35802 0 0 /news/hythetown6-2beckenhamtown-hythearehalfwaytoparadisesaystommysampson 1 8742 0 0 /news/sheppey080419 5 21582 0 1 /archive-2006-2014/22 3 14747 0 0 /news/welling081015 3 10983 0 0 /news/trottimbuildingateamofwinners-exclusiveinterview 1 5548 0 0 /news/wellingunited090120 4 19036 0 0 /news/ihopemyteamperformtwogamesinarowsayscroydonbossdicksongill 3 12506 0 0 /news/fisher030717 5 19864 0 1 /news/letsmakeitamemorabledayforkentfootball 2 5723 0 0 /news/phoenixgroundgrading100415 2 8340 0 0 /news/drmartens/eastern/fisher/26thfeb04.html 1 0 0 0 /news/kentleague/thamesmead/20thJan04.html 2 0 0 0 /news/dartford230916 3 11727 0 0 /news/31stmay05.html 2 0 0 1 /news/sevenoakstown0-2dulwichhamlet-ladyluckdesertedusadmitsdisappointedjones 2 13389 0 1 /sitemap.xml 7 330533 0 0 /news/551a99e51c7ce 1 5501 0 0 /news/eritbeck150920 4 44832 0 0 /news/weremeetingthedeadlinethekentinvictaleaguehaveimposedonallclubssayslewishamchairman 3 16205 0 0 /news/551bc99d04290 1 6843 0 0 /news/kolaaddsmorefizzforfolkestone 2 10385 1 1 /news/hernebay2-3erithtown-whenwepasstheballijustknowwereahandfulsaystonyrussell 2 19554 0 0 /isthmian-league/37 6 29306 0 0 /news/beckenhamtown3-1hythetown 1 4203 0 0 /news/mcmahonlookingtocreatetrophyhistoryformead 1 3955 0 0 /news/whitstabletown1-0ramsgate-youcantlosehereandexpecttogetintothetopfivesaysward 2 14900 0 0 /news/drmartens/eastern/erith&belvedere/26thjune03.html 2 0 0 0 /news/ourtargetispromotionsaysdoverathleticbossnickyforster 1 4399 0 0 /news/551a97b0bee23 3 13539 0 0 /news/lordswood040816 2 6876 0 0 /news/kentleague/thamesmead/24thnov04.html 1 0 0 0 /news/lewisham220219 2 7870 0 0 /news/551a9c0e64a84 1 3225 0 0 /news/551a956c6d1f6 3 18033 0 0 /tonbridge-2003-2006/4 2 6002 0 0 /news/bromley280817 2 10442 0 0 /news/tonbridgeangels3doverathletic2falanaimaluckyomeninplay-offfinals-exclusive 2 15442 0 1 /news/drmartens/eastern/folkestone/heybridge301004.html 1 0 0 0 /news/NationalLeagueStatement100321 7 34539 2 2 /news/theweekaheadwc27thmarch2006 1 3683 0 0 /news/chathamtownappointpeterhawkinsastheirnewassistantmanager 4 16833 0 0 /news/dartvfolk240204.html 1 0 0 0 /news/551a92506e12b 1 4091 0 0 /news/canveyisland161020 6 19105 0 0 /news/551a979a7c044 1 4749 0 0 /news/sportwell281218 2 20864 0 0 /news/windsoreton0-1folkestoneinvicta-invictacontinuetheirimpressiveawayform 1 4710 0 0 /news/glebe090516 6 38933 2 2 /news/whitstable240516 3 13521 0 0 /news/sittingbournereadytounveilnewboss 1 3818 0 0 /news/sittingbourne3-2waltoncasuals-willishasabrightfutureinthegamesayslovell-exclusive 2 12324 0 0 /news/corinthian281119 2 9198 0 0 /news/weremakingmistakesandgettingpunishedadmitsseager 1 3547 0 0 /news/kentleague/sladegreen/23rdjuly03.html 2 0 0 0 /news/greenwich020405.html 2 0 0 0 /news/lordswoodbossmetcalftargetstopsix 1 4960 0 0 /news/bromley110518 4 15310 0 0 /news/drmartens/eastern/fisher/fishvfolk201203.html 1 0 0 0 /news/beckmeri300719 5 47161 0 0 /news/becksissueultimatumtounderperformingstars-exclusiveinterview 1 4927 0 0 /news/drmartens/premier/welling/sutton131104A.html 1 0 0 0 /news/maidstone230715 5 21496 0 0 /news/551bc99db7da5 1 5802 0 0 /news/551a940f2acfb 5 16127 0 0 /assets/images/print/Thumbs.db 1 62464 0 0 /news/drmartens/eastern/tonbridge/tonbvfolk131203.html 1 0 0 0 /news/charltonathletic020120 4 24248 0 0 /news/sceflstatement080520 3 11252 0 0 /news/gillsdesperatetoendtenmonthwait 3 8794 0 0 /news/soccershortswhitstabletownsignhessenthalerfromgillingham 1 6937 0 0 /news/551a97987ef7b 4 19450 0 0 /news/551bc5e764568 2 10186 0 0 /news/drmartens/eastern/erith&belvedere/chatham300804.html 1 0 0 0 /news/erith050305.html 2 0 0 0 /news/craywanderersacademyhasexceededallexpectationssaysanslow 2 10482 0 1 /news/controversyattractstheattention 4 12798 0 0 /news/itspleasingtostartgettingonthescoresheetagainsaysjamespinnock 1 3949 0 1 /news/sittingbourne0uxbridge3 3 14023 0 0 /news/drmartens/premier/dover/13thjuly04.html 1 0 0 0 /news/7thaug05.html 1 0 0 0 /news/mcmahonwevegotagreatchancetogetintotheplay-offs 1 4040 0 0 /news/crockenhill250915 3 12795 0 0 /news/ahwansetshimselftwenty-goaltarget 1 3340 0 0 /news/jenkinswantsmorefromhispromotionchasingside 1 4676 0 0 /news/bromley070617 2 9307 0 0 /news/sheppey310820 2 7996 0 0 /news/dartford050619 4 13970 0 0 /news/sevenoakstown2-2beckenhamtown-itsalltoplayforagreerivals 2 13102 0 0 /news/drydensignsnewcontracttostayatcrabble 2 6259 0 0 /news/fernandes210715 4 16742 0 0 /news/weputaverygoodargumentforward-ramsgatechairman 2 8892 0 0 /news/tommywarrilowfreshensuphisstrikeforce 1 4400 0 0 /news/folkestone250720 2 7620 0 0 /kent-invicta-league/3 5 38882 1 1 /news/fisher0-0crayvalleypapermills-ourdecisionmakinginthefinalthirdislacking-chapman 1 6713 0 0 /news/551a99e401b6e 1 3957 0 0 /news/wewantasidefulloflocalplayerssayswellsbossfarnie 3 10616 0 0 /news/wokiwell120519 6 51944 1 1 /news/sittingbourne1-1ashfordtown-abbottcondemstrebelsioverallegedspittingincident 1 7473 0 0 /news/faversham130817 1 3806 0 0 /news/othernews/18thjuly04.html 1 0 0 0 /news/croydontargetpromotionbackintotherymanleaguewithintwoyears-exclusiveinterviews 1 5020 0 0 /news/bromley040420 2 11714 0 0 /news/bredclark250515 3 9812 0 0 /news/sittingbourne210417 1 3569 0 0 /news/margate161118 3 12939 0 0 /news/kentleague/ramsgate/24thsept04.html 1 0 0 0 /news/drmartens/eastern/ashford/23rdaug04.html 1 0 0 0 /news/dockersswitchboroughgame 1 2998 0 0 /news/worldcupstarsarecomingtostonebridgeroad 6 21898 0 0 /news/7thmay05.html 2 0 0 0 /news/idontknowwhatimexpectingatcorinthianadmitslordswoodbossjasonlillis 3 13998 0 0 /news/beckenhamtown130919 3 10806 0 0 /news/jimward230817 2 8432 0 0 /news/mersbird010515 4 18698 0 1 /news/551bc5e207db2 1 5060 0 0 /news/bromley1harrowborough1 3 11453 0 0 /news/wellingunited1-1charltonathletic-iwillgivetrialistsanotherchancetoimpresssaysford 1 6113 0 0 /news/EFLStatement031220 3 13361 0 0 /news/erithbel230518 3 16716 0 0 /news/folkestoneexploreafrenchconnection 5 28980 0 0 /news/ksportsebbsfleet300619 3 8676 0 0 /news/cugleyproudofawayrecord 2 9962 0 0 /news/phoenixsports070220 2 7606 0 0 /news/craywands190317 1 4864 0 0 /news/lyddtown080416 3 13899 0 0 /news/drmartens/premier/dover/harrow231104.html 1 0 0 0 /assets/ckeditor/plugins/smiley/images/ 1 943 0 0 /news/folkestoneinvictatopayofftheirdebtsthreemonthsearly 3 11275 0 0 /assets/images/site/ 8 7174 0 0 /archive-2006-2014/212 2 9290 0 0 /news/crayvalley150117 2 7183 0 0 /news/551a9c0f30822 1 3370 0 0 /news/corinthian0-9maidstoneunited-alittletriptowembleywillbenicesaysfive-goalwelford 2 18850 0 0 /news/kentleague/beckenham/19thsept04.html 1 0 0 0 /news/westviewcupproducesfivemouth-wateringkentshowdowns 5 18277 0 0 /news/MPvbrom070204.html 1 0 0 0 /news/28thoct05.html 2 0 0 0 /news/craywands240818 3 13791 0 0 /news/shorts070615 3 19151 0 0 /news/551a979900ddf 3 32726 1 1 /news/burmangetshisbruciebonus-exclusiveinterview 1 4252 0 0 /news/551a96db79ff8 1 3668 0 0 /news/dannylye020519 4 14430 0 0 /news/conference/margate/margatevfarnborough250803.html 1 0 0 0 /news/jimwardwillgethisguysfiredupwarnsramsgatebosstimdixon 2 9252 0 0 /news/imlookingforwardtomoreexcitingtimeswithstonessaysreturningstrouts 1 3145 0 0 /news/dover090815 4 14170 0 0 /news/ksports090218 3 10917 0 0 /news/ashfordtownp-pwhitstabletown-gameoff 1 2713 0 0 /news/wewouldlovetogiveourloyalfanssomethingtoreallyrememberthisseasonsaysjohnovard 1 3697 0 0 /news/thereisstillhopethatwecanmaketheplay-offssaysmaidstoneunitedbossjaysaunders 3 14364 0 0 /news/ourawayformjusttakescareofitselfsayscraywanderersbossianjenkins 3 10469 0 0 /news/551bc5e3c3f2b 1 3420 0 0 /news/551bc5dd3536d 2 9620 0 0 /news/tonbridge291216 1 3987 0 0 /news/craysev110417 4 41266 2 2 /news/551a99e3cdc5f 3 12084 0 0 /news/chairmanspraiseforhome-grownyoungsters 1 4199 0 0 /news/kentclubsbeginmagicalfacupjourney-exclusiveinterviews 4 29124 0 0 /news/hernebay030220 2 7508 0 0 /news/burmansdartsembarkonbigweek 1 3964 0 0 /news/cray261205.html 2 0 0 0 /news/vcdbed071017 1 8254 0 0 /sittingbourne-2003-2006/2 2 6196 0 0 /news/fleeetdown040517 3 11676 0 0 /news/551a99e35f653 3 12807 0 0 /news/erithandbelvedere111220 3 26013 1 1 /news/sevenoaks130815 4 19461 0 0 /news/551bc5e175dd1 2 10470 0 0 /news/551a956ca571a 4 27028 0 0 /news/chathamtown1-2afcsudburymileswewasntattheraces-exclusiveinterview 1 5774 0 0 /news/rusthalladoptprofessionalapproachundernewbosshugo-exclusive 1 5136 0 0 /news/551a96784c078 1 3758 0 0 /news/burmantheballisinourcourt 3 12501 0 0 /news/551bc5e89b302 2 6783 1 0 /assets/ckeditor/plugins/about/dialogs/ 1 415 0 0 /archive-2006-2014/245 3 12863 0 0 /news/551bc99be8e41 3 18687 1 1 /news/PeterboroughStatement 2 7348 0 0 /news/greatwakering161104.html 2 0 0 0 /news/weneedallthehelpwecangettoreturnhomesaysfisherchairman 6 29366 0 0 /news/werecapableofgoinginthereandmakingtheplay-offssaysmaidstoneunitedbossjaysaunders 4 16664 0 0 /news/luchfordwantsfavershamtoimpressinfrontofthecameras 1 5400 1 0 /news/weneedtomakeourhomegamesastoughaspossibleforotherteamssayswellingbossjamieday 5 20570 0 0 /news/aldershottown1-1ebbsfleetunited-queseraseraweregoingtowembleykent 2 12260 0 0 /news/drmartens/eastern/ashford/23rdaug04T.html 1 0 0 0 /news/fgrday110515 5 27110 0 0 /news/chatham220719 4 16033 0 1 /news/551a931de88ca 4 16450 0 0 /news/imlookingforagoodresponseaswewerepooragainstmersthamsayswhitstablebosspeternott 1 4601 0 0 /news/irosetothevolatilehatredthatwasaimedatmesayshyde-exclusive 1 4784 0 0 /news/championshessenthalerlaysthefoundationsfornextseason 3 24937 0 1 /news/conference/gravesend/1stnov03.html 1 0 0 0 /news/551bc99bb4feb 1 5355 0 0 /news/kentleague/maidstone/maidvslade251003.html 1 0 0 0 /news/551a96791ea3a 1 5826 0 0 /news/beckseven100318 2 6046 0 0 /news/hayesyeadingunited0-0tonbridgeangels-wehavetoputourchancesawaysaystommywarrilow 7 84513 2 0 /news/craywanderers4-1chichestercityunited-wemusttysterlingtoacontractsaysjenkins 2 26055 1 1 /news/daishquiteexcitedaboutnewfacesontrial 5 26418 0 0 /news/551a9718d4996 4 14510 0 0 /news/dartford150519 4 13926 0 0 /news/southallsettosignone-yeardealfordovertonight 2 10491 0 0 /news/charlton100620 5 17461 0 0 /news/congratulationsdartfordfootballclubrymanleaguedivisiononenorthchampions 1 2981 0 0 /news/watchtheworldcupunfoldatyourfootballclub 2 8954 0 0 /news/dealtown250920 3 11973 0 0 /news/551a9c92d5c62 1 4844 0 0 /news/551bc5e6de5d7 3 16282 0 0 /news/551a931e1dcd4 1 3806 0 0 /news/margatebossiainoconnellwaitingforshaunwelfordscanresults 2 8764 0 0 /news/dimmockreturnstohisspiritualhome-exclusiveinterview 3 11024 0 0 /news/wemustbetopofthetreenextseasonsayswingersherwood 1 4149 0 0 /news/crowborough170617 1 3330 0 0 /southern-counties-east-football-league/40 4 18707 0 0 /news/milesfrustratedasstonespriseawayhisbestplayer-exclusive 1 5012 0 0 /news/dulwich160318 1 4750 0 0 /news/fansraisefundsfordartford 3 9386 0 0 /news/wekeepshootingourselvesinthefootsaysfrustratedseager 1 3549 0 0 /isthmian-league/50 5 14848 0 0 /news/551a9c0f2c48a 1 5180 0 0 /news/551a9bafd7dfb 3 11016 0 0 /news/iwanttobetopbosssaysmanageresspowell 1 4535 0 1 /news/nealleavessittingbournetofindregularfootball-exclusive 1 3540 0 0 /news/551a97b1831f3 1 4024 0 0 /Home/Get/getJnd28 1 3457 0 0 /news/othernews/drmartens1staug04.html 1 0 0 0 /news/breakingnews9pmdartsswitchtorymanonenorth 1 2864 0 0 /news/vickersoakwoodgroundreadyinfourweeksexclusiveinterview 1 4698 0 0 /news/hendfolk020518 1 9207 0 0 /news/parmenterplaysdownkinnearlink 1 3742 0 0 /news/drmartens/premier/dover/29thoct04.html 1 0 0 0 /news/kentleague/beckenham/hernebay231004.html 1 0 0 0 /news/markharrisreturnstoholmesdaleasnewchairman 2 7120 0 0 /news/humewerrereadyfortoughtootingtest 2 7316 0 0 /news/windsor050804.html 1 0 0 0 /news/drmartens/eastern/folkestone/ramsgate200704.html 1 0 0 0 /news/25thmay04.html 2 0 0 0 /news/burmandescribespitchatbourneparkacowpatfollowingstonesshocker 2 11524 1 0 /news/itsgoingtobeatoughopeninggamesayscanterburycityplayer-bosssimonaustin 1 4541 0 0 /news/kissi070116 4 16535 0 0 /news/burmanreasonablyhappywithstart 1 3829 0 0 /news/punjab300417 3 10703 0 0 /news/ashfordapologiseforlatecuppostponement 1 3178 0 0 /news/551a95b3ae4f2 1 3781 0 0 /news/fatrophyreviewtonbridgeangelsequalclubscoringrecord 2 7898 0 0 /news/othernews/20thaug03.html 1 0 0 0 /news/551a97b140506 1 3825 0 0 /news/lewisham211218 2 7476 0 0 /news/beckcori221218 4 43359 0 1 /news/551bc5e57fe02 2 9948 0 0 /news/codybeingwelllookedafterbynorwichcity-mcdonaldfamily 2 7042 0 0 /news/abbottconcentratesontheleague 1 3354 0 0 /news/favershamappointpiggottasfirstteamcoach 2 9243 0 1 /news/wevegotgoodplayerswhocanhandlethepressuresaysalexobrien 1 5079 0 0 /news/551a979971515 1 4407 0 0 /news/seagerdeservesrecognitionfornurturingakinde 2 7846 0 0 /news/myfacupmemorieswithhornetshavestuckwithmesaysprouddartfordstrikercarlrook 1 4119 0 0 /news/erithtown260518 2 7047 0 0 /assets/ckeditor/plugins/pagebreak/ 5 1813 0 0 /news/hounrust080817 1 8151 0 0 /news/favershamwillshockafewteamswarnswalker 2 7582 0 0 /news/551bc5ded6593 3 15833 0 0 /news/bromley2-1wellingunited-thepotentialatbromleyisenormoussaystable-toppingmarkgoldberg 1 7643 0 0 /news/supportersraisefundsformargate 4 13686 0 0 /news/kentfootballunited0-2orpington-theteamshouldbedoingbetteradmitssammacneil 2 17547 0 0 /news/thebigfreezewhitstablehopefulforbigcrowdiffanscanhelpgetramsgategameon 1 5038 0 0 /news/myambitionistotakecrayintothefootballleague-jenkins 1 5066 0 0 /news/opkchangenametobexleyborough 1 3421 0 0 /assets/ckeditor/skins/ 5 1798 0 0 /news/fishercommunityday080415 3 12258 0 0 /news/cugleysevenmorepointswillkeepusup-exclusive 1 4219 0 0 /news/otfordunited211120 5 25698 2 1 /news/theleaguehavebeengreatallowinggamesongoodartificialpitchessaysglebebossrockymcmillan 1 4150 0 0 /news/551bc5e65f1bd 1 4986 0 0 /news/hernebay260620 3 10139 0 0 /news/facarlsbergvasethirdrounddraw-1 1 3143 0 0 /news/craigholloway050619 2 7684 0 0 /news/wehavetomakesurewerehardtobeatsaysbromleybossmarkgoldberg 1 3949 0 0 /news/michaelthalassitistributes 3 11916 0 0 /news/doverathleticbossnickyforsterbeginssearchforlocalgem 1 3892 0 0 /news/meridiansearchforanewmanagerwithenthusiasmcommitmentanddiscipline 5 15840 0 0 /news/quartetsigncontractstostaywithstones 1 3574 0 0 /news/carshaltonathletic1-1folkestoneinvicta 1 4777 0 0 /news/youwontseeanyonerunawaywithitthisyearsaysbeckenhamtownbossjasonhuntley 3 13362 0 0 /news/margateadmittheyoverspentastheytriedtoreclaimconferenceplace 2 7114 0 0 /news/tonbbrom190319 4 34004 0 0 /news/551a9c0eb6928 4 16649 0 0 /news/ramsgate291219 1 0 1 1 /news/signingstroutsisabigcoupforwhitstabletownhailsseager-exclusive 2 7576 0 0 /news/551bc5e3526b4 1 4961 0 0 /news/greeashf131118 4 43590 1 0 /archive-2006-2014/44 4 19969 0 0 /news/glebe170919 4 12304 1 1 /assets/uploads/ 4 1837 2 0 /news/551a925048014 4 13909 0 0 /news/crayvalley070716 3 9939 0 0 /news/margatebossiainoconnellwillgivetrialistsplentyoftime 1 4575 0 0 /news/soccershortsliamharwoodpenscontracttostayatbromley 1 5404 0 0 /news/hendon3-0dartford-controversialredcardupsetsburman 6 85869 3 4 /news/hamptonrichmondborough2-0wellingunited-fordruescostlyerrors 2 11476 0 0 /news/sevenoaksbossjohnjameshailsstrikeforceafterclinchinglesleckiecupagain 3 9994 0 0 /news/wehavetodustourselvesoffandhavethatbeliefagainsayshernebaybosssimonhalsey 3 11383 0 0 /news/drmartens/premier/dover/28thjuly04.html 1 0 0 0 /news/551a96dc95213 2 11956 0 0 /news/kentleague/sladegreen/didcotvsladefac060903.html 1 0 0 0 /news/ashford151105.html 1 0 0 0 /news/551a95b3cad8b 4 14641 0 0 /news/gravesham040816 4 14265 0 0 /news/becktunb200319 4 39082 0 0 /assets/select2/docs/vendor/js/ 1 407 0 0 /news/StanPunj160418 4 33893 0 0 /news/551bc5e84249c 2 6774 0 0 /news/becksfacingraceagainsttimeexclusiveinterview 2 10346 0 0 /news/battleoframsgatepastandpresentasclubhonourloyalservantbenlaslett 4 12414 0 0 /news/551a96db664f0 1 3271 0 0 /news/takalooreturnstomaidstone 1 3724 0 0 /news/erithbel090218 3 11943 0 0 /news/crayvalley090218 3 12045 0 0 /news/iwanttobethemanthatbringsglorytohernebaysayssimonhalsey 1 4383 0 0 /news/551bc5dd9fc9a 1 3838 0 0 /news/26thjune05.html 2 0 0 0 /news/croydon0-5phoenixsports-youdontwinanythingindecembersayssteveoboyle 3 28447 0 0 /news/stepup010717 3 14912 0 0 /news/tohavegillinghaminthesuperleaguewouldboostwomensfootballinkentsayschairman 3 23416 1 0 /news/thanetcharitiesbenefitfromramsgatessuccess 2 6500 0 0 /news/551bc5e05f692 3 17579 0 0 /news/firstteamstarsturnoutforangelsreserves 2 5910 0 0 /news/551bc5e20d538 1 4379 0 0 /news/soccershortsfansoutrageasplayersrefusetodonatetheirwagesbacktotheclub 1 7720 0 0 /news/icertainlyunderstandtheimportanceoffavaseprogresssaysmartinlarkin 1 4345 0 0 /news/bromleyminshull230515 3 15261 0 0 /archive-2006-2014/121 2 9423 0 0 /news/eastbourneborough240920 2 10032 0 0 /news/kentleaguetitledualwemusttreatwellswithrespectinsistshuggins-exclusiveinterview 2 8169 0 0 /news/551bc99acb681 1 4721 0 0 /news/ashford230517 2 8142 0 1 /news/drmartens/eastern/dartford/dartvfolk240204.html 1 0 0 0 /assets/ckeditor/plugins/clipboard/ 5 1823 0 0 /news/itfeelsgoodtobejoint-topadmitslovell-exclusive 2 8977 0 0 /news/localhomegrownyouthisthewayforwardsaysashfordchief 2 11417 0 0 /news/MaidSaunders030415 3 11014 0 0 /news/bromleians030618 2 6038 0 0 /news/highly-ratedstrikerbarronmakesthanetswitch 1 3530 0 0 /news/Afcwimbleon060905.html 1 0 0 0 /maidstone-2003-2006/3 3 8733 0 0 /news/FACupNews251020 7 40643 0 0 /news/hernebaywerethebestsidethatweveplayedthisseasonsaysjones 2 9548 0 0 /news/ihavedonealotintermsofkeepingtheclubafloatsaysbromleybossmarkgoldberg 3 12071 0 0 /news/thamesmead131018 3 10710 0 0 /news/fisher270716 3 11447 0 0 /news/551bc5e2e0fc9 3 9477 0 0 /news/princesparkspecialwelcomehomedarts 3 18850 0 0 /news/budgetcutsforcerobbinstobringinlocaltalent 2 8571 0 0 /news/dartfordbosstonyburmanseeksvastlyimprovedperformanceagainstportvale 1 4404 0 0 /news/lyddtown060516 4 15793 0 0 /news/wemustkeepholdofourbestplayerssaysbrady 2 9398 0 0 /news/doverathletic200221 7 33226 1 1 /news/rusthall060116 6 21002 1 2 /archive-2006-2014/279 4 16853 0 0 /news/worthing271205.html 1 0 0 0 /news/551a967769a97 3 17808 0 0 /news/canterbury201115 3 14487 0 0 /archive-2006-2014/142 3 13752 0 0 /news/saturdaysoccer28thjanuary2006 3 9536 0 0 /news/551bc5e6c71de 3 21806 0 0 /news/erithbelvederevyaxley-gameon 4 13128 0 0 /news/fcelmstead180915 3 15054 0 0 /news/magpiesflyintohelpbromleyscash-flowproblems 2 9666 0 0 /news/daishswoopsforwokingdefendermacdonald 1 3736 0 0 /news/winningmeanssomuchfortonbridge-exclusiveinterviews 1 6688 0 1 /news/551bc5db0f5e0 2 6048 0 0 /news/rusthall240818 1 3986 0 0 /news/stonesbossjaysaunderssnapsuplocaltalent 1 4583 0 0 /news/kentstarsofferyoungstersthechancetojoinsoccerelite 2 12308 0 0 /news/deal161004.html 1 0 0 0 /news/wemustputpressureonthesidesaboveusinsistslangton 2 7378 0 0 /news/therealdealtommysampsonswembleymanuscript 1 3321 0 0 /news/551bc99d13107 1 5463 0 0 /news/lordswood011217 2 7174 0 0 /news/ramsgate301004.html 1 0 0 0 /news/wellmarg010117 4 41449 0 0 /news/551a97b28b988 1 5019 0 0 /news/soccershortsexspurscoachjoinssevenoaks 1 7615 0 0 /news/kentleague/cray/crayvsevenoaks200903.html 1 0 0 0 /news/oneofmychallengesistoliftmyplayersforleaguegamessayslisney 2 8053 0 1 /news/551a979983e89 1 4610 0 0 /news/play-offheroesfolkestonehavegottonamearoadincugleyshonour-sayschairmanwoods 2 10839 0 0 /news/wearetoojekyllandhydeatthemomentadmitscrayvalleybossstevechapman 2 7432 0 0 /news/maidstone190216 4 15522 0 0 /news/551a95b36bcf0 1 3251 0 0 /news/appiahmakesinstantimpactforfleet 2 6680 0 0 /news/croydon4-1epsomewell-maybeicanaffordtogoandbuytracksuitsformyplayerssaysgill 5 61371 1 1 /news/bromleybossmarkgoldbergbringsintriotoaidsurvivalbid 1 3806 0 0 /news/folkestone091117 2 8114 0 0 /news/ryman/bromley/corivbrom200903.html 1 0 0 0 /news/tilbury020405.html 1 0 0 0 /news/ithinkthedealgameisanicegameforussaysdoverathleticbossnickyforster 1 4382 0 1 /news/averymakeschathammovepermanent 2 6958 0 0 /news/sportvlord131203.html 2 0 0 0 /kent-invicta-league/13 2 10259 0 0 /news/drmartens/eastern/folkestone/burgvfolk070104.html 1 0 0 0 /news/kentleague/whitstable/4thjuly04.html 1 0 0 0 /news/saturdaysmatchreports-3 2 5247 0 0 /news/sheppey250416 3 10905 0 0 /news/551a9c0ec4d47 3 13014 0 0 /news/ramsgate170804.html 1 0 0 0 /news/wellingunitedbeginsearchfornewmanagementteam 2 7085 0 0 /news/croydon070220 3 10733 0 0 /news/551bc5e50a29f 2 7268 0 0 /news/551bc5dd58318 3 12734 0 0 /news/glebesign25-yearleaseontheirchislehurstbasedground 3 10574 1 0 /news/551bc5e02453c 3 17957 0 0 /news/wealdstone290105.html 2 0 0 0 /news/551bc5e616f8e 3 14297 0 0 /news/chathamtown2-0metropolitanpolice-alcoholfuelledkidstarnishchatsfirsthomeleaguewin 1 6424 0 0 /news/martinfordstatement190520 5 16681 1 1 /news/stonesconquereurope 6 20551 0 0 /news/maidstoneunitediscommittedtofindthenextchrissmallingsaysyouthmanageriangrieves 3 44640 2 1 /news/wellmoveontobiggerandbetterthingsinsistsbromleychairmandolke 4 17041 0 0 /news/wevegottoberuthlessinthefacupasyougetnosecondchancesayschathambosskevinwatson 2 8301 0 0 /news/wellingtown170120 2 7662 0 0 /news/551bc5dc9366f 3 12239 0 0 /news/erithbelvedere1-2bromley-consolidationisthewordatthisclubatthemomentsayscollins 1 6585 0 1 /news/weareinittotryandwinitsayserithtownbosstonyrussell 1 5042 0 0 /news/sittingbourne291216 1 3576 0 0 /news/farnietellshisplayerstofightfortheirshirts-exclusiveinterview 5 26390 1 0 /news/werespectpeopleinourleaguebuttheresnotmanywefearsaysbarryashby 3 13469 0 0 /news/551a97b24d6d1 1 4368 0 0 /news/cugleyprofessionalteamsgiveusagoodtest 5 25335 0 0 /news/thecommiteearemakingthesameoldmistakesagainsaysformerhernebaychairmantrevorkennett 5 64324 3 3 /archive-2006-2014/98 2 10138 0 0 /news/sheppey230916 2 7624 0 1 /news/wevegottobeattheteamsaroundussayslovell 2 9128 1 0 /news/phoenixsports101019 3 11834 0 0 /news/craysitt231218 3 33990 0 0 /news/horshamunveiljustinluchfordastheirnewboss 1 4565 0 0 /news/kenncrow131019 4 50322 0 0 /news/corinthian020819 4 15802 0 0 /news/craywands060918 3 14109 0 0 /news/thechairmanhastoldustokeepsittingbourneintherymanleaguesaysnickdavis 4 21170 0 0 /news/temporarydismissalsguidance230619 2 10230 0 0 /news/bromvthurrockfac111003.html 1 0 0 0 /news/weareworkingtirelesslytomakethisworksayssittingbournejoint-bossnickdavis 4 15330 0 0 /news/stonesunveilsubstantialsponsorshipdealwithbritelitewindows 5 17536 0 0 /news/ihadsomegreatdaysandgoodmemoriesduringmyyeightyearsatarsenalreflectsmartinhayes 2 9939 1 0 /news/ashford150815 5 18936 0 0 /news/13thaug04.html 2 0 0 0 /news/dolbybeginssearchforreplacementgoalkeeper-exclusive 1 4653 0 0 /news/kentleague/thamesmead/10thoct03.html 1 0 0 0 /news/fcelmshep080119 5 51208 0 0 /news/punjab150320 3 11030 0 0 /news/bromley190320 5 20122 0 0 /news/resultssept2017 4 48070 0 0 /news/pauljefcoatestandsdownasramsgatechairmanaftertimdixonscontroversialdeparture 1 3983 0 0 /news/thefaplacebanonnon-leaguefootballersplacingbetsonworldwidefootballmatches 3 11178 0 0 /news/551a925074b83 2 6029 0 0 /news/greenwichborough0-1erithtown-letskeeptheseasonalivesayserithtownbossmarktompkins 2 17968 0 0 /whitstable-2003-2006 11 33111 0 0 /news/551a931e133a2 2 7950 1 0 /news/vcdfarn171115 3 27792 0 0 /news/whitstableunveilmundayastheirnewmanager 3 10363 1 1 /news/yesterdaysmatchreports 4 40004 0 0 /news/facupthirdqualifyingrounddrawdoverathleticfacebromley 2 6772 0 0 /news/championswinningthetitleonourhomepatchwaskeysayshessenthaler 1 4332 0 0 /news/councilunveilplansforcanterburycitysnewstadium 2 12469 0 0 /news/tonbridgeangels1-5horsham-itsadaytoforgetadmitswarrilow-exclusive 1 6911 0 0 /news/warrilowexpectingbloodandthunderderby 2 10018 0 0 /news/crayvalley3-1greenwichborough-weregoingtorunitlikeaproperprofessionalclub-jones 3 31319 0 0 /news/angelschairmanourerraticformistotallyunacceptableexclusiveinterview 1 5032 0 0 /news/wemustliveuptoexpectationsinsistsdartsboss-exclusiveinterview 5 25284 0 0 /news/margate130519 4 15582 0 0 /news/ifeeliwasrighttoresignsaysformersittingbournebossmattwyatt 2 8258 0 0 /news/maidstoneunitedp-pchathamtown 2 5970 0 0 /news/crayfav270816 2 22716 0 0 /news/wehavetoguardagainstcomplacencysaysnickysouthall 3 13711 0 0 /news/551a96dc793a8 2 9710 0 1 /archive-2006-2014/115 1 4986 0 0 /news/whitstabletown1-1whyteleafe-mundaypleasedwithhissidescharacterastheyendmiserablerun 1 6170 1 1 /news/wereonarollercoasterrideadmitscugley 3 13310 0 0 /news/20thjune04.html 2 0 0 0 /news/nolaninterestedinlordswoodvacancy-exclusiveinterview 1 3622 0 0 /news/551a924fea287 5 32081 1 0 /news/birchall060716 3 12381 0 0 /news/mattletissiergivesnon-leaguedaythethumbsup 4 18278 1 1 /news/daishweacquittedourselveswell 11 108392 6 5 /archive-2006-2014/108 1 5121 0 0 /news/elthampalace2-2orpington-werodeourluckalittlebitadmitsorpingtonbossseanglover 3 25789 1 1 /news/551a97b222e35 1 4055 0 0 /news/551a99e47289b 3 12945 0 0 /news/3rdmar04.html 1 0 0 0 /news/13thjan05.html 2 0 0 0 /news/dartford0-4dorchestertown-burmanimlookingformyplayerstorespondtohorrordefeat 1 5930 0 0 /news/wardilltakeramsgateuptotheconferenceexclusive-segregationdetailsforthebiggame 1 6452 0 0 /news/thamesmead300305.html 1 0 0 0 /news/551bc5e26bacc 4 25072 1 1 /news/promotionchasingrusticsappointlangtonastheirnewboss-exclusive 1 3329 0 0 /news/sportbeck070119 5 47188 0 0 /news/hernebay2-2chipstead-batteredchips 1 5623 0 1 /news/fisher121018 3 12836 0 0 /southern-counties-east-football-league/51 2 5498 0 0 /news/iwillnotfailtodeliverthegoodsvowslovell 2 7749 0 0 /kent-invicta-league/12 2 9853 0 1 /news/canterburysmith040615 4 16046 0 0 /news/551bc5e35880e 1 4852 0 0 /news/551a956c06bb8 3 20519 1 0 /news/tonbridgeangels2-1chathamtown-wevegottolearnhowtowingamessayskevinwatson 3 26717 0 0 /news/tonbridgeangels2tootingmitchamunited0 1 5341 0 0 /news/551a9c9160346 4 16774 0 0 /news/werenotgoingtowinitbutyouwanttostayinitforaslongasyoucansaystommywarrilow 1 5043 0 0 /news/resultsfeb2017 3 38372 0 0 /news/afccroydonathleticwillbeabigtestforusbecausewereascalpsaysfisherbossstevefirkins 1 4330 0 0 /news/tonbridgeangels1-0aveley-youdnicka1-0winalldaylongadmitsalexobrien 1 6727 0 0 /news/harrowborough2-1tonbridgeangels-allgoodthingscometoanendadmitswarrilow-exclusive 1 6169 0 1 /news/iwillonlyplayinemergencies-obrien 2 9520 0 0 /news/soccershorts040316 4 51766 0 0 /news/551a96dc7fd8d 2 31354 0 0 /news/ramsgatechairmanfearsthedropfollowingfour-pointdeduction 2 7634 0 0 /news/21stsep05.html 2 0 0 0 /gravesend-2003-2006 15 44791 1 0 /news/lordswood091118 5 17256 0 0 /news/corinthiandefenderdanbentearnstrialatdagenhamredbridge 2 8994 0 0 /news/jamesmarrsrelishesgillinghamreturn 4 23843 1 1 /news/551bc5e7e1942 2 8784 0 0 /news/wemustremainfocusedandcollectthreepointssayshume 1 4385 0 0 /news/wecantbegoodoneweekandbadthenext-hume 1 3469 0 0 /news/551bc5dd129d4 1 4492 0 0 /news/ramsgate260518 3 14301 0 0 /news/facupspecialhumeexpectsabigperformancefromhisside 2 7764 0 0 /news/craywands060917 4 14680 1 2 /news/wardclosetofinalisinghissquad-exclusive 2 8398 1 0 /news/551a99e486f83 1 3987 0 0 /news/drmartens/premier/dover/22nddec03.html 1 0 0 0 /news/wardimreapingtherewardsoflocaltalentexclusive 2 7606 0 0 /news/weveunderachievedthisseasonadmitscory 2 8396 0 0 /news/charltonathletic2-1queensparkrangers-wevehadquiteasuccessfulseasonsaysstuartweston 3 29154 0 0 /news/resultsnovember2019 3 31036 0 0 /news/november2010resultsfixtures 3 20095 0 0 /news/brendoncasswillfireustowardskentleaguetitlesaysporter 1 5005 0 0 /news/mentallyifeltineededachangeandnowwastherighttimeforthatchangesaysleeworgan 3 14312 0 0 /news/16thjuly03.html 1 0 0 0 /news/tenterden211018 3 13946 0 0 /news/551bc5e37d15f 1 3702 0 0 /news/551a9c928902b 2 12162 0 0 /news/kentseniorcupsemi-finaldraw 1 2643 0 0 /news/facarlsbergtrophythirdqualifyingrounddraw-1 1 4195 0 0 /news/chairmanmccarthyquitsbeckenhamtown 1 3396 0 0 /news/greenwich230916 2 6799 0 0 /news/drmartens/eastern/sittingbourne/berkhamsted250904.html 1 0 0 0 /news/551bc5da4513c 2 12302 0 0 /news/kentleague/whitstable/5thnov04.html 1 0 0 0 /news/bromley010820 5 25298 2 2 /news/facupfirstrounddrawwellingunitedhandedhometieagainstlutontown 2 9329 0 0 /news/crayhast130917 2 18282 0 0 /news/favershamtownkeepersimonoverlandruledoutthroughfracturedtibia 2 6632 0 0 /news/dartfordshomecomingdartford4-2horshamymcadartsreturnhomeinstyle 2 10804 0 0 /news/tunwells300617 2 7429 0 0 /news/folkestoneinvicta1-1margate 2 5137 0 0 /news/cordiceourdestinyisverymuchinourhands 2 9154 0 0 /news/burmanwarnsagainstcomplacencyagainstdragons 2 17622 1 1 /news/reviseddrawsthefatrophyandthefavase 2 5932 0 0 /news/otfoideh290415 4 57765 0 1 /news/kennyshowshisthankstothemanwhokeepstheborodreamalive 2 11126 0 0 /news/wemustkeeptherungoingsaysjenkins 2 7370 0 0 /news/kentleague/beckenham/27thaug04.html 1 0 0 0 /news/resultsaugust2015 4 32926 0 0 /news/dartford4-2bostonunited-jacoberskinewillimprovewithussaysdartfordbosstonyburman 1 8045 0 0 /news/yeading190305.html 2 0 0 0 /news/hythhern010220 4 43620 0 0 /news/wecanreplicatewembleyglorysaysrecordbreakercharles 2 8475 0 1 /news/rusthall1-4hildenboroughathletic-adamdaviesisaqualityplayersaysbossandrewmckechnie 4 39432 0 0 /news/afchornchurch2-0maidstoneunited-wethoughtwecouldgetoutofitadmitsjaysaunders 1 4712 1 1 /news/drmartens/premier/dover/4thsept04.html 1 0 0 0 /archive-2006-2014/217 2 8474 0 0 /assets/ckeditor/plugins/table/dialogs/ 1 373 0 0 /news/12thsept03.html 2 0 0 0 /news/greenwich181016 1 3505 0 0 /news/maidstoneunitedbossjaysaunderssendsjackharrisandorlandosmithoutonloan 4 14866 0 0 /news/ourbuilduptothenewinvictaleagueseasonhasbeenexcellentsayssammacneil 4 16444 0 0 /news/thamesmeadtown1sevenoakstown1 2 8086 0 0 /news/551bc5df732e0 3 17741 0 0 /news/dealtown030120 2 6852 0 0 /news/whitstable300715 3 14460 0 0 /news/erithtown200705.html 1 0 0 0 /news/551a9797e238c 2 7443 1 0 /news/hernebayhasbeengoingfromstrengthtostrengthinrecenttimessayschairmantrevorkennett 2 7124 0 0 /news/551a931dbca95 1 4283 0 0 /news/barking200905.html 2 0 0 0 /news/28thjuly05.html 2 0 0 1 /news/stevenageborough4-1doverathletic-someofmyplayersgotfoundouttodayadmitshessenthaler 2 14042 0 0 /news/hernebay131204.html 1 0 0 0 /news/551bc5df310db 1 5576 0 0 /news/lymington261105.html 2 0 0 0 /news/551bc5de83f4f 1 3439 0 0 /news/craywands201118 3 14418 0 0 /news/smissenruledoutfortherestoftheseason 1 3547 0 0 /news/bearsted0-1whitstabletown 1 5266 0 0 /news/drmartens/eastern/folkestone/eastleigh250904.html 1 0 0 0 /news/drmartens/eastern/sittingbourne/maldon231104.html 1 0 0 0 /news/movingtothamesmeadwasntadifficultchoicetomakesaysbexleyboroughbossliamkelly 6 21356 0 0 /news/hernebay1-0hythetown-morgansdefenceleavesporterspeechless 1 5196 0 0 /news/itsashamemorepeopledontcomeandsupportus-cugley 2 8869 0 0 /archive-2006-2014/289 3 11918 0 0 /news/551bc5e064f29 2 10572 0 0 /news/551bc5df54863 1 2819 0 0 /news/orpington180915 3 9996 0 0 /news/551a9c0e87f50 3 13872 0 0 /news/bromtoot051015 4 35570 0 0 /news/ashford170905.html 2 0 0 0 /news/551a9c9157632 4 20606 0 0 /news/lydd210417 4 16206 0 0 /news/kentleague/sporting/sporting.html 1 0 0 0 /news/cray210917 2 7884 0 0 /news/crayvalley310119 4 15922 0 0 /news/horsvbrom091203.html 1 0 0 0 /login/kefuxian.mvc 1 2750 0 0 /news/551bc5dcdc6d4 1 4153 0 0 /news/martinfordstatement130320 3 9263 0 1 /news/551a931e3696a 4 14786 0 0 /news/551bc99a56f3f 3 9364 0 0 /news/tunbridgewells2-5kennington-iwanttofollowinmybrothersfootsteps-exclusive 2 11902 0 0 /news/23rdjune04A.html 1 0 0 0 /news/kentskidsgetofftoawinningstart 1 3561 0 0 /news/lordswood1-2erithbelvedere-refcartergetshisknickersinatwist 2 9453 1 0 /news/metcalfrallieshistroopsafterheartbreakingfacupexit 2 9079 0 0 /assets/ckeditor/plugins/find/dialogs/ 1 370 0 0 /news/croydon070819 3 11120 0 0 /news/551bc5de7f259 1 3348 0 0 /news/wellingunited170619 3 12264 0 0 /news/kentinvictaleagueconfirmfirstsixteenparticipants 1 3369 0 0 /news/westandagoodchanceofgettingtowembleysaysdartfordco-chairmandavidskinner 1 4305 0 0 /archive-2006-2014/97 1 4859 0 0 /news/werenotsplashingthecashanymoresaysburnettt-exclusive 1 4500 0 0 /news/fisherprepareforjudgementday 1 3423 0 0 /news/greeniesfridaypreview-whowilljoinfleetinlastqualifyinground 3 18632 0 0 /news/downbeatwardplaysdownplay-offhopes-exclusiveinterview 1 4309 0 0 /news/walkerunveilssignificantpoutonsigning 1 3126 0 0 /news/kentfootballunited121118 4 18354 0 0 /news/dealtown100120 2 8614 0 0 /news/drmartens/eastern/erith&belvedere/23rdjune03.html 2 0 0 0 /news/hernebay0-0hythetown-hythehaventcompletelygotbothhandsonthetitleyetsayshalsey 1 7521 0 1 /news/ebbsfleetunitedsnapupshanehuke 6 20863 0 0 /news/carterton210904.html 1 0 0 0 /news/mysackinghascomeasabitofashockadmitsleerichmond 3 11181 0 0 /news/facarlsbergtrophythirdrounddrawmoretravellingforkentslasttwo 1 3684 0 0 /news/ramsgate150619 4 16450 0 0 /news/bromley191119 3 15661 0 0 /news/551bc5dca17b9 2 9034 0 0 /news/kentleague/lordswood/sportingbengal041204.html 1 0 0 0 /news/hayescanwinusthegamesaysflanagan-exclusive 4 22325 2 2 /news/faversham161018 3 12318 0 0 /news/dulwichhamletreassurefansofapositivefuturefortheclub 2 8762 0 0 /gravesend-2003-2006/2 4 12065 0 0 /news/sittingbourneunveilgoalscoringlegendastheirnewboss 1 3075 0 0 /news/551a97b1222ca 1 4762 0 0 /news/craycant170319 7 82540 1 1 /news/kennington010819 3 10426 0 0 /news/hythfolk200719 4 42744 0 0 /news/myintentionistobringtheyouththroughsayssevenoakstownbosssimonjones 2 10008 0 0 /news/551a9250c8377 2 7138 0 0 /news/saturdaysoccer4thfebruary2006 3 9409 0 0 /news/itwouldbegoodifwecanemulatemartinhayesandgetintofacupthirdroundsayschriskinnear 2 9612 0 0 /news/werequitecapableofgonigtodoverandbeatingthemsaystommywarrilow 3 14069 0 0 /news/facupfirstrounddrawtheplayersmustputinagoodperformancetosetupvaleclash-burman 2 9092 0 0 /news/hernebaychairmantrevorkennettaxesbosssimonhalsey 3 10162 0 0 /news/vcdathletic3-0hythetown-foleyitsabouttimewebeatthem 2 8663 0 0 /news/phoenix270715 4 19296 0 0 /news/ramsgateunveilsamgoresigning 1 3282 0 0 /national-league/21 2 10289 0 0 /news/daishpraisesmckimmforbattlingagainstcareerthreateninginjury 2 6967 0 0 /news/darrenphillipspicksnineteenplayerstocarrythekentflagagainstrivalssussex 2 8938 0 0 /news/afcsudbury0-0ramsgateramswon5-4onpens-herowilkersonsaveshisbestforlast 1 10433 0 0 /news/551a95b45b6cc 1 4281 0 0 /news/kentrivalsrelishcupclash 3 18500 1 0 /search/ 1 698108 0 0 /news/551a95b467628 1 4171 0 0 /news/maidstone290915 4 16094 0 0 /news/tootingvsittfat041003.html 2 0 0 0 /news/stansfeld040416 2 7080 0 0 /news/sladegreen1dealtown2 1 4192 0 0 /news/greenwich270218 1 3142 0 0 /news/soccershortspersonalreasonsforcefordtoswiftlyquitderes 1 7689 0 0 /news/theweatherhashitushardsaysconcernedstoneschairman 1 4601 0 0 /news/leebrowning100516 6 64140 1 3 /news/551a979a483b8 2 9990 0 0 /news/imsurprisedwithourstarttotheseasonadmitsluchford 1 4957 0 0 /news/551a95b41b5d8 4 22850 0 0 /news/imreallypleasedtohavejonmainattheclubsaysthamesmeadtownbosskeithmcmahon 5 24330 0 0 /news/drmartens/eastern/tonbridge/kingstonian040904.html 1 0 0 0 /news/551bc5e5e7388 1 4284 0 0 /news/oldbroms040317 3 16417 0 0 /news/larryo'connelltribute050120 2 9170 0 0 /news/bromley040618 4 15098 0 0 /news/hytheheroesherefordaway-itfeelslikewevewonthefacup-saysskipperdavecook 2 9985 0 0 /news/margate0-1maidstoneunited-stonesweremorestreetwisethanusadmitsbutler 1 6395 0 0 /news/sidneywarden13062018 4 16866 0 0 /news/werelikeawoundedanimalatthemomentsovcdbetterwatchoutwarnsjustinluchford 2 8206 0 0 /news/theweekahead-10 2 6052 0 0 /news/theroadtowembleyitsgoingtobeagoalscoringthrillerpredictfolkestone-exclusive 2 8465 0 0 /news/dartsfacedoubleinjuryblowdespitetheirriseintoplay-offpicture 2 10386 0 0 /news/dartfordreinstatedintoconferencepremieraftertroubledsalisburycityarethrownout 4 18129 0 0 /news/doverathletic081018 3 9807 0 0 /news/ryman/bromley/23rdnov03.html 1 0 0 0 /archive-2006-2014/266 2 8487 0 0 /news/wehavetosetrealistictargetsandstayintheleaguesayswellingunitedbossjamieday 7 35477 1 1 /news/drmartens/premier/dover/18thjuly03.html 2 0 0 0 /news/holmesdalecoachrossmitchelllooksforabettersolidcampaign 2 7302 0 0 /news/bromley310717 3 28316 1 1 /news/551a9798138d8 1 3418 0 0 /news/resultsaprilmay2014 3 41003 1 1 /news/maidstone110619 3 11028 0 0 /assets/select2/docs/_includes/navigation.html 1 567 0 0 /news/erithtown.co.uk 2 0 0 0 /news/551bc5db226f6 2 11166 0 0 /news/signingpursgloveshowshowambitiouswearesaysoboyle 2 7685 0 0 /news/lewisct200818 3 33048 0 0 /news/chathamlookforwardtobumperpayday 1 4290 0 0 /news/ashfvfolk270104.html 2 0 0 0 /news/craywanderers1-2ramsgate-bremnerisstayingputinsistsjenkins 6 38114 3 1 /news/tonbridgeangels2-1hendon-angelswinmarredbyscottgoodinginjury 1 5700 0 0 /news/chathamtown0a0folkestoneinvicta-greensuffersthreebreaksinhorrorinjury 3 15930 0 0 /folkestone-2003-2006/4 6 42213 0 0 /news/maldontown0bromley2 2 7122 0 0 /news/wearenotgoingintotherymanpremiertosimplymakeupthenumberssaysterrycasey 6 21608 0 0 /news/dealvcrayfav181003.html 1 0 0 0 /news/ivegottolearnonthejobadmitsnewdockersbossoboyle 1 4459 0 0 /news/thefavasefinal2013insportingtermsitsourbiggestdayanyofushavehad-martinlarkin 4 23860 2 2 /news/charlieslocombe020819 3 9842 0 0 /news/brownsofftorusthall-exclusive 1 3188 0 0 /news/beckenham020817 2 9192 0 0 /news/letshopewecanproduceanothergutsydisplayatwrexhamsaysnickysouthall 3 12145 0 0 /news/dorkbrom141219 5 41266 0 0 /news/othernews/24thmar04.html 1 0 0 0 /news/551bc5dfe04bb 2 9696 0 0 /assets/uploads/content/1908_Challenge%20-%20Copy%202.htm 1 30083 0 0 /news/burgfolk070115 4 47542 1 2 /news/weneedtoturndrawsintowinssayswhitstabletownbosspeternott 1 4447 0 0 /news/551bc99b61e0a 1 3728 0 0 /news/soccershortsburmanshowsthedoortosixtitlewinningplayers 1 5116 0 0 /news/conference/margate/8thoct04.html 1 0 0 0 /news/everythingstoplayforinthekentleagueatthemomentsaysmickycollins 3 15356 0 0 /news/lovellkscupclashhasthemakingsoffagoodgame 2 8668 0 0 /news/551a956ba15db 1 3575 0 0 /news/wearemakingsteadyprogressathythetownsaysbosstimdixon 3 12050 0 1 /news/551a97b26a7be 1 4848 0 0 /news/drmartens/eastern/sittingbourne/sittvroth030104a.html 1 0 0 0 /archive-2006-2014/6 6 30672 0 0 /news/551a92503885c 2 8622 0 0 /news/bromley050815 4 17469 0 0 /news/551a9c0ed1eac 3 12546 0 0 /news/vcdwalt230719 3 25212 0 0 /news/folkestoneinvicta1-1leatherhead1-3p-theoff-the-fieldsituationhasgottoimprove-cugley 4 42338 0 0 /news/aylesburyunited0-0margate-weveturnedthecorneradmitstrott-exclusive 2 12584 0 0 /news/soccershortsthechallengetoourplayersistogettothenewyearunbeatensayslyddbosssmith 2 19115 0 0 /news/weveunderachievedthisseasonadmitsseager 2 8913 0 0 /news/wereprogressiveandwedontwanttostandstillsaysphoenixsportschairmanandrewmortlake 3 19124 0 0 /news/burmansettomakechangesdespiteawesomedisplay 1 4404 0 0 /news/crowborough130618 4 15661 0 0 /news/551bc99e64ddd 1 15435 0 0 /news/tonbridge180915 3 9645 0 0 /news/hernebay3-1winchestercity-wecanmixitupifweneedtosayshernebaybosssimonhalsey 1 6930 0 0 /news/551a97190dfa2 4 15417 0 0 /news/curtisrobinsonscoopsdoubleawardatmargate 1 4023 1 0 /news/dartford2-1ware-thepressureisallonsudburysaysburman 8 142300 6 6 /news/itscometoapointwhereicannotgivetherolethetimeandeffortitneedssayssimonaustin 3 15751 0 0 /assets/ckeditor/plugins/tabletools/dialogs/ 1 378 0 0 /news/sittingbourne3-1whyteleafe 2 7850 0 0 /news/canterbury010116 5 27560 1 1 /news/goals021015 9 79738 4 4 /news/resultsforjanuary2008 2 9856 0 0 /news/shamefullondonriotsforcecancellationofthreegamesoversafetyreasons 1 3818 0 0 /news/dolbypreparshisangelsofthenorth-exclusive 1 5908 0 0 /news/maidstoneunited2-0waltonhersham-wewantourunbeatenruntokeepgoingsaysjaysaunders 2 12038 0 0 /news/favevcd271020 5 53225 0 0 /news/kentleague/maidstone/10thdec04.html 1 0 0 0 /news/meridian050619 2 9240 0 0 /news/551bc5e4324c2 3 8702 0 0 /news/551a9798d675d 2 12775 0 0 /news/otfordcharity140119 3 9193 0 0 /news/sittingbourne3-1thamesmeadtown 4 23664 0 0 /news/sevenoakstown3-1otfordunited-wedidntdoourselvesjusticeadmitssevenoaksbossanslow 2 15068 0 0 /news/551a9c0e9b6e6 3 15585 0 0 /news/erithbelvedere0-0erithtown 2 7385 0 0 /news/erithvlords081103.html 1 0 0 0 /news/supportersclubchairmanpredictsbetterfutureforinvicta 1 3392 0 0 /news/ryman/bromley/bromvwalton060903.html 1 0 0 0 /archive-2006-2014/19 2 10264 0 0 /news/rusthall230916 3 11163 0 0 /news/maldon200805.html 2 0 0 0 /news/tonbridgeangels3-2ashfordtownmdx-itsbeenagooddayforus-warrilow 2 10793 0 0 /news/fleetleisure0-3suttonathletic-winningyourfirsttrophyisthehardestonesaysjamescollins 4 38838 0 0 /news/folkestoneinvicta0braintreetown0 3 11759 0 0 /news/sorryfleetfallatfinalhurdle-forthirdyearrunning 1 4964 0 0 /news/farnieswoopsforwinter-nolan-exclusiveinterview 1 4317 0 0 /news/13thoct03.html 1 0 0 0 /news/dartfordbosstonyburmanunveilsthesigningofpetersweeney 3 10332 0 0 /news/hollands250816 2 8352 0 0 /news/10thjune04.html 1 0 0 0 /news/glebe080818 2 7236 0 0 /news/crayassistantpaulbladeexpectstoughweek 2 7162 1 2 /news/kentleague/lordswood/30thsept03.html 1 0 0 0 /news/drmartens/eastern/fisher/13thaug04.html 1 0 0 0 /news/sevenoakstown3-2hythetown-weturnedupwiththewrongattitudeadmitsporter 1 6621 0 0 /news/551bc99b678f7 1 5919 0 0 /news/ebbsfleetunited1-0eastbourneborough-wevegotagoodchanceofgettingpromotionsaysbrown 3 27054 0 0 /archive-2006-2014/147 4 18322 1 0 /news/551a96773a089 1 6652 0 0 /news/charlton080805.html 3 0 0 0 /news/walkerstaysatfaversham 2 8608 0 0 /news/bromley030119 3 13104 0 0 /news/theofferfromleatherheadcameoutofnowheresaysdarrensmith 8 41044 3 2 /news/drmartens/eastern/sittingbourne/19thaug03.html 1 0 0 0 /news/sevenoaks310716 2 7650 0 0 /news/strikerjoneswillbewearingafolkestoneshirtbytheendoftheseasonsayscugley 2 9680 0 1 /news/punjab300819 3 11160 0 0 /news/tonbridgeangels1-2leiston-wevecomeupalittlebitshorttonightadmitsstevemckimm 3 23717 0 0 /news/Faversham130615 3 12315 0 0 /news/dulwichwaldren080615 3 12042 0 0 /news/551a9cf4da674 1 4045 0 0 /news/bromley3-1sevenoakstown-wererelyingonotherstowintheleaguesaysbromleybosskeithbird 1 9014 1 1 /news/refereehatzidakisimadeamistaketosendoffnathanpaul 1 3401 0 0 /news/551a9cf59f4b7 1 3568 0 0 /news/551a97983df76 1 3019 0 0 /news/dartford221015 3 11559 0 0 /news/seageraddsmorequalitytohissquad 1 4669 0 0 /news/youhavetoperformtokeepyourshirtsaysfoley 1 4351 1 0 /news/managerscometotermsfollowingaweekofupheaval 1 6806 0 1 /news/craywands121118 4 18121 0 0 /news/551a99e53bc2e 1 4463 0 0 /news/hythetown150321 18 56957 4 6 /news/shorts17072015 4 33433 0 0 /news/beckashf240819 3 28166 0 0 /news/kentleague/lordswood/14thaug03.html 2 0 0 0 /news/drmartens/eastern/sittingbourne/burgessvsittfat011103.html 1 0 0 0 /news/folkestoneinvicta1-0ramsgate-drydenpouncestogivefolkestonejoyoverrams 4 18406 0 1 /news/oconnellbeatingthedropisdefinitelyon 1 3975 0 0 /news/beckenham250920 8 28137 0 0 /news/100wellssettoapplyforpromotion 1 3473 0 0 /news/bridonropes230918 4 15490 0 0 /news/glebe270416 5 18190 0 0 /news/wemeanbusinessthisyearinsistscugley 1 6473 0 0 /news/drmartens/eastern/ashford/19thsept04.html 1 0 0 0 /news/folkestoneoncoursetocompletereserveteamdouble 4 32762 0 1 /news/eightypointswillgetuspromotedsaysburman 1 4075 0 0 /news/borehamwood221005.html 1 0 0 0 /news/beckenham041204.html 2 0 0 0 /news/cray260705.html 1 0 0 0 /news/551a967835d07 1 4001 0 0 /news/ryman/bromley/bromleyvlewes190803.html 1 0 0 0 /news/551bc5dd5d93f 2 8458 0 0 /news/551a9798efa36 2 13620 0 0 /news/moulespartscompanywiththeconference 1 3517 0 0 /news/sittingbourne090217 1 4112 0 0 /news/iwasreadytowalkawayfromthegameadmitsadamburchell 1 4536 0 0 /news/craysoh130316 4 37778 0 0 /news/suttonath180416 3 13347 0 0 /news/francisplotsrevenge 2 7412 0 0 /news/551a979958dae 3 26349 1 1 /news/fatrophyfirstqualifyingroundpreviews 2 14710 0 1 /news/thesefacupgamesmeansomuchtoeveryoneinnon-leaguefootballsaysramsgatebossdeanhill 3 15719 0 0 /news/551a931ea557b 2 11602 0 0 /news/tonbridgeangels0-1chelmsfordcity-warrilowaskswheredidhegetthetimefrom 1 6750 0 0 /news/idontwanttoloseoverthefestiveperiodsaysabbott 1 4329 0 0 /news/theresstillalongwaytogointhetitleracesaystable-toppinghessenthaler 1 4526 0 0 /news/angelshaveplentyinreserve 1 4151 0 0 /news/551a96dbbfb62 1 3922 0 0 /news/rusthall281016 3 10713 0 0 /news/doverathletic100920 2 6462 0 0 /news/charltonathletic150321 4 14240 1 0 /news/pmstatement040617 3 16585 0 0 /news/itstimetostartpickingupthreepointssayscugley 1 4981 0 0 /news/matchreportswellshavekeepersentoffasderesneteight 3 22869 1 0 /news/cordicebeckenhamrepresentsabigchallengeforus 4 16920 0 0 /news/wellingtown101217 2 8458 0 0 /news/vickerspitchwillsuitussaystitlechasinghythebossscottporter 2 7797 0 0 /news/werebuildingtowardswinningtheleaguenextseasonsayserithtownbossmarktompkins 3 12457 0 0 /news/rustelms180217 3 34419 0 0 /news/backingthefleettowembleyweymouthwillwanttoimpresstheirnewbosswarnskimble 2 8669 0 0 /news/lewishamborough3-2meridianvp-thereisalotofworktobedonesaysdarrellqueeley 8 120950 2 4 /news/NationalLeague140420 2 6040 0 0 /news/maidsaunders130515 4 14729 0 0 /news/ramsgatewinfirstthanettussle 6 31806 1 1 /news/sheppey260720 3 11727 0 0 /news/kentglebe191215 4 43874 0 0 /news/langtonrelishingimportantmonthahead 1 4358 0 0 /news/dartford010216 4 15562 0 0 /news/stevenage0-0maidstoneunited-theplayersandsupporterswereoutstandingsaysproudsaunders 3 24155 0 0 /news/jasonlillis290819 2 9022 0 0 /news/didcottown180320 2 7102 0 0 /news/itsanhonourtobeappointedstonesreservebossattheageof22saysjimbodle 1 3514 0 0 /news/551bc5e726ad0 2 9663 0 0 /news/5thsept05.html 2 0 0 0 /news/cugleypraiseslocalplayersforsteadyingtheship 1 5445 0 0 /news/sportingclubthamesmead300819 3 12396 0 0 /news/deresbossexpectdockersdog-fight-exclusiveinterview 3 10107 0 0 /news/hernebay151119 5 17062 2 2 /news/fisher6-1chichestercity-ifeltalittlebitmorecomfortaletonightsaysfisherbossfirkins 1 7503 0 0 /news/soccershortsmartinmovestomargate 1 3725 0 1 /news/conference/margate/11thsept04.html 1 0 0 0 /news/kentleague/thamesmead/2ndaug04.html 1 0 0 0 /news/sevenroch141015 3 27687 0 0 /news/551bc5dc03e76 1 3533 0 0 /news/glebe100120 2 7758 0 0 /news/wevedonebetterthanweexpectedatthestartoftheseasonsaysfavershamcoachclivewalker 2 8702 0 0 /news/imnotgoingtothrowthetowelininsistsfisherbossbillywalton 4 17704 0 0 /news/551a92507f9a0 1 3585 0 0 /news/leadinggoalscorers-clubbyclub 2 8608 1 0 /news/551a99e4cb044 7 85183 2 3 /news/meridian141216 4 14989 0 0 /news/beckenham310719 4 17198 0 0 /news/soccershorts110617 4 25338 0 0 /news/lewiphoe211218 4 43000 0 0 /news/iwantthissidetobethebesterithtownsidesaysmanagertonyrussell 1 5754 0 0 /news/boredart191217 3 26919 0 0 /news/salisburycity2-0maidstoneunited-imnotgoingtoblametherefereeforourdefeatsayshume 2 11882 0 0 /news/bearsted020819 4 14006 0 1 /news/wingschairmanweneedyoursupporttoreachplay-offs 1 3505 0 0 /news/iamlookingforagoodresponseagainstbarnetsayswellingunitedbossjamieday 3 9950 0 0 /news/theresthingsthatarentrightatthemomentadmitshessenthaler 2 8683 0 0 /news/whitstabletownvacancygeneratesinterestfromfarandwide 1 3650 0 0 /news/ashfordtown2-2waltoncasuals-yourluckrunsoutwhenyouredownthebottomrueslovell 1 5034 0 0 /news/551a95b46ab2d 1 4021 0 0 /news/ryman/bromley/bromvmole230803.html 1 0 0 0 /news/favershamtown5-1lordswood-luchfordrefusestolistentotitletalk 1 7298 0 0 /news/bromley040416 4 14745 0 0 /news/play-offsemi-finalspecialwerereadyforpromotionsayscraychairman 2 9208 1 0 /news/whyteleafe100321 11 36299 2 5 /news/wedontfearhigherleaguehorshaminsistseveritt 1 4310 0 0 /news/tonbridgeangels1-1wellingunited-wecancompeteagainstthetopteamssaystommywarrilow 1 6322 0 0 /news/sponsorourlivecoverageovertheeasterperiod 1 3060 0 0 /news/lordswoodbossjasonlillisaimingtocausecupshockovershininglightshythetown 2 10166 0 0 /news/soccershortssheppeyunitedsettolightupholmpark 4 42458 0 0 /news/councilpurchasestonebridgeroad-twothousandexpectedfordonsvisit 1 4413 0 0 /news/kentleague/sevenoaks/21stjuly03.html 2 0 0 0 /news/551bc5dd4e603 3 12526 0 0 /news/551a9678235b0 1 4975 0 0 /news/ashfordtown0-2craywanderers-titlechasetakesnewtwist 1 7138 0 0 /news/brommaid031216 3 31119 0 0 /news/chelsea4-0dartford-wellrememberthisfortherestofourlivessaysderenibrahim 7 184406 6 2 /news/werenotsettingintothelionsdenitsnotlikethatinguernseysaysderesbossmickycollins 3 15581 0 0 /news/tunbcray090418 2 19998 0 0 /news/tunbridgewells040619 5 19291 0 0 /news/aveley3-0thamesmeadtown-problemsmountformead 1 4377 0 0 /news/16thnov03.html 1 0 0 0 /news/ebbsfleetunited3-0borehamwood-wouldntitbenicetodreamaboutthethirdround-daish 2 11706 0 0 /news/folkvcorb210204.html 2 0 0 0 /news/kentcountyleaguerusthallbosspleasedwiththeplayingstandards-exclusive 1 5614 0 0 /news/hollandreflects130518 4 19425 0 0 /news/wewontgiveuptheghostsayswarrilow 2 8064 0 0 /ashford-2003-2006 12 35594 0 0 /news/faversham151118 5 21345 0 0 /news/551a99e453879 1 3206 0 0 /assets/datetimepicker/bower.json 1 894 0 0 /news/jacksonpledgeshisfuturetofolkestoneinvicta 1 5770 0 1 /news/canterbury111215 3 12540 0 0 /news/margbill210418 2 17836 0 0 /news/dulwleis130115 3 24158 0 0 /news/ebbsfleet181018 4 16614 0 0 /news/EFLStatement180320 3 12698 0 0 /news/bromsutt280717 1 7738 0 0 /news/bromley250517 1 3833 0 0 /news/551a97b1f234f 1 4623 0 0 /news/dagedove260319 3 19881 0 0 /news/othernews/cafcladies8thdec03.html 1 0 0 0 /news/wejusthavetomaintainourperformancelevelssaysfavershamtownbossrayturner 3 12005 0 0 /news/selsey011005.html 1 0 0 0 /isthmian-league/9 8 52362 1 1 /news/wevegottogetbacktowinningwayssaysbromleycoachneilsmith 2 9388 0 0 /news/doverathletic251120 2 5862 0 0 /news/shekicksmagazineunveiledaskentwomenscupandplatetitlesponsors 3 12621 0 0 /news/kentleague/deal/Sampson20.html 1 0 0 0 /news/facupspecialwycombewillbeinforashockinsistsmain 1 3936 0 0 /news/bromley210519 4 14893 0 0 /news/551bc5e79011f 2 8612 0 0 /news/551a96dc49b55 4 15378 0 0 /news/551bc99dcdbd9 1 2696 0 0 /assets/ckeditor/plugins/link/dialogs/ 1 389 0 0 /news/wellproduceagiant-killingifweplaythecardsright-porter 1 5107 0 0 /news/551a9250e2ff7 4 17306 0 0 /news/drmartens/premier/welling/17thsept03.html 1 0 0 0 /news/ashfordtownpressconference 1 2689 0 0 /news/frenchacehopestoearnhimselfdoverdeal 2 7019 1 0 /news/lewash121016 4 48074 0 0 /news/551a956ba4a09 1 4553 0 0 /news/ksports170117 3 13422 0 0 /news/gravesendnorthfleetvgraysathleticmatchpostponed 2 5502 0 0 /news/crawleytownsnapupcroydonteenager 1 4200 0 0 /archive-2006-2014/291 3 11929 0 0 /news/fordwelcomesdevoncreaminlastsixteen 1 3072 0 0 /news/wellingunited131219 2 7722 0 0 /news/bromvdartksc071003.html 1 0 0 0 /news/winchester111204.html 2 0 0 0 /news/greatwakeringrovers2chathamtown0 3 11189 0 0 /news/croydon171104.html 1 0 0 0 /news/hernebay0-2chathamtown-weweregenerallyawfuladmitshernebaybosssimonhalsey 2 12435 0 0 /news/iwantustostartputtingaruntogetherandmoveupthetablesaysholmesdalebossjpcollier 3 13897 0 0 /news/westwickham271104.html 1 0 0 0 /news/551bc5dd60a39 2 8260 0 0 /news/billericayforcerymanleagueintohastyswitch 2 9322 0 1 /news/crayvglebe090916 7 58697 2 2 /news/wewanttofinishashighaswecansaystonbridgeangelsbosstommywarrilow 1 4377 0 0 /news/bentaylorwastheheartandsouloftheclubforsixyearssayswoodstocksportschairronwelling 9 41753 4 4 /news/wevegottoavoidbeinginarelegationfightsaysbromleybossmarkgoldberg 2 8458 0 0 /news/resultsdecember2012 3 25730 0 0 /news/itwillbeagreatachievementtoreachthekentseniortrophyfinalsaysholmesdalecoachmitchell 2 9388 0 0 /news/drmartens/premier/dover/30thsept04.html 1 0 0 0 /news/kentleaguecupfinalspecialcassiusgivenchancetoshowhistalentsonthebigstage 1 6600 0 0 /news/folkestoneinvicta2harrowborough1 1 4303 0 0 /news/16thjune05.html 2 0 0 0 /news/lovellhashighhopesfornewstriker 1 4450 0 0 /news/dartford300916 3 12915 0 0 /news/kentleague/cray/kentseniortrophyqf030104.html 1 0 0 0 /news/drmartens/eastern/erith&belvedere/8thsept04.html 1 0 0 0 /news/resultsaugust2019 3 25115 0 0 /news/wewantlyddtopushusallthewaysayshollandsblairbosspaulpiggott 2 8584 0 0 /news/dealtown080917 1 3459 0 0 /news/maidstone240119 4 15922 0 0 /sevenoaks-2003-2006/ 1 3034 0 0 /news/ebbsfleetunited2-1burtonalbion-fleetarethelifeandsoleoftheparty 2 13853 0 0 /news/afccroy281016 1 3417 0 0 /news/drmartens/eastern/folkestone/folkvchat211003.html 1 0 0 0 /archive-2006-2014/76 1 4862 0 0 /news/bromleyfaceuncertainfutureaschairmanputsclubupforsale 2 7444 1 1 /news/ashfordtown0-4worthing-lovellultimatumplayformeorgetout 1 7224 0 0 /news/itsprobablythebiggestweekinmymanagerialcareersofarsaysjaysaunders 2 11030 0 0 /news/wellingtown011119 2 8130 0 0 /news/bearsted100716 5 23290 1 1 /news/551bc99d56395 1 4209 0 0 /news/hythetown090519 4 16013 0 0 /news/margate270817 1 4313 0 0 /news/dartfordhavehighhopesfortheirpaseside-exclusive 2 8729 0 0 /news/luchfordrubbishesbigspendingtag 1 3600 0 0 /news/crayhors180318 2 19992 0 0 /news/ashfordunited090620 2 7692 0 0 /news/lewesmarg230119 5 42900 0 0 /news/morganstepsdownfromhernebayoverfundamentaldisagreementovertacticsandteamselection 1 3722 0 0 /folkestone-2003-2006/7 4 11742 0 0 /news/soccershortsmanypeopletipusforpromotionthisyearsaysramsgatebosstimdixon 4 24900 0 0 /news/551a931dc97c6 1 4148 0 0 /news/tilleysuffersthirdbadbreak-exclusiveinterview 5 26120 0 0 /news/kentleague/cray/folkestone061104.html 1 0 0 0 /news/stonessettosignsecondchoicegoalkeeper-exclusiveinterview 5 22036 0 0 /news/welltrytomakebourneparkourfortresssaysmiltonfulstonbossaaronperry 2 8858 0 0 /news/margatepreview170705.html 2 0 0 0 /news/kentleague/VCD/19thaug04.html 1 0 0 0 /news/hessenthalerlookstocompletehisjigsaw 1 3321 0 0 /news/soccershortsfolkestoneinvictamustfind800permonthtopayofftaxbill 2 14010 0 0 /news/kentleague/lordswood/14thoct04.html 1 0 0 0 /news/robbinsiwanthungryplayers-exclusiveinterview 5 16995 0 0 /news/margate151215 7 53475 3 1 /news/grahamstack020717 1 6173 0 0 /news/dartford3-2horsham-wehavetobestrongenoughtohandleexpectationsaysburman 2 10938 0 0 /news/551bc5e27b41b 1 3545 0 0 /news/seagerhailshisfive-starteam 2 7710 1 0 /news/551bc5dc5a42f 3 22817 0 0 /news/bearsted080917 1 3579 0 0 /news/glebe031220 2 7758 0 0 /news/thefaknowourfeelingsaboutplayinginrymanonenorthsaysbinks 2 8980 0 0 /news/folkestone260320 4 13452 0 0 /news/13thmar05.html 1 0 0 0 /news/greenwich290318 1 4786 0 0 /news/canterbury040915 4 15654 0 0 /news/551a9250da3c1 4 23685 0 0 /news/bromgate170318 7 75790 0 0 /news/ivespentallofmybudgetadmitspromotionchasingjenkins-exclusive 1 4627 0 0 /news/15thmay04.html 1 0 0 0 /news/epsombeck280818 1 9573 0 0 /news/crockenhill010715 3 13497 0 0 /news/theplay-offsaretheminimumsayscraywanderersassistantpaulblade 1 3923 1 0 /news/weareallworkingtogethertobereadyforourkentleaguereturnsayscanterburycitychairman 2 6755 0 0 /news/wellingunited130120 2 7154 0 0 /news/holmesdalecommittedtofulfillingourfixturesforthisseasonandbeyond-clubstatement 1 3511 0 0 /conference-2003-2006 12 36852 1 1 /news/kentleaguelookatfavershamtownsapplication 1 3607 0 0 /news/551a9c927f0ea 3 17546 0 0 /news/wedontwanttobeinthekentleagueforeversaystunbridgewellschairmanjoecroker 1 6022 0 0 /news/551a9b482107b 4 13254 0 0 /news/abbotthashighhopesforbradbrook-exclusive 2 7402 0 0 /news/othernews/youthleaguetables110204.html 1 0 0 0 /news/fishvfolk201203.html 1 0 0 0 /news/vickershavesetthebenchmarksayswellsbossrobbins 1 4000 0 0 /news/wedothebestwecanwiththeresourceswehaveavailablesaysfisherbossgarylisney 1 4342 0 0 /news/isthmian150517 2 7540 0 0 /news/letsdoourbittokeeptwokentclubsaliveandkicking 2 5944 0 0 /news/sittingbournevfleet060903.html 2 0 0 0 /news/crockenhill050715 3 15072 0 0 /news/leatherhead210517 2 6451 0 0 /news/canterburycity060219 5 19366 0 1 /news/coneyhallbeginsearchforexperiencednewboss-exclusiveinterview 4 15572 0 0 /news/bromley090520 3 9382 0 0 /news/551bc5e47ec61 1 2940 0 0 /dartford-2003-2006/ 1 2982 0 0 /news/pennockenjoyscompetitionforplaces 4 13536 0 0 /news/crayvalley140719 3 11427 0 0 /news/hessenthalerplansshake-upatchampions-electdoverathletic 2 7573 0 0 /news/16thnov05.html 2 0 1 0 /news/ramsaddanotherlocalladtotheirsquad 2 6524 0 0 /news/551a96770f7f3 3 13221 0 0 /archive-2006-2014/53 2 9938 0 1 /news/sittingbourne1-5dartford-youveletdowntheclubblastslovell-exclusive 1 7721 0 0 /news/sevenoaks170716 3 15795 0 0 /news/londonbuildingcollapse 1 3566 0 0 /news/sevenoakslouiscollins240715 7 40475 2 2 /news/551a92502fb7c 2 7899 0 0 /news/hornfolk010919 3 24646 0 0 /news/kentleague/deal/Sampson3.html 1 0 0 0 /news/tonbridgeangels3-0tunbridgewells-brombyisinhighdemand-exclusiveinterviews 1 7384 0 0 /news/28thJan04.html 1 0 0 0 /news/5thdec03.html 1 0 0 0 /news/icantseehernebayslippinguptoomuchsaysvcdathleticbossrickybennett 1 4647 0 0 /news/oldbrom260118 2 10352 0 0 /news/ryman/bromley/leatvbrom181003.html 1 0 0 0 /archive-2006-2014/286 3 11990 0 0 /news/551a979a54495 1 5477 0 0 /news/wewillneedtobeflyingfromthefirstminutesayswoodstocksportsassistantchriscooper 3 12709 0 0 /news/imabsolutelyguttedandshatteredthatithasntworkedoutsaysfabiorossi 3 10973 0 0 /news/everyoneispullingtogetherforgeorgehoward 9 52157 1 1 /news/vickersbossfoleymakestwounprecedentedstarsignings 2 9578 0 0 /news/facupfirstrounddrawtheresnoillfeelingsbetweenusandgills-doverchairman 2 7670 0 0 /news/sct301116 3 11256 0 0 /news/kentleague/thamesmead/9thsept04.html 1 0 0 0 /ashford-2003-2006/ 1 2966 0 0 /news/tuncray070317 1 12873 0 0 /news/wellgiveitthebestwevegotsaysleatherheadkeeperderenibrahim 11 154252 7 7 /news/stoneschairmanasksforfinancialsupport 2 9987 1 0 /news/bromleyneilsmith130518 4 24690 0 0 /news/ashford200815 4 14789 0 0 /news/wellingunitedappointjamieturnerandjakegallagherasjoint-caretakermanagers 3 11027 0 0 /news/everyonewantstoplayinafinalsayserithbelvederemidfielderpaulspringett 1 4892 0 0 /news/lordswood010916 7 65603 4 2 /news/neilcugley1000 4 17442 0 0 /news/thamesmeadtown1-2ashfordtown-injuriesmountupforashford 7 122083 2 3 /news/newromney300519 2 6504 0 0 /news/551a9718b4dcc 2 6815 0 0 /news/ebbsfleet081118 3 11931 0 0 /news/tonbridge020106.html 2 0 1 0 /news/ifwedontdowellenoughthenitsmyfaultsaysmargatebossiainoconnell 1 4265 0 0 /news/drmartens/eastern/sittingbourne/sittvburg170104.html 1 0 0 0 /assets/ckeditor/plugins/iframe/ 5 1868 0 0 /news/erith&belvedere111204.html 2 0 0 0 /news/19thapr05A.html 3 0 0 0 /news/resultsaugsept2016 3 41837 0 0 /news/whitstable141204.html 1 0 0 0 /news/ramswelcomelordstosouthwood 4 12258 0 0 /news/charlton231216 4 15071 0 0 /news/sailsburyvfolkestone200903.html 2 0 0 1 /news/sevenoakstown1-2eastpreston-wejusthaventputtheballinthenetadmitsmickycollins 3 28307 0 0 /news/ashford250118 1 3577 0 0 /news/welling020617 1 3605 0 0 /news/sheppey100416 4 20404 0 0 /news/fleetseeknewdevelopmentpartner 2 6773 0 0 /news/551a97b13be5d 1 4573 0 0 /news/formerpremierleagueacesetforhernebaymove 1 5077 0 0 /news/kentleague/thamesmead/23rdaug03.html 1 0 0 0 /news/bromley260719 2 6430 0 0 /news/wevegotamassivehurdletoovercomeadmitsdartsbosstonyburman 1 4636 0 0 /news/theteamwhowantsitthemostwillgettothefinalsayscorinthianbosstonysitford 2 8512 0 0 /news/rookgivenanotherchancetoimpressseagulls 2 9360 0 0 /news/thefacarlsbergvasefourthrounddraw-1 4 11090 0 0 /news/551a931ec0401 2 9361 0 0 /news/rothwell081005.html 1 0 0 0 /news/greenwichboroughbeginsearchforanewbossafterjohncumberbatchleaves 1 3988 0 0 /news/edgwaretownconfirmtheirsaddemise 1 3195 1 0 /news/tonbridgeangels050420 3 13619 0 0 /news/charltonathletic0-2gillingham-weshouldbewinningthiseveryyearsaysgillinghambossvarley 1 7588 0 0 /news/beckenhamtown3-5corinthian-weredelightedtogetthroughsayscorinthianbossjamescollins 3 36701 0 0 /news/8thmay05.html 2 0 0 0 /news/chatham031019 21 103605 15 15 /news/greenstan290919 3 38390 0 0 /news/haveimissedit-yesandnosayssevenoakstownbosssimonjones 1 3867 0 0 /assets/smartmenus/ 8 3701 0 0 /news/greeniesfridaypreviewonthefacuptrail 2 11657 0 0 /news/ourfocuswillbeonsundayagainstbrightonsaysgillscoachjackwheeler 4 16978 0 0 /news/charltonathletic180619 3 10274 0 0 /news/weneedtohaveawinningmentalitysaystunbridgewellsbossmartinlarkin 1 4932 0 0 /news/bordenvillage250920 2 6958 0 0 /news/bromley110615 6 42435 2 2 /news/551a979a711c4 1 4625 0 0 /news/mycurrentpriorityistofindahomeforcraywandererssayschairmangaryhillman 2 7330 0 0 /assets/ckeditor/plugins/div/dialogs/ 1 369 0 0 /news/551bc5e71389a 2 7294 0 0 /news/551bc5e86ea8c 3 12581 0 0 /news/resultsdec2015 4 36942 0 0 /news/thebigkick-offkentleagueannouncefixturelists 1 3449 0 0 /southern-counties-east-football-league/10 6 46040 1 1 /news/551a979a8306a 1 4964 0 0 /news/chatham110817 1 3564 0 0 /news/ashfordtown1-0folkestoneinvicta-lovellstrikeclawsashfordoutofdropzone 2 12517 0 0 /news/phoenixsports311218 4 15830 0 0 /news/soccershorts240617 7 34056 1 1 /news/iwanttotaketheclubforwardsaysmargatessurprisechoicebutler 1 4622 1 1 /news/corihebb050920 3 33456 0 0 /news/wewontbreakthebankinsistsdartsbossburman 3 10031 0 0 /news/551a9798419f2 2 14262 0 0 /news/bromley210218 4 17429 0 0 /news/ryman/bromley/horsvbrom091203.html 1 0 0 0 //.env 4 14236 3 1 /news/soccershortsealhamdecidestoretire 2 18601 0 0 /news/lordsvbeckfavase200903.html 1 0 0 0 /news/itsimportantwestaypositiveduringtestingtimessayswarrilow 2 10916 0 0 /news/8thaug05.html 1 0 0 0 /news/favershamtown3-2hythetown-wewasntatourbesttodayadmitsfavershambossrayturner 3 30142 0 0 /news/afchornchurch1-1tonbridgeangels-warrilowstroopssoclosetotheplayoffs 2 11527 0 0 /news/kentsleadinghotshots-lastupdated22032012 1 3379 0 0 /news/551a956c6604c 1 3682 0 0 /news/kentleaguecupfinaltompkinssetforfinalswansong-exclusive 1 4179 0 0 /news/ashfordgivehomelandsaface-lift 1 3596 0 0 /news/sceflstatement181220 7 36510 1 1 /news/craycray210718 4 36636 0 0 /news/newportcountysofferforadambirchallwasaninsultsaysdoverathleticchairmanjimparmenter 1 3320 0 0 /news/ebbsfleetunited1-1millwalllionessesaet-millwall3-1pensimsoproudsaysfleetboss 1 6913 0 0 /news/lewisham020518 4 14866 0 0 /news/13thoct05.html 1 0 0 0 /news/551bc5e45fc2c 1 3483 0 0 /news/doverremovestainesfromtitlerace 1 3412 0 0 /news/seagerexplainskingabsence-exclusiveinterview 2 6447 0 0 /news/glebe060919 4 13804 0 0 /news/erithtown210316 4 18973 0 0 /news/fisher140719 4 14214 0 0 /news/551bc5e681be1 2 7980 0 0 /news/551bc5e76e41a 1 4370 0 0 /news/drmartens/eastern/erith&belvedere/27thnov03.html 1 0 0 0 /news/conference/margate/16thoct.html 1 0 0 0 /news/551bc99c9843d 1 6526 0 0 /news/ourtriptobournemouthhasserveditspurposeadmitsburman-exclusive 1 3403 0 0 /news/phoenix060418 1 3754 0 0 /news/vcdrom131216 2 19770 0 0 /news/drmartens/eastern/sittingbourne/lymingtonreplay070804.html 1 0 0 0 /news/crayvcda280120 2 22406 0 0 /news/ithinknowwedowanttoprogressasfaraswecansaysotfordunitedbossjimgillan 2 7928 0 0 /news/iminchargeofthewholelottfornowsayscumberbatch-exclusiveinterview 3 12845 0 0 /news/hessenthalerreflectsonfleetwoodwinitwasareallygoodperformanceandagreatresult 1 5257 0 0 /news/aseriesofkicksintheteethhavemadethejobsomuchmoredifficultsaysrickybennett 3 15650 0 0 /news/chercray190519 7 71589 1 1 /news/cugleymakesdoublesigning 3 9916 0 0 /news/chatram101016 4 43274 0 0 /news/soccershorts280616 5 35671 1 1 /news/551bc5df58691 1 4699 0 0 /news/551a96786d942 3 11001 0 0 /news/beckenhamtownpulloffsheringhamsigning 1 3719 0 0 /news/charltonathletic071020 4 15418 0 0 /news/kentleague/sladegreen/sladevgreen140204.html 1 0 0 0 /news/soccershorts140616 4 26258 0 0 /news/ashford220518 1 3527 0 0 /news/charltonathletic0-3gillingham-weshouldwinmorethanweshouldlosesaysjamesmarrs 4 44130 0 0 /news/dartford2-2molesey-sampsonssideopenprincesparkexclusiveinterviews 4 26492 0 0 /news/chatham010120 2 9636 0 0 /news/flackwell021004.html 1 0 0 0 /kent-invicta-league/10 5 40231 1 1 /news/wemustputlastyearbehindussayslewis 1 3918 1 0 /news/carshalton240905.html 1 0 0 0 /news/rustwick120818 1 8860 0 0 /news/551a9798539bc 2 5018 0 0 /news/551bc5e167363 1 5800 0 0 /news/folkestoneinvicta1-3stainestown-cugleysufferssickeningdefeat 1 4911 0 0 /news/burmanplottingfacupupset 1 4477 0 0 /news/gwr020405.html 2 0 0 0 /news/redhill0-1folkestoneinvicta-hopefullywecanmakefolkestoneabiggerclubagain-neilcugley 6 58268 1 1 /news/maidstoneunited1-3carshaltonathletic-imconfidentwecangetoutoftrouble-sayspeternott 1 5537 0 0 /news/551bc5dc15fb6 1 4693 0 0 /news/eastbournevlordsfac230803.html 1 0 0 0 /news/someoftheacademyladsdeservetostartthefinalsaysmaidstoneunitedbossjaysaunders 4 22334 1 0 /sevenoaks-2003-2006/3 2 5280 0 0 /news/9thfeb04.html 1 0 0 0 /news/cray070804.html 2 0 0 0 /news/dontforgettommysampsonsbenefitnightisonsaturdaynight 2 14844 1 1 /news/kentleague/tunbridgewells/thamesmead011204.html 1 0 0 0 /news/bstortford120305.html 3 0 0 0 /news/551a956c2de9d 1 4757 0 0 /news/19thapr05.html 3 0 1 0 /news/bearsted171016 2 8068 0 0 /news/drmartens/eastern/sittingbourne/dartvsitt160304.html 1 0 0 0 /news/dartford100518 4 15955 0 0 /news/wereallywanttowininthefirstroundofthefacupsaysholmesdalejoint-bossjohn-paulcollier 5 20835 0 0 /news/parmenteriwilltakemytimetogettherightman 2 7848 1 0 /news/551a9c930f09a 2 11441 0 0 /news/bromweston180415 7 56092 0 0 /news/erithbelvederebossmattlonghurstsearchesforunder21managementteam 3 11463 0 0 /news/dartssendcarteroutonloan 1 3840 0 0 /news/bromley140618 5 36442 0 0 /news/sporasco111019 5 42717 0 0 /news/sheppey090218 2 8991 0 0 /news/ramsgate300619 4 15352 0 0 /archive-2006-2014/55 2 9974 0 1 /news/wecantgiveupwecangetourselvesoutofdropzoneinsistspinnock 2 7188 0 0 /news/tonbridgeangelsonline.co.uk 1 0 0 0 /news/551bc5e1c32b9 2 8862 0 0 /news/sct280816 3 10923 0 0 /news/soccershortskcfapublishcountycupdraws 1 9136 0 0 /news/stafav120915 3 29937 0 0 /news/fisher2-1kingsburylondontigers-mynaiveteamwillimproveinsistslisney 1 6689 0 1 /news/kentleague/erithtown/erithtown.html 1 0 0 0 /news/gillsafcwimb111015 7 117864 3 2 /news/17thmay04.html 2 0 0 0 /news/fisher1-0rochesterunited-ijustcantcommittorochesterunitedsaysdarrenphillips 3 27686 0 0 /news/wellingunited0-0thurrock-ineedmoneytobringsuccesssaysford 2 13341 0 0 /news/solidaritywillhelpclaimourplay-offspotsaysford 2 7565 0 0 /news/drmartens/eastern/folkestone/29thsept03.html 1 0 0 0 /news/elmsbeck010817 4 36542 0 0 /news/resultsnovember2014 2 20562 0 0 /news/kentleaguechristmasprogrammesuffersfromthebigfreeze 1 3901 0 1 /news/imnotputtinganypressureontheladssaysfisherbossstevefirkins 1 4110 0 0 /news/kentleague/sevenoaks/tunwells170804.html 1 0 0 0 /news/imhappyatthefleetsaysheroicstoppercronin 2 7240 0 1 /news/dulwton280316 4 42642 0 0 /news/phoenixsports170120 2 7394 0 0 /news/fisher2-4erithtown-theresnopressureonustowinthekentleagueadmitstonyrussell 1 9033 0 0 /news/ifwecanshowthesamecommitmentwecangetaresultsaysthamesmeadtownbosskeithmcmahon 5 25895 0 0 /news/551bc99b36e96 1 2994 0 0 /news/551a979b26d86 2 8752 0 0 /news/suttonath110518 4 19026 0 0 /news/sladegreenpulloffcotterillcoup 1 3022 0 0 /archive-2006-2014/269 2 8708 0 0 /news/craywands140318 2 6405 0 0 /news/romewasntbuiltinadaywarnsashfordunitedbosstonyreynolds 1 5844 0 0 /news/resultsseptember2016 3 33251 0 0 /news/wewanttofinishonahighsayswhitstabletownbossnickysouthall 3 12552 0 0 /news/hernebay180920 3 11152 0 0 /news/551bc5e512af0 2 12044 0 0 /news/glebe101019 3 11091 0 0 /news/thissquadofplayerswillnotgetusrelegatedinsistsward 3 14942 0 0 /news/551bc5e8b318c 2 6637 0 0 /news/atop-eightfinishwillbedeemedasasuccessfulseasonsaysderesbossmickycollins 1 4832 0 0 /news/chathamtown5-1royalengineers-itsalwaysnicetoscoregoalssayskevinwatson 2 24708 1 1 /news/dartford0-0edgwaretown-wedidntdoourselvesjusticeadmitsburman 1 5527 1 0 /news/7thapr05.html 2 0 0 0 /news/chathamtown0enfieldtown2 1 3802 0 0 /archive-2006-2014/190 9 40547 0 0 /news/hasimdeenplacedontransferlistbytrott-exclusive 5 20112 0 0 /news/sittingbourne220619 5 30616 0 0 /news/imhappywithprogresssofarsayshernebaybosssamdenly 1 4283 0 0 /news/soccershortsfavershamstruckbyboltoutoftheblue 1 4971 0 0 /news/fleetflytheflaginfacarlsbergtrophylastsixteen 2 6179 0 0 /news/margatearebuzzingastheylookforwardtotwobigawaytrips 2 6460 0 0 /news/maidstoneunited2-2worthing-wehavetoimprovesaysfrustratedstonesbossjaysaunders 3 26401 0 0 /news/ahwansuffersinjuryset-back 2 7525 0 0 /news/551a97b1183b7 1 4370 0 0 /news/30thapr04.html 2 0 0 0 /news/tonbridgeangels1-1hayesyeadingunited-wemustnotlosetosidesaroundussayswarrilow 2 15097 0 0 /news/lordswood011216 2 7225 0 0 /news/thamesmead181015 4 16437 0 0 /news/dulwtonb190216 4 14518 0 0 /news/charltonathletic291119 5 23297 0 1 /news/ryman/bromley/29thfeb04A.html 1 0 0 0 /news/themostimportantthingistostayinthisdivisionsaystonbridgeangelsbosstommywarrilow 3 11000 0 0 /news/wembleyheroeshessenthalerkentfootballisonthemap-exclusive 1 4739 0 0 /news/idontwanttogetbeatbythesameteamtwiceinaseasonsaysjamieday 3 13388 0 0 /news/resurgentclubstrivesfornew25-yearlease-exclusiveinterviews 6 40276 0 0 /news/leeworgan050420 9 173765 6 6 /news/wevegottoimproveonourtravels-hares 2 9762 0 0 /news/ashfduns300116 5 42061 1 1 /news/erithglebe250817 1 10088 0 0 /news/kspmer070116 4 47816 0 0 /news/conference/margate/26thfeb04.html 1 0 0 0 /news/farnieaimingforplaceinlast32offavase-exclusive 1 4348 0 0 /news/gillingham070820 3 9965 0 0 /news/veterangoalkeeperrogersstillplayingatsixty-exclusiveinterview 1 3741 0 0 /news/551bc5df0537c 3 26344 0 0 /news/551a97b24391f 1 4371 0 0 /news/comeandjoinusandprovehowgoodyouare 1 3882 0 0 /news/resultsoctober2016 4 48598 0 0 /news/faversham170117 1 4429 0 0 /news/afccroydon080917 2 7062 0 0 /news/dartford191017 1 4441 0 0 /news/itwillhavetobeagooddealtotakemeawayfromramsgatesaysjimward 1 5364 0 0 /news/fixturesforapril2009 2 11133 0 0 /news/bromley080618 3 10230 0 0 /news/losingtodoverathletichurtmeadmitsunder-fireandyhessenthaler 1 4243 0 0 /news/551bc5e0d3c5f 3 34309 2 2 /news/iwantmoregoalsfromfazakerleysaysday 1 3288 0 0 /news/kentleague/beckenham/22ndnov04.html 1 0 0 0 /news/cassstillhasafutureatprincespark-burman 2 9615 0 0 /news/stainvcd160216 4 34610 0 0 /news/iamexpectingamarkedimprovementwithkevinharrisinchargesaysraysimpson 5 26448 1 1 /news/551bc5dc52d16 2 9356 0 0 /news/corinthian120218 1 3421 0 0 /news/walthamforest3chathamtown1 4 15616 1 0 /news/warrilowsettoendkeepersearch 2 8586 0 0 /news/tunbwhit050518 2 19632 0 0 /news/hythetown1-1holmesdale-stalemateleavesdooropenforvickers 2 9089 1 0 /assets/select2/src/js/banner.json 1 413 0 0 /isthmian-league/20 8 40190 0 0 /news/bromley5-0chelmsfordcity-imnottalkingaboutwinningtheleagueorpromotion-markgoldberg 2 18300 1 0 /news/werehandpickingqualityplayerstomakeusbettersayschathamtownbosskevinwatson 4 20154 0 0 /news/iwantplayerstograbtheheadlinessaysfleetbossliamdaish 1 4832 0 0 /news/ashfordunited140420 2 7206 0 0 /news/bromley1-1wellingunited-wehaventgotthedivinerighttogetthreepointssaysjamieday 1 7351 0 0 /news/22ndsept04.html 2 0 0 0 /news/ryman/bromley/brackvbrom300903.html 1 0 0 0 /news/551bc99ba98f1 1 2940 0 0 /news/hendon1-0folkestoneinvictasevenpointswillkeepusuppredictscugley-exclusiveinterview 2 11828 0 0 /news/tradtionalboxingdayfixturewillattractmoresupportsayswhitstabletownchairmangaryjohnson 2 7640 0 0 /news/551bc99a72e60 1 5054 0 0 /news/fansopenvirtualstadiumtoraisefundsformaidstoneunited 1 4197 0 0 /news/crayvalley200918 3 10749 0 0 /news/bromley3-4dartford-wehadagreatopportunitytodayandweblewitadmitsmarkgoldberg 3 31201 0 0 /news/holmesdale0-4dulwichhamlet-weretryingtofinishhigherthanwedidlastyearsayscollier 3 28248 0 0 /news/formerrefereejohnsonjoinswhitstableboard 2 9374 0 0 /news/itsalwaysatoughencounteratdealsaysbeckenhamtownbossjasonhuntley 3 13643 0 0 /news/dulwichhamlet150619 3 9765 0 0 /news/pagham040904.html 1 0 0 0 /news/ryman/bromley/bromvleat240104.html 1 0 0 0 /news/hernebay3-1favershamtown-iwontneedtomotivatemyplayersforsecondleg-luchford 2 13643 0 0 /news/ramsgateiswhereienjoyedmyhappiesttimesinfootballsayswillgraham 3 11072 0 0 /news/brownquitsunderperformingderes 1 3087 0 0 /news/hollandsblair4-4ramsgate3-4pens-theygavemeeverythingsaysproudpaulpiggott 2 22656 0 0 /news/pre-seasonincomeiskeepingusgoingincoldsnapsaysdartschairman 1 4850 0 0 /news/welling171116 3 10167 0 0 /news/statattackrickyfreemanleadsgoalscoringchartswith24goals 1 5729 0 0 /news/soccershortsineedhelptopaybeckenhamsbillssaysmanagerjasonhuntley 1 15399 0 0 /news/drmartens/eastern/dartford/9thoct03.html 1 0 0 0 /news/18thsept05.html 2 0 0 0 /cray-2003-2006 12 36506 0 0 /news/18thmar05.html 2 0 0 0 /news/corinthian1-1erithtown-wedontexpecttobetopforlongadmitstonysitford 1 7893 0 0 /news/isthmianleaguestatement171220 4 21021 1 1 /news/wereaspiringtodobetterthanlastseasonvowsnewsevenoaksboss 2 8905 0 0 /assets/fileman/php/movedir.php 1 45 0 0 /news/wemustkeepourfeetonthegroundsaysthurgood 1 4296 0 0 /news/kentleague/greenwich/23rdnov03.html 1 0 0 0 /news/551a96dc43657 4 25617 0 0 /news/merrychristmaseverybody 1 2536 0 0 /news/wemuststayintouchwiththeleaderssaysfrancis 2 8239 0 0 /news/551bc5db9539d 3 13376 0 0 /assets/fileman/system.inc.php 1 0 0 0 /news/itssuchashametohavetoletsomanyplayersgosaysfisherbossdeanharrison 4 17588 0 0 /news/kentleague/thamesmead/26thjune03.html 2 0 0 0 /news/fisher0-4erithbelvedere-everythingalfiemaytouchesseemstogoesinsaysmattlonghurst 3 31310 0 0 /news/551bc5df87596 1 4952 0 0 /news/551bc5dbcbdfc 4 20054 1 1 /news/maidstone170716 3 13671 0 0 /news/sittingbourne1-2hythetown-wereshowingsignsthatwecanturnitaroundsaysbradleyspice 1 5995 0 0 /news/phoechar041219 2 19054 0 0 /news/unfortunatelyasaclubwerenotinapositiontotemptthemtostayadmitswhitstabletownboss 1 3540 0 0 /news/canterbury091118 3 11712 0 0 /news/551bc5e5191d0 1 3192 0 0 /news/fisher1-0hendon-werelookingadecentsidesaysfisherbossstevefirkins 2 28816 1 0 /news/drmartens/premier/welling/10thdec04.html 1 0 0 0 /news/551a99e4398ff 3 12099 0 0 /news/daishhandedextrafundsthrough80000joint-transferdeal 1 3231 0 0 /assets/uploads/content/1908_Challenge.htm 1 30083 0 0 /news/phoenix260118 1 3660 0 0 /news/princesparkspecialwinningwastheicingonthecake-exclusiveinterviews 2 10968 0 0 /news/guttedburmanseesdartsunbeatenstartgo 2 25385 1 1 /news/551bc5e498895 1 3032 0 0 /news/wewanttogouptotherymanleaguesayshernebaychairman 1 4293 0 0 /news/ramsgate120620 4 13817 1 0 /news/551bc5dbe45de 3 18667 0 0 /news/wedliketogetasfaraswecaninthefacupsayswellingunitedbossjamieday 3 12132 0 1 /news/bullardreturnstostonebridgeroad 1 3172 0 0 /news/551bc5dc24a9c 1 3159 0 0 /news/whitstablepaytributetobeatenbears-exclusiveinterviews 1 4583 0 0 /news/concernedwardindesperateraceforreplacementgoalkeeper 1 4078 0 0 /news/kentleague/maidstone/24thfeb04.html 1 0 0 0 /news/itsasaddayforeverybodyconnectedwithashfordtownfootballclubsayshurtlovell 2 15226 0 0 /news/youwanttoprogressasfarasyoucaninthefacupsaysclivewalker 2 9331 0 0 /news/conference/margate/26thjuly04.html 1 0 0 0 /news/hytheheroesiwillbringtheladsbackdowntoearthintimeforfavasetriptovcdsaysporter 1 5241 0 0 /news/metrogas290416 2 6240 0 0 /national-league/25 3 14173 0 0 /news/failurethiscloseisnotanoptioninmybooksayshernebaybosssimonhalsey 2 10555 1 0 /news/stoneschairmanissuesapologyafterlatetrophypostponement 2 8042 0 0 /ladies-football/2 4 13581 0 0 /news/cuxton250517 3 10670 0 0 /news/551bc5d9e4bc4 2 6522 0 0 /news/551bc5e2c003c 1 3557 0 0 /news/favershamtownunveiltheirnewmanagementteam 1 3751 0 0 /news/margatesuspendkinnearandrainewithimmediateeffect 1 3203 0 0 /news/drmartens/premier/welling/17thdec03.html 1 0 0 0 /news/towerhamlets300321 33 114928 3 11 /news/551a9c929ef3b 1 4331 0 0 /news/551bc5e5cf2ff 1 3780 0 0 /news/resultsmarch2017 3 29049 0 0 /news/hythetown2-1favershamtown-idontthinkwewereatourbestadmitsunbeatenporter 1 6923 0 0 /news/favershamtown301020 2 7610 0 0 /news/erithtown010116 3 11118 0 0 /news/551a9678beb01 1 6205 0 0 /news/soccershorts110720 3 18203 0 0 /news/drmartens/premier/dover/Northwood040904.html 1 0 0 0 /news/erithandbelvedere301020 2 7790 0 0 /news/bromley280719 5 21000 0 0 /archive-2006-2014/78 1 4959 0 0 /news/hernebaysearchforexperiencedgroundsman 3 11035 2 2 /news/bromley210417 3 16684 0 1 /news/551a9799b9d93 4 47910 0 1 /news/welling031117 2 7631 0 0 /news/comeandwatchourgoodproducturgesfolkestoneboss 3 14890 0 0 /news/erithbelvedere2-1hernebay 2 17729 1 0 /news/bluesquarebetsouthopeningdayfixturesgivedoverathleticearlyrevengechance 1 3853 0 0 /news/ashfordunited1-2hanwelltown-theleagueisourmainprioritynowsaysjohnovard 2 36230 0 1 /news/havingmybudgettakenawayfrommemadeitverydifficultformesaysglennbarlow 3 11732 1 0 /news/manchester280517 3 11093 0 0 /news/2ndnov05G.html 4 0 1 0 /news/letshopewecangoandclaimamassivescalpsaysbromleymatch-winnerdannywaldren 2 11544 0 0 /news/551a9c0eabd86 4 16462 0 0 /news/551bc99b3fe26 1 3761 0 0 /news/greenwich040118 1 3619 0 0 /news/sindensignsforkentleaguersvcdathletic 1 4196 0 0 /archive-2006-2014/193 7 30816 0 0 /news/rymankingsclinchtitlekingstonian2-6dartford-wedeserveeverythingthatwevegot-burman 2 15154 0 0 /news/wefindithardtokeepholdofourplayerssaysebbsfleetunitedbossliamdaish 1 4172 0 0 /news/551a956c28b1e 2 6594 0 0 /news/kentishrivalsrelishingthetieoftheround 2 11360 0 0 /news/CONIFAFWorldCupBarawa300518 3 17555 0 0 /news/551bc99ce347d 1 4757 0 0 /news/wealdstone171205.html 1 0 0 0 /news/everyoneknowsthatthefacupdoesnttakeanyprisonerswarnsstonesplayer-bossjaysaunders 1 4242 0 0 /news/fisherchairmantomeetfanstoprovidestadiumupdate 4 14932 0 0 /news/dartford6-0horshamymcaburmanimthrilledabout4000princesparksell-out 2 14310 0 0 /news/551a925023bdf 2 6469 0 0 /news/stainestown2-1ramsgate-wardfuryovercostlypenaltydecision 1 6825 0 0 /news/croyath040317 1 3616 0 0 /news/motthall180417 3 32465 0 0 /news/wevegotverylittletoloseandanawfullottogainsaysfavershamtownbossrayturner 2 8806 0 0 /news/itsimportantforustoimproveourformathomesaysbromleybossmarkgoldberg 3 12719 0 0 /news/551a956b84519 1 3237 0 0 /news/ihavetheutmostrespectforourkentleaguerivalssayscroydonboss-exclusiveinterview 5 25867 0 0 /news/chattoot150816 2 17633 0 0 /news/sittingbourne0-0arleseytown 2 8499 0 0 /news/551a956c6894f 2 11850 0 0 /news/bromley301117 3 11457 0 0 /news/tunbridgewellssignsixteen-year-oldwonderkid 1 4438 0 0 /news/corileig290220 2 6084 0 0 /news/rymanpremierleaguedayofdestinyitsdowntowhohasthemostbottlesaysstonesbosswalker 1 10345 0 0 /news/ryman/bromley/bromvcroyath240204.html 1 0 0 0 /news/thamesmeadtown2-2erithbelvederegormanbemoanescostlymistakes-exclusiveinterviews 2 14268 0 0 /news/fishlydd181117 4 45968 0 1 /news/chathamtowncanbeclassedasasleepinggiantsaysmiles-exclusiveinterview 5 26647 0 0 /news/ashford061117 2 6317 0 0 /news/chathamtown0bedfordtown2 3 11087 0 0 /news/sevenoaks310515 4 17102 0 0 /news/facupspecialkentclubsembarkontheroadtowembley-exclusivepreviews 1 6682 0 0 /news/FAStatement040820 5 20516 0 0 /news/tonbridge291217 1 4071 0 0 /news/ramsvbeck030404.html 2 0 0 0 /news/lyddtown050216 4 14506 0 0 /news/fishcori220419 5 54347 0 0 /news/drmartens/premier/welling/8thsept04.html 1 0 0 0 /news/crayvsporting160803.html 2 0 0 0 /news/8thJune05.html 2 0 0 0 /news/imgoingtokeepworkingtobringinnewplayerssaystonbridgeangelsbossstevemckimm 4 16398 0 0 /news/ashfordsdroughtenjoyssuddendownpourofrain-exclusiveinterviews 2 12214 0 1 /news/thamesmead161004.html 2 0 0 0 /news/stonespromotenottandcornwellfromwithin 1 3809 0 0 /news/saturday21stjanuary2006fixtures 2 6310 0 0 /news/551bc5e5017da 1 3054 0 0 /news/deresdropfivepointsoverholidayprogramme 4 32432 0 0 /news/drmartens/eastern/dartford/9thfeb04.html 1 0 0 0 /news/bromley061219 2 7294 0 0 /news/551bc5e145adc 3 31333 1 0 /news/footballerslaunchappealtoraise100000forseriouslyillgoalkeepergeorgehoward 4 14878 0 0 /news/fordlookingformoreknightsinshiningarmour 2 8312 0 0 /news/beckenhamtownfc.co.uk 2 0 1 0 /news/maidstone020805.html 2 0 0 0 /news/kentrivalsbidtobankthemuch-neededloot 1 4706 0 0 /news/drmartens/eastern/folkestone/fleetvfolk280204.html 1 0 0 0 /news/thrillingsidescomehead-to-headinpromotionshowdown 1 4256 0 0 /news/FAStatement290920 4 13332 0 0 /news/bromley120218 4 16857 0 0 /news/wellingunitedbossjamiedayreadytoconfirmhiseighteen-mansquadwithintendays 1 4646 0 1 /news/youvegottogivecredittoeveryonebehindthescenesfortheireffortssaysluchford 2 7774 0 0 /news/anynewswillfollowhere-1 1 2533 0 0 /news/crayvalley1-2lingfield-itwouldhavebeennicetorepaythechairmanwithavaserun-chapman 2 16674 0 1 /news/fordrelishestheirunderdogtagasvickersaimfortheirsecondtrophy 1 4158 0 0 /tunbridge-wells-2003-2006/ 1 3046 0 0 /news/28thjan05.html 1 0 0 0 /news/551bc5e17a3bd 2 8230 0 0 /news/whitstabletown2beckenhamtown0 4 18718 0 0 /news/kentleague/sladegreen/14thjan04.html 1 0 0 0 /news/6thfeb04.html 1 0 0 0 /news/coneyhall2-2afccroydonathletic-wevehadtocomebacktogoforwardadmitschristucker 5 54174 2 2 /news/idratherbewherewearenoworbeinmidtablewithnothingtoplayforsayssteveoboyle 2 8922 0 0 /news/wehavetobeatourbesttogetresultssayscraywanderersbossianjenkins 3 15500 0 0 /news/551bc5dd82bcc 2 9148 0 0 /news/hastashf290419 4 35758 0 0 /news/ebbsfleetunitedcontinuesearchfortrainingbase 2 10752 0 0 /news/weneedamanagertoliftourconfidencesayswilson 1 4005 0 0 /news/atriptowembleystadiumiswithintouchingdistanceforebbsfleetunited 2 7624 0 0 /news/sittingbourne1-2wealdstone-mysidegivingbadgoalsawayisunheardoff-abbott 2 11019 0 1 /news/7thnov04.html 1 0 0 0 /news/wearedelightedtohaveobtainedtheservicesofstevemckimmsaystonbridgeangelschairman 4 15665 0 0 /archive-2006-2014/89 1 5032 0 0 /news/NationalLeague220420 4 13540 0 0 /news/551bc5dfaef19 1 3013 0 0 /news/drmartens/eastern/dartford/11thaug03.html 2 0 0 0 /news/soccershortstrophywinningskipperstayswiththefleet 2 8183 0 0 /news/551a97b0f06d7 3 14859 0 0 /news/jamespeacockbecomespeternottsfirstsigningforwhitstabletown 1 3784 0 0 /news/erithandbelvedere260120 4 21704 0 0 /news/551a9797c1c8b 4 20994 0 0 /news/canterbury201017 2 7482 0 0 /news/wehavenochanceofcausingcupshockadmitscotton-exclusiveinterview 1 4530 0 0 /news/afacuprunwillbringthecrowdstogreatnessparksaysjones 2 8860 0 0 /news/551bc99b4e121 1 5751 0 0 /news/croydonath120118 2 7189 1 0 /news/551a931e34343 2 8708 0 0 /news/551bc5e9028ec 6 56663 1 0 /news/millwallpreview070705.html 1 0 0 0 /news/chatspark110815 9 143458 3 2 /news/maidstone160717 1 4338 0 0 /assets/uploads/teams/Thumbs.db 2 199680 0 0 /news/hythe030905.html 2 0 0 0 /news/ramsgate3doverathletic2theramsaregoingup 2 10966 0 0 /news/barnesoptstomovetomaidstoneunited 6 24586 1 1 /news/conference/margate/17thjuly03.html 2 0 0 0 /news/wevenotshownenoughdesireinkentderbiesbemoansnott 1 3900 0 0 /news/greenwichborough0-1erithtown-boroughsfootballwaslovleytowatch-oboyle 1 6812 0 0 /news/facupsecondqualifyingrounddraw-1 5 14912 0 0 /news/craywandsFlamingoPark190318 1 4830 0 0 /news/551a9718c7c4a 4 14882 0 0 /news/staines041204.html 2 0 0 0 /news/ebbsfleetunited4-0bromley-iapologiseforouroverallperformancetonightsaysmarkgoldberg 3 29832 0 0 /news/wehavetogiveourselvesachancesaysoconnell 2 7903 0 0 /news/drmartens/eastern/folkestone/folkvroth061203.html 1 0 0 0 /news/551a9798691e4 2 10658 0 0 /isthmian-league/33 3 14678 0 0 /slade-green-2003-2006/3 3 9094 0 0 /news/ihopeworthingrespectusaswecanscoregoalswarnsbeckenhamtownassistantmichaelmarks 2 7771 1 1 /news/canterburycitymakeawelcomereturntofootballpyramid 1 2888 0 0 /news/NationalLeague090420 2 6652 0 0 /news/551a9677a3b59 1 3350 0 0 /news/drmartens/eastern/ashford/11thaug03.html 2 0 0 0 /news/551a92503b556 2 8416 0 0 /news/wevegottobuildonourwinoverkssaysinjuryhitstonesbosspeternott 2 9957 0 0 /news/workstartsonnewstonesstadiuminjanuary 1 3505 0 0 /news/hastingsunited0-4maidstoneunited-hat-trickheropinnockrepaysthefaith 1 6576 0 0 /news/12thjune05.html 2 0 0 0 /maidstone-2003-2006/ 1 2994 0 0 /news/thamesmeadtown1-2sittingbourne-iwanttowintheleagueonthesmallestbudgetsaysmattwyatt 4 33970 0 0 /news/beckenham200117 2 7491 0 0 /news/wehavetogetthejobdoneandcomeawayfromsportingbengalwiththreepointssaysrickybennett 1 4120 0 0 /news/ebbsfleetunited3-1wrexham-iowealottomyteammatessaysrelievedopinel 2 14380 0 0 /news/551a956bd5ef5 2 6254 0 0 /news/ashford10817 1 3811 0 0 /news/fastatement190320 5 17727 0 0 /news/pre-seasonresults2014 4 36726 0 0 /news/551a967757740 6 65388 2 3 /news/ramsgatedefendersubmitstransferrequest 1 2920 0 0 /news/dealtown190218 2 7107 0 0 /news/551a97988b767 5 23617 1 1 /news/punjab050718 2 7095 0 0 /news/erithandbelvedere101019 3 10617 0 0 /news/drmartens/eastern/erith&belvedere/8thoct04.html 1 0 0 0 /news/551a931dd2b85 2 9232 0 0 /news/551bc5dca96ee 3 15542 0 0 /news/sesayhandedpremiershipchance 2 6526 0 0 /news/kentcountyfaholdtrialsforgirlsteam 2 6536 0 0 /news/defendersdavisandclearyreturntostones 2 9093 0 0 /news/favershamcontinuestoimprovebothonandoffthepitchsaysrayturner 4 13714 0 0 /archive-2006-2014/114 1 4779 0 0 /news/collinscategoricallydeniessevenoaksspeculation 1 4345 0 0 /news/drmartens/premier/welling/3rdnov04.html 1 0 0 0 /news/warrilowdolke150415 3 14081 0 0 /news/playingwilliamsisnotaproblemsaysabbott 1 3856 0 0 /news/551a967712765 1 4649 0 0 /news/551a9bb004cc5 3 49842 0 0 /news/huntleysetforhealyshowdowntalks 2 7927 0 0 /news/welling250116 5 32489 1 1 /news/wellsbossrobbinswantstopsixstability 2 10833 1 0 /news/kentleague/thamesmead/26thjuly04.html 1 0 0 0 /news/folkchat031020 10 120503 0 0 /news/kentleague/greenwich/Greevlord130104.html 1 0 0 0 /news/ibelieveineverysingleoneofmyplayerssaystonbridgeangelsbosstommywarrilow 5 24675 0 0 /archive-2006-2014/34 1 5179 0 0 /news/formerdoverbosswalkerunveiledasnewashfordtownmanager 1 4409 0 0 /news/maidstone230720 2 6380 0 0 /news/551bc5e826825 2 9914 0 0 /news/tonbrom081116 3 26967 0 0 /Home/GetAllGameCategory 1 3457 0 0 /news/croygreen270116 4 11613 1 0 /news/551a979961deb 1 4742 0 0 /news/folkestoneinvictabossneilcugleywantstheedgeoverhisstrugglingrivals 2 12338 1 0 /news/weregoingtomakeafistofitsaystonbridgeangelsbosstommywarrilow 2 11397 0 0 /news/beckenham090120 2 7336 0 0 /news/phoenix221217 1 5028 0 0 /news/weveblownitadmitsburman 2 7082 0 0 /news/ramsgate130816 2 6977 0 0 /news/11thmay05.html 3 0 0 0 /news/551bc99ca268b 1 7178 0 0 /news/6thdec04.html 1 0 0 0 /news/wevegotachancetoputitrightathayeslanesaysbromleybossmarkgoldberg 3 13210 0 0 /news/551a9bb014974 3 12243 0 0 /news/27thmay04.html 3 0 0 0 /news/ivedonemyjobandmoresoileavehernebaywithmyheadheldhighsayssimonhalsey 3 13981 0 0 /archive-2006-2014/61 4 20138 0 0 /archive-2006-2014/220 2 8820 0 0 /news/hythetown1-0dulwichhamlet-ifwereachtheplay-offswevereachedourgoalsaysscottporter 3 24379 0 0 /news/dulwich090217 1 4096 0 0 /news/crowborough210819 3 10116 0 0 /news/metrogas1-2fleetleisure-wejustcouldntgetoverthefinalhurdleadmitsroydavies 3 30062 0 1 /news/sportingclubthamesmead271020 3 13535 0 0 /news/551bc5d95c137 2 8292 0 0 /news/stoneschairmanweneedyoursupport 1 3876 0 0 /news/chancetoplayback-to-backchampions 6 16304 0 0 /news/respectarticle021015 3 12717 0 0 /news/iplayfootballforthesebiggamessaysroyston-exclusiveinterview 2 10908 1 0 /news/551bc5e4dd621 1 3557 0 0 /news/greenwichboroughbossstevefirkinswantssupportfromthebromleyareatoincreasegates 2 10734 0 0 /news/glebe040920 3 13268 0 0 /news/551a9250421da 2 6828 0 0 /news/conference/margate/12thaug04.html 1 0 0 0 /news/idontwantthesejekyllandhydeperformancessayswhitstabletownbossnickysouthall 2 7920 0 0 /news/kentleague/hythe/7thjuly03.html 2 0 0 0 /news/croycroy220818 2 21548 1 1 /southern-counties-east-football-league/12 6 30353 0 1 /news/LondonFAStatement171220 4 27312 1 1 /news/wewontheworldcuplastnightsaysgiantkilleroboyle 1 4376 0 0 /news/craywands220115 3 19323 0 0 /news/whitstable250620 3 11947 0 0 /news/folkestone310517 2 10489 0 0 /news/winningonopeningdayisallthatmatterssayswellingbossjamieday 2 7654 0 1 /news/maldon020405.html 1 0 0 0 /news/ramsworth051215 4 52789 1 1 /news/iwouldntsaywerethefavorites-halsey 1 5059 0 0 /news/craywanderers1-0worthing-thejobsonlyhalfdoneadmitsdelightedjenkins 1 6616 0 0 /news/southern160117 1 3020 0 0 /news/phoenixsports1-2hollandsblair-wewanteditalittlebitmoresayspaulpiggott 2 19622 0 0 /news/canterbury120118 1 3698 0 0 /news/hythdork050316 4 33074 0 0 /news/bromleysignwingerdeanlodgeonnon-contracttermsfromkingstonian 2 10164 0 0 /news/29thapr05.html 2 0 0 0 /news/1stjan06.html 2 0 0 0 /news/shepbeck220220 7 83278 3 2 /news/wevegottobuildonourcupsuccesssaysford 2 7292 0 0 /news/dartskeepingfullyfocusedduringtwo-horsetitlerace 2 11290 0 0 /news/551a956c34d0c 1 3114 0 0 /news/folkestone300317 1 4646 0 0 /news/markgoldbergpartscompanywithbromleycitingongoinginhouseconflict 1 4225 0 0 /news/molesey1-5sittingbourne 1 4850 0 0 /news/arisremainsupbeatoverwandsplay-offchances 2 7712 0 0 /news/ihavenoroomformercenariesanymoresaysradbourne 2 9731 1 0 /sittingbourne-2003-2006/3 2 6242 0 0 /news/551a92501f8b7 4 14798 0 0 /news/tunverith111003.html 1 0 0 0 /news/erithandbelvedere110920 3 11824 0 0 /news/wellingtown111019 3 11889 0 0 /news/corinthian100220 4 13560 0 0 /news/drmartens/eastern/folkestone/corbyvfolk181003.html 1 0 0 0 /news/551bc5e0eeead 1 5302 0 0 /news/facarlsbergvasethirdrounddraw-wewanttoreachthenationalstagesayswellsbosslarkin 1 4138 0 0 /news/pitchero.com/clubs/dulwichhamlet 2 0 0 0 /news/bromley100517 2 6750 0 0 /news/551bc5e35f167 1 4267 0 0 /news/551bc5e0e1ccd 1 4522 0 0 /news/watsontakesapaycuttosignforin-formvickers 1 3825 0 0 /news/551a9c91e2796 2 10403 0 0 /news/13thjuly05.html 2 0 0 0 /news/thebigkickoffwhitstabletown2-2eastbournetown-weunderachievedtodayadmitsseager 1 7467 0 0 /news/folkestoneinvicta0-1sittingbourne-cugleywarnsofplayercutsfollowingcupexit 2 11877 0 0 /news/thereismoretocomefrommygoodsquadsaysdartfordbosstonyburman 1 3913 0 0 /news/jenkinsplottingtrophyupset 1 4256 0 0 /news/551a97b061dd0 3 15204 0 0 /news/craywands100716 1 3543 0 0 /news/kentleague/hythe/8thaug04.html 1 0 0 0 /news/551bc5e778e23 2 6662 0 0 /southern-counties-east-football-league/46 2 9424 0 0 /news/dulwich251118 4 14958 0 0 /news/greenleyt220717 7 182714 6 5 /news/burmanwantstoclaimbraggingrightsoverarch-rivals 1 4701 0 0 /news/folkestone030920 2 6024 0 0 /news/thefacupdraw2014 4 11221 0 0 /news/551bc5e28762e 1 3139 0 0 /news/ksports311016 4 15174 0 0 /news/hollands220417 2 8478 0 0 /news/mulhollandstaysforexcitingtimesatbaylissavenue 2 6231 0 0 /news/tunhay050917 2 21608 0 0 /news/thamesmeadtown0-0metropolitanpolice-itsamassivepointgainedforussayskeithmcmahon 6 82671 1 1 /news/ramsgate1-0stainestownwardhailscrowdpleaseredusei-exclusiveinterview 3 15703 0 0 /news/doverathletic1-2bromley-whatagreatwinforuswewereimmensesaysproudmarkgoldberg 3 29393 0 0 /news/wemustfocusonfinishinginplay-offplacessaysdoverstars 1 4834 0 0 /news/johanterhorstwantstohelpusmaketheplay-offssaysfolkestonebossneilcugley 1 3723 0 0 /news/imconfidentwecangotomoleseyandgetaresultsaysneilcugley 4 16412 0 0 /assets/images/icons/contact/ 5 1980 0 0 /news/dealtown101019 3 10428 0 0 /news/wardrallieshistiredtroops-exclusiveinterview 2 7447 0 0 /news/CoronavirusStatements130320 5 32497 0 0 /news/greenwichboroughsuspendplayerovershockingrefereeattack 1 3380 0 0 /news/favasesecondroundspecialcroydonsignformerfootballleaguegoalkeeper-exclusiveinterviews 2 13248 0 0 /news/robbinsfillsmanagementplaces-exclusive 7 25188 1 1 /news/comingup 1 2902 0 0 /news/ramsgateunveilthesigningofnigerianstrikerjosephafusi 3 10618 0 0 /news/burmanwantstoupsetplay-offchasingteams 2 7700 0 1 /news/stoneslookingtogosevenpointsclear 1 3655 0 0 /news/551a99e458cac 1 4320 0 0 /news/ryman/bromley/chessington240704A.html 1 0 0 0 /news/fishcrow170417 2 24114 0 0 /news/551a99e46f22d 1 3684 0 0 /news/newfleetgroundideallywithinthreeyears 2 6960 0 0 /news/craywanderers1-2woking-jenkinspleasedwithpre-seasonpreparation 1 6204 0 0 /news/drmartens/eastern/folkestone/tonbridge070904.html 1 0 0 0 /news/staceylonghastakenasignificantdropinwagestore-signforebbsfleetsaysbossstevebrown 6 24356 0 0 /news/resultsaprilmay2018 5 63402 0 1 /news/iwilldeliverthetrophysayswalker 2 8734 0 0 /news/hopefullyhomeadvantagewillcountagainstwealdstonesaysdartfordbosstonyburman 1 4528 0 0 /news/thefaworldwidebettingbanwillupholdtheintegrityoffootballinengland 3 13044 0 0 /news/FishErit230315 2 19746 0 0 /news/ryman/bromley/7thjuly04.html 1 0 0 0 /news/dulwich060318 1 3533 0 0 /news/551a931e6a4ad 1 4111 0 0 /news/threenewclubsforkentcountyleague 6 22441 0 0 /news/KentCountyLeagueStatement311220 5 27563 1 1 /news/soccershortswarrilowandboardoutlineplansfornextseasonatfansmeeting 1 7111 0 0 /news/keytrioreturnfortop-of-the-tableshowdown 1 5008 1 0 /news/wortfolk150220 4 40140 0 0 /archive-2006-2014/77 1 4956 0 0 /news/5thoct05.html 2 0 0 0 /news/hopefullywecangoallawayandgetpromotioninfrontofourownfanssayshessenthaler 1 4058 0 0 /news/staplehurst270420 5 20445 1 1 /news/ryman/bromley/19thsept03.html 1 0 0 0 /news/fisher0-3hernebay-werereadytosnatchitifhytheslipupsayssimonhalsey 1 8502 0 0 /news/sittingbourne171016 2 8194 1 1 /news/551bc5e34f243 1 4540 0 0 /news/ashfordunited010720 5 15567 0 0 /news/erithbelvedere4-4crayvalley-agreatadvertforkentleaguefootballsaysmickycollins 3 30090 1 0 /news/kentcounty/15thdec03.html 1 0 0 0 /news/barton090405.html 2 0 0 0 /news/sittingbourne2-1fleettown-thewholeteamhavebeenbrilliant-garyabbott 1 6390 0 0 /news/sceneissetforvickersoakwoodhomecoming 3 8905 0 0 /news/snodlandtown300619 5 16485 0 0 /news/551bc99e45bdd 1 4417 0 0 /news/chatham070716 1 3612 0 0 /news/551bc5e306ffd 3 12487 0 0 /news/idontexpectaneasyopeneratfisherwarnsfirkins 2 6905 1 0 /news/weknowtheopportunitytogoupispotentiallyhugethisseasonsayskfumanagersammacneil 1 3712 0 0 /news/551a956d0e8a5 1 6966 0 0 /news/northwich250305.html 4 0 0 0 /news/warrilowsignstriointimeforwimbledontrophyshowdown-exclusive 2 12134 0 0 /news/winningcupwillbeicingonthecakesaysdolby-exclusiveinterview 1 4092 0 1 /news/crowsseven261215 3 33582 0 0 /assets/select2/docs/ 9 6021 0 0 /news/cumberbatchfearsforhisfuture 1 5509 0 0 /news/fordnewgroundisgivingusafreshinjectionoflife 3 12071 0 0 /news/kentleague/thamesmead/14thnov03.html 1 0 0 0 /news/folkvkl270304.html 2 0 0 0 /news/doverathletic070221 5 27780 1 1 /news/folkestone190517 1 3543 0 0 /news/maidstoneunited2-3tonbridgeangels-theyveallgivenmeeverythingsaystommywarrilow 3 22227 0 0 /news/551a99e47da6b 1 5497 0 0 /news/fordexplainshisdeparturefromvcdathletic 1 4923 0 0 /news/holmesdale110220 3 12452 0 0 /news/551bc99d3d898 1 4601 0 0 /news/eighthwonder070916 4 19073 0 0 /news/sittingbourne251215 3 13461 0 0 /southern-counties-east-football-league/34 3 14154 0 0 /news/ayruhear050221 13 85775 0 1 /news/craywanderers2-0hastingsunited-wevegottobelievethatwereagoodsidesaysmichaelpaye 2 15688 0 0 /news/551a95b43e5f8 2 7875 0 0 /news/doverathletic2-1tonbridgeangels-losingatthisstagewillbecostlyadmitstommywarrilow 2 13302 0 0 /news/crayvtham291003.html 1 0 0 0 /news/551a97b1b5888 1 4621 0 0 /news/chelmsfordcity3-0folkestoneinvicta 2 8870 0 1 /news/afccroydon270817 1 3508 0 0 /news/wedontbelieivethetitleraceisoversayshollandsblairbosspaulpiggott 2 11606 0 0 /news/551a9c0edef2e 4 20213 0 0 /news/soccershortsmargatepayofftaxbill 1 10254 0 0 /news/bromley4-2favershamtown-leaguehasbeenaneyeopeneradmitsfavershamtownbosskevindoyle 2 35297 2 1 /news/londonseniorcupquarter-finaldraw 1 2883 0 0 /news/551a925065c97 2 7451 0 0 /news/dulwichhamlet031219 3 12889 0 0 /news/tunbridgewells2-0sevenoakstown-imveryproudofthemsayswellsbossmartinlarkin 1 7886 0 0 /news/jackpark180415 1 3922 0 0 /news/dartford230920 2 7066 0 0 /news/551a9799d1f38 2 13430 0 0 /news/sheppey270519 3 10497 0 0 /news/kentcountyfootballleague.co.uk 2 0 0 0 /news/starsturnoutinforcetosupporthughescause 2 7330 0 0 /news/thamesmead290416 3 11247 0 0 /news/trottlookingforcapitalgains 1 3719 0 0 /news/551bc5debd234 1 3011 0 0 /news/itsinourhandssayserithbelvederebossmickycollins 3 11165 0 0 /news/ifwerenotchallengingimsuremyjobwillbeindoubtsaysstonesbossjaysaunders 1 5750 0 0 /news/551bc5dea96a5 1 3192 0 0 /news/EMC070520 3 12329 0 0 /news/burmangiveshisdartfordsidetopmarksatoxford 1 3926 0 0 /news/maidstone140804.html 2 0 0 0 /news/wembleywoemcclarenpaysthepriceforenglandsembarrasingexit 1 4724 0 1 /news/oursuccessisdowntohardwork-notmoneysayshessenthaler 2 8984 0 0 /news/faversham290916 2 8649 0 0 /news/maybewecangettopspotifresultsgoourwaysayscraywanderersbossianjenkins 1 4613 0 1 /news/bromley170617 2 6361 0 0 /news/onhisdayloickpiresisamatch-winnersayswellingunitedbossjamieday 3 9989 0 0 /news/26thnov05.html 1 0 0 0 /news/wereatthebeginningofthejourneyheresayserithbelvederebossmattlonghurst 3 12482 0 0 /news/theprizemoneyisveryimportanttoallclubsatourstandardsaysramsgatebosstimdixon 3 12373 0 0 /news/seagerlookingforbonuspoints 2 8726 1 0 /news/gravesendnorthfleet1margate0-daishjacksonsinjurytakesshineoffreachingfinal 2 10970 0 0 /news/thefacupisallaboutenjoymentsaystable-toppingluchford 1 3930 0 0 /news/rusthall020719 2 6966 0 0 /news/whenyoureplayingwellyouhavetoscoresaysgillinghamladiesbosssimonratcliffe 3 17405 0 0 /ramsgate-2003-2006/2 2 6156 0 0 /news/erithbelvedere3-1erithtown-weneedtowinfiveoutoffivesaysmickycollins 3 29200 0 0 /news/craywands060418 1 4425 0 0 /news/551a9c91ce4b2 1 3847 0 0 /news/elmstead020817 3 11712 0 0 /news/551a99e4bed70 3 19827 0 0 /news/lordsvcray251003.html 1 0 0 0 /isthmian-league/16 7 34502 0 0 /news/whitstable240820 3 10992 0 1 /news/tunwells191115 4 18368 0 0 /news/dartford3-0tonbridgeangels-wevelosttothebetterteamtodayadmitstommywarrilow 3 20233 0 0 /news/folkvflee181103.html 2 0 0 0 /news/metrolewath200415 7 112376 2 3 /news/wevesilencedourcriticswithcuprompsayscosgrove 1 5260 0 0 /news/551a967917810 1 5911 0 0 /isthmian-league/28 11 51198 0 0 /news/drmartens/eastern/folkestone/harrowcup1021004.html 1 0 0 0 /news/27thapr04.html 1 0 0 0 /archive-2006-2014/96 1 4850 0 0 /news/11thapr05.html 2 0 0 0 /news/551a99e54e2c8 1 5167 0 0 /news/hythe190216 4 15409 0 0 /news/improudofmyachievementssofarsayscraystalwartwood 2 9316 0 0 /news/hastvsitt201203.html 2 0 0 0 /news/drmartens/eastern/erith&belvedere/19thoct04.html 1 0 0 0 /news/551a9c9257f07 3 20532 1 0 /news/bromleychairman180919 3 12568 0 0 /news/areyouinterestedinsponsoringthiswebsite 1 2977 0 0 /news/18thaug04.html 1 0 0 0 /news/daishmakessignificantsigning 5 16780 0 0 /news/youdontgettimeinfootballadmitspromotionchasingangelsbosstommywarrilow 2 9376 0 0 /news/5thjuly05.html 2 0 0 0 /news/sittrams281215 3 32277 0 0 /news/walkerwillnotbesackedinsistsdoverchairman 3 10936 0 0 /news/chathamtown2-2dorking-averypreventsembarrasingdefeat 2 12826 0 0 /news/ryman/bromley/fisherfacupreplay210904.html 1 0 0 0 /news/fisher2-4maidstoneunited-webelievewecanhaveagoodruninthissaysjackparkinson 2 17443 0 0 /news/bromley300916 3 15546 0 0 /news/folkestoneinvicta0-1afcwimbledon 1 4384 0 0 /news/kinchsidelinedforatleasteightweeks-exclusiveinterview 3 11720 0 0 /news/tonbridge290416 3 10920 0 0 /news/greerust230919 4 40278 0 0 /news/maidstone310717 1 4702 0 0 /news/favershamtown2-1whitehawk-wevegotnoreasontofearanyoneinthisleaguesaysluchford 2 17375 0 0 /news/thechairmanwasconvincediwasnttherightpersonforthejobsaysaxedjamescollins 4 18220 0 0 /news/wewanteveryonetocomeandenjoythemselvessaysdartfordco-chairmandaveskinner 1 4800 0 0 /news/551bc99b0e1bc 1 4302 0 0 /archive-2006-2014/244 3 12898 0 0 /news/imdeterminedtomakesureitsnotusthatgodownsaystonbridgeangelsbosstommywarrilow 3 16979 0 0 /news/helpustosupportkentfootball 1 3345 0 0 /news/551bc5e41b8f2 1 4960 0 0 /news/apmcontrast271115 4 15906 1 0 /news/pearcetributes170717 6 25062 2 2 /news/angelsbidfarewelltoskipperchopperaris 1 3691 0 0 /news/craywanderers5-0erithtown-wearegoodenoughfortheconferencesouthsaysianjenkins 1 9095 0 0 /news/thebigkickoffinvictasigndaggerskeeper-exclusive 1 4349 0 0 /news/oursuccessstorywouldmakeagreatfilmsaysjackson 1 5311 0 0 /news/facarlsbergvasethirdrounddrawkentleaguerivalsfaceeachotherforaplaceinthelast32 1 3827 0 0 /news/daishsplashesthecashongash 1 3675 0 0 /news/6thjan06.html 1 0 0 0 /news/ashfordunited0-3gillingham-itsnicetoseeashfordbackonitsfeetsaysandyhessenthaler 1 23235 1 1 /news/saundersreturnstohartsdownpark 3 9977 0 1 /news/corinthian040818 1 4144 0 0 /news/cumberbatchfeelsfrustratedoverpostponements-exclusiveinterview 3 11672 0 0 /news/tonbrdover210915 4 37943 0 0 /news/ryman/bromley/26thoct03.html 1 0 0 0 /news/551a931e8ab80 3 20268 0 0 /news/kentcounty/16thsept03.html 1 0 0 0 /news/28thoct03.html 1 0 0 0 /news/chatbeck121019 6 68058 0 0 /news/wakelingifeltiwasatafuneralexclusive 3 13579 0 0 /news/swanseastarjonjoshelveysignsuptogeorgehowardsbenefitmatch 5 25547 1 1 /news/551a9c0f252cc 3 40349 2 2 /news/thamesmead180915 3 10926 0 0 /news/craywands080419 4 13997 0 0 /news/welling240517 1 3582 0 0 /news/allmystrikersaregoingtoplayatsomestageoftheseasonsayserithtownbosstonyrussell 1 4165 0 0 /news/badscray041118 4 39758 0 1 /news/walthamforest190305.html 1 0 0 0 /news/corinhors080918 4 41506 0 0 /news/stainestown4-1margate-itwasmenagainstboysadmitsrelegatedyorath 2 11167 0 1 /news/dulwichhamlet3-2dartforddartssurrendernotverygoodsaysburman 5 58553 3 0 /news/tunbridgewells2-2thamesmeadtownaetweshouldhavebeatenthemadmitsfarnie-exclusive 2 28395 0 1 /news/wevegottogetfisherbacktowhatitwassaysjoint-bossbillywalton 4 19741 0 0 /news/theressomuchpressureonmyyoungsideadmitsmiles-exclusiveinterview 1 4545 0 0 /news/strikerwattspartscompanywithfisherathletic 3 11360 0 0 /news/leppardchangeshisspots 1 3483 0 0 /news/ebbsfleet200718 3 14910 0 0 /news/bromley150616 5 33113 1 1 /news/margate2-0suttonunited-weknowwhatwevegottodosaysyorath 2 10831 0 0 /news/theplay-offtargetis75pointssaysbromleybosshaydenbird 1 4126 0 0 /news/dockerwemusttakeourchancesorwellgetpunished 1 4934 0 0 /news/sheppey201017 2 7384 0 0 /news/toallhoveringvulturesthereisnotamanagerialvacancyatgreenwichboroughinsistsgerrycox 1 5386 0 0 /news/soccershorts290116 4 21406 0 0 /archive-2006-2014/223 2 9002 0 0 /news/paulfoley150617 2 7406 0 0 /news/wardputsoutanappealtofindwingersforfacupclash-exclusive 2 9385 1 0 /news/wevegottobemoremotivatedandworkhardertogetresultssayscraybossianjenkins 1 4028 0 0 /news/maidstone091216 4 17098 0 0 /news/crayvalleyatwembley160519A 3 12291 0 0 /news/551bc99a9fca8 1 3510 0 0 /news/wewillnaturallymissliamdicksonsaysfolkestoneinvictabossneilcugley 6 34003 1 1 /news/551a9677f1195 1 4407 0 0 /news/afccroydonathletic170120 4 15964 0 0 /news/workbeginstobringstonesbackhome 1 3323 0 0 /news/canterbury080416 4 14358 0 0 /news/551bc5e12c070 1 3534 0 0 /news/9thdec04.html 1 0 0 0 /news/551a9c0e476a0 1 3511 0 0 /news/sewellcharitymatchbringsoutthestars 2 9328 0 1 /news/tonbridge161017 2 7813 0 0 /news/551a97b25c05e 1 4636 0 0 /news/ebbsfleetunited1-2millwall-daishwerecomingtotheboil 1 5526 0 0 /news/whitstabletown0-2dulwichhamlet-ineedmorequalityinmyteamadmitsseager-exclusive 4 67369 1 1 /news/bridsutt300316 4 65844 1 1 /news/fleetbouncebackatfirstattempt 1 4330 0 0 /news/eghamvbrom060404.html 1 0 0 0 /news/ramsu18vchat210304.html 2 0 0 0 /news/binkshailsthereturnofdenness 1 4146 0 0 /news/jonmainiskeentogetbackinvolvedsaysramsgatebossjustinluchford 4 17973 0 0 /advertising-rates 35 155064 4 6 /news/sct150620 2 9290 0 0 /news/newleaguewillbridgethegapsaysfa 1 3739 0 0 /news/breakingnewshomelandsgivengreenlighttostagefatrophytie 1 2854 0 0 /news/humehasfaithinhisyoungsters 1 4428 0 0 /news/bromanch150215 3 26369 0 0 /news/iwasntexpectingsixpointsovertitle-rivalsadmitsburman 2 8379 0 0 /news/551bc5e7b448a 1 4512 0 0 /news/wevebeenstabbedinthebackclaimsjoeford 5 28191 0 0 /news/551a9677ad5be 1 7156 0 0 /news/robbinsunveilssignificantcablesigning 2 6542 0 0 /news/pre-seasonfriendlies2009 2 28120 0 1 /news/551a97990a98c 2 7376 0 0 /news/29thmay05.html 2 0 0 0 /news/stalbanscity0-0dartford-burmandrawscomfortfromsaintsstalemate 1 4339 0 0 /news/bromley040718 3 9936 0 0 /news/ashfordtown2-4craywanderers 1 4144 0 0 /news/crayvalley1-2lordswood-hopefullyhelltakeusupnextseasonsaysstevechapman 3 29079 0 0 /news/beckenham201017 1 3822 0 0 /news/551a931e2f3e9 1 3751 0 0 /news/chatavel030115 4 36698 0 0 /news/raynesparkvale180904.html 2 0 0 0 /news/cook101215 5 44660 2 1 /news/wevegottolookfortopthreesayscrayvalleybossstevechapman 5 20605 0 0 /news/sittingbourne180915 3 11520 0 0 /news/walkerbrushedasideaslovelltakesupexcellentopportunityatashfordtown 2 6076 0 0 /news/croydonathletic100905.html 2 0 0 0 /news/phoenix010516 3 12447 0 0 /news/openingdayresults 5 19868 0 0 /news/favershamstrikeforce120620 2 7170 0 0 /news/dulwich280417 2 9753 1 0 /archive-2006-2014/238 3 13141 0 0 /news/bromley180515 4 16885 0 0 /news/ashfordunited190618 3 11028 0 0 /news/tonbridge070904.html 2 0 0 0 /news/footballconferencefixturelist 1 2657 0 0 /news/551bc5de6f568 1 3420 0 0 /assets/ckeditor/plugins/pastefromword/filter/ 1 380 0 0 /news/imstayingputatwhitstablesaysflatteredseager 1 3956 0 0 /news/berkhamsted030905.html 1 0 0 0 /news/wellgivebansteadtherespecttheydeservesaysshaunwelford 1 4010 0 0 /news/mishimorathtributes201219 2 9736 0 0 /news/dealtown070220 4 19912 0 0 /news/craywanderers250321 21 90576 4 6 /news/westwickvbrom290204.html 1 0 0 0 /news/kentleague/tunbridgewells/9thsept03.html 1 0 0 0 /news/idontwanttheclubtostandstillsaystonbridgeangelsbosstommywarrilow 1 5027 0 0 /news/wellingunitedsellstrikerandypughtocambridgeunitedfor15000 1 3741 0 0 /news/bromley191018 4 21574 0 0 /news/551a9c92c3986 2 11202 0 1 /news/wevegottwomassivegamescomingupnowsaysmaidstoneunitedbossjaysaunders 2 7882 0 0 /news/tunbridgewells150519 4 15780 0 0 /news/551a97993f37f 1 6776 0 0 /news/551a97980c4a7 4 23385 0 0 /news/bromhava270818 3 29898 0 0 /news/lewkotey130515 3 9802 0 0 /news/othernews/AEI130904.html 1 0 0 0 /news/lureofbiggergatespesuadedcasstoleavechathamforrivalsdartford-exclusiveinterviews 2 10526 0 0 /news/sct14062020 5 16797 0 0 /news/hythe041215 3 11496 0 0 /news/18thaug04A.html 1 0 0 0 /news/tongrays110217 1 10276 0 0 /news/angelschairmansuccesswillbestayingup-exclusiveinterview 1 4437 0 0 /news/ithinktheresabitmoretocomefromussaysvcdathleticbossrickybennett 2 9529 0 0 /news/doverathleticunveilnathaneldersigning 6 20275 0 0 /news/wellingunited070120 4 13544 0 0 /news/canterbury041215 3 11586 0 0 /news/worthing120305.html 2 0 0 0 /news/itwillbeatoughbattleagainstdartfordsayswellingunitedbossjamieday 1 4972 0 0 /news/soccershortschathambossbinksretainselevenplayersfornewcampaign 1 3389 0 0 /news/championsdoverathletic1-0burgesshilltown-thewaitisoverfordoverathletic 1 6624 0 0 /news/551bc5d990ad9 2 7000 0 0 /news/dartford240804.html 2 0 0 0 /news/charltonathletic170619 5 20647 0 0 /news/20thapr05.html 1 0 0 0 /news/drydenoutforjustonemonth 3 10055 0 0 /news/wererisingtothechallengesaystable-toppingbeckingham 1 3981 0 0 /news/dulwichhamlet2-1margate-wecanbeathreatinthisleaguesaysdulwichhamletbossgavinrose 3 30542 0 0 /news/soccershortsbosseslookforwardtooakleyroadvaseshowdown 2 13440 0 0 /news/thamesmeadvramsgate160803.html 2 0 0 0 /news/kentcounty/2ndjuly03.html 2 0 0 0 /tonbridge-2003-2006/5 2 5248 0 0 /news/fisher3-2dagenhamredbridge-wewoulddearlyliketokeepdanyoungheresayslisney 1 6491 0 0 /news/551bc5dcb171c 2 11074 0 0 /news/rochestercity210220 2 6348 0 0 /news/sevenpointsfromtitlemyplayersmustplaylikeobriensaysburman-exclusive 1 4920 0 0 /news/sittingbourne010715 3 14208 0 0 /news/vcdmaid110717 3 31075 0 0 /news/drmartens/eastern/folkestone/gillingham090704.html 1 0 0 0 /assets/ 6 3134 1 0 /news/iwouldliketogainentrancetothewomenssuperleagueinfuturesaysgillschairmanpaulscally 4 21097 0 0 /news/wecantdoanymorefortheplayersintermsofpreparationsaysnickysouthall 6 29534 0 0 /news/hernebay200718 4 12698 0 0 /news/hythetownfc.co.uk. 1 0 0 0 /news/weneedtobeontopofourgamefromthefirstwhistlesayswellingunitedbossjamieday 2 9742 0 0 /news/favershamtown0-4maidstoneunited-wecantfeelsorryfourourselvessaysrayturner 4 28340 2 2 /news/551a95b39bbdc 4 19890 0 0 /news/lordvseve061203.html 1 0 0 0 /news/erithtown220620 3 9074 0 0 /news/EssexSeniorLeagueStatement240320 2 6126 0 0 /news/kentleague/hernebay/hernvlords111003.html 1 0 0 0 /news/hernebaybosssimonhalseywantstocelebratefirstanniversarybyguidingtheclubintolast32 1 4949 0 0 /news/longhurst181015 4 21245 0 0 /news/wemusttakeadvantageofbeingathomesaysmartinhayes 1 4643 0 0 /news/sevenoakstown0-0vcdathletic-frostidontwantthejob-exclusive 1 6029 0 0 /news/551bc5e123192 1 4638 0 0 /news/5thsept05G.html 3 0 0 0 /news/thefalaunchprobeoversuspiciousbettingactivityinconferencesouth 3 9506 0 0 /news/erithtown130805.html 1 0 0 0 /news/551a92509eaab 4 13354 0 0 /news/itwillbespecialtoplayatpriestfieldstadiumsaysemmatune 3 15893 0 0 /news/metpoltonb241115 5 81954 1 1 /news/wellliftourselvesagainstthebig-spenderssaysabbott 1 3704 0 0 /assets/fileman/images/ 8 7419 0 0 /archive-2006-2014/258 6 25945 0 0 /news/macdonaldsignstwo-yeardealforsouthendunited 1 3194 0 0 /news/ashford020417 1 3999 0 0 /news/confidentcosgrovewarnscroydonofpasting-exclusive 1 4018 0 0 /news/stonesshockwalkerhartenedwithinitialplayerresponsedespitecut-backs 2 7906 0 0 /news/551bc5de58b6e 2 9350 0 0 /news/holmesdale090218 3 10401 0 0 /news/resultsandforthcomingfixtures 5 25880 0 0 /news/551bc5e74cc22 2 10376 0 0 /news/tonbafcw230716 1 8273 0 0 /news/othernews/SECWFL290204.html 1 0 0 0 /archive-2006-2014/276 4 17117 0 0 /chatham-2003-2006/2 4 12197 0 0 /news/whyteleafe1horsham1 1 3558 0 0 /news/itsvitalwestartpickingupsomepointssayswellingunitedbossjamieday 1 5397 0 0 /news/craywands211217 1 4345 0 0 /news/southallsetfordoverreturn 2 7754 0 0 /news/drmartens/eastern/dartford/7thjuly03.html 2 0 0 0 /news/fivekentclubsinthelast32ofthefavaseisagreatachievementsaysdeniserichmond 2 7152 0 0 /news/551a97987bd64 4 18177 0 0 /news/551a97b0e57be 3 16410 0 0 /news/tunwells250915 4 15705 0 0 /news/roseremainstightlippedfollowinghisresignation 1 2859 0 0 /news/seagerimpressedwithwestwickhamonscoutingtrip 2 7980 0 0 /news/lordswood150616 8 74337 1 4 /news/wellingunited1-0charltonathleticturnerletsaimfortheplay-offs-exclusive 5 27459 0 0 /news/fisher290116 4 13998 0 0 /news/8thoct04.html 2 0 0 0 /news/pennockmidweekcupwinoverdartfordwasanicelittleboost 2 6818 0 0 /news/formerkentleaguerefereejonathanstonelinesupdatewiththestars 1 3648 0 0 /news/28thsept05.html 1 0 0 0 /news/kingvfolk170104.html 2 0 0 0 /news/justhopewecankeeptheboystogetherandwinsomethingsaysbridonropescaretakerkrishollidge 2 7512 0 0 /news/kentleague/cray/greenwichvcray060903.html 1 0 0 0 /news/weneedgatesofover500tokeeptheclubsheadabovewaterwarnsmargatedirector 1 5664 0 0 /news/winnertakesallinrymanrace 1 8036 0 0 /news/twoin-twooutforangels 3 9920 0 0 /news/redhill0-1doverathletic-carruthersitsgoodtoputadovershirtonagain-exclusive 1 5477 0 0 /news/whitstablechairmanoutlinesfive-yearplanasbelmontpassesgroundgrading 1 3945 0 0 /news/othernews/31stJan04.html 1 0 0 0 /news/sevenoakstownsettounveilnewmanagerwithindays 2 6360 0 0 /news/dartfordbosstonyburmanrelishingopeninggameagainstbookiesfavourites 2 8414 0 0 /news/551a9c92187c3 1 6084 0 0 /news/hopefullywellwintheleagueoutrightsaysebbsfleetunitedchairmandrabdullaal-humaidi 3 10371 0 0 /news/cugleydemandsimprovementagainsturchins 1 6094 1 0 /news/wardleavestonbridgeforhomecomforts 2 5984 0 0 /kent-invicta-league/ 1 4812 0 0 /news/551a9cf4e9f45 2 14852 1 1 /news/ryman/bromley/bromvbans211003.html 1 0 0 0 /news/dartssearchfornewtalent 6 17672 0 0 /news/phoechat310718 6 68019 0 0 /news/drmartens/eastern/sittingbourne/3rdjuly03.html 2 0 0 0 /news/551bc5e32752d 2 8872 0 0 /news/ourfinancialpositionisthebestiveknownitforalongtimerevealsfolkestoneinvictaboss 1 4174 0 0 /news/soccershortswehavenothingtolosesotheresnopressureonussaysjohnovard 2 17410 0 0 /news/551bc5e28b620 4 16214 1 0 /news/snodlandtown291020 3 12410 0 0 /news/fisher130620 3 9788 0 0 /news/dolbyslamspiscinaoverhisdecisiontoleave 1 4190 0 0 /news/hythe270517 2 9416 0 0 /news/folkestoneinvicta0-0sittingbourne-itsbyrnesdayatfolkestone 3 20222 0 1 /news/wehavenotbeenhappyinthekentleagueforaconsiderabletimenowsayspeterpalmer 1 3620 0 0 /news/othernews/londonseniorcup0405.html 1 0 0 0 /news/drmartens/premier/welling/16thsept04.html 1 0 0 0 /news/tonbridgeangels1-0folkestoneinvicta-wecouldhavemadelifeeasiersaystommywarrilow 2 13437 0 0 /news/truroisneveraneasyplacetogotosayswellingunitedbossjamieday 3 9503 0 0 /news/551bc99e13b42 1 6309 0 0 /news/weareallveryexcitedatthewaytheclubisgrowingsayscorinthiancoachmattlonghurst 1 3868 0 0 /news/soccershortstheprospectsarelookinggoodsaysashfordtownbosstonyreynolds 1 6274 0 0 /news/differenceofopinionforcesgormantoquit 1 3581 0 0 /news/folkestoneinvicta0-0sloughtown 2 9046 0 0 /news/wecanholdourheadsuphigh-exclusiveinterviews 1 4092 0 0 /news/sevenoaksbidtoendtheirtunbridgewellsjinx 1 4166 0 0 /news/topsixfinishwillbeclassedasasolidseasonsaysorpingtonbossbyronbeard 3 16362 0 0 /news/hernebay090405.html 2 0 0 0 /news/fatrophyspecialplacingobrienonthetransferlistwasadifficultdecisionadmitsburman 2 9742 0 0 /news/invictadrawcomfortagainstleagueleaders 3 13982 0 0 /news/hythetown5-3lewishamborough-wehavetodefendbetteradmitsfisk-exclusive 1 5729 0 0 /news/icouldnotignoretheopportunitytomanageconferencepremiersidewellingunitedsaysjodybrown 2 10912 0 0 /news/doverquashdrydenmoverumours-dulwichsignstrikerbremnerfromcraywanderers 1 3626 0 0 /news/eontopowerthefacup 3 12265 0 0 /news/leggeisdestinedtoturnprofessionalsayswarrilow 1 4010 0 0 /news/ilford1-3chathamtown-wedontwanttounderachievethisseasonsaystable-toppingkevinwatson 1 8263 0 0 /news/whyteholl230816 2 21174 0 0 /news/aldertonwillhavetofightforhisplaceinsistsabbott 2 8632 0 0 /news/managerissuesrallyingcrytoashfordpeople-exclusiveinterview 5 25635 0 0 /news/thamwith070915 4 38676 0 0 /archive-2006-2014/167 7 32334 0 1 /news/thefavasefinal2013idontwanttobetheonlyonetowinatwembleysaystommysampson 2 11878 0 0 /news/fishwing091115 3 26145 0 0 /southern-counties-east-football-league/42 2 9524 0 0 /news/wedonthaveacrisisatthamesmeadinsistsmcmahon-exclusiveinterview 2 9038 0 0 /news/cugleywemusttakepointsoffeastthurrocktonight 3 16124 0 0 /news/deal101105.html 1 0 0 0 /isthmian-league/41 2 9442 0 0 /news/conference/margate/margvnorthwich270903.html 1 0 0 0 /news/drmartens/premier/dover/15thoct04.html 1 0 0 0 /news/551a99e3986f4 1 3455 0 0 /news/551a92503fcf4 2 8416 0 0 /news/kentleague/ramsgate/4thmar04.html 1 0 0 0 /news/ryman/bromley/20thoct04A.html 1 0 0 0 /news/woking0-1wellingunited-wemadehardworkofitbutwereinnextroundsaysjamieday 3 24545 0 0 /news/soccershortsfolkestonesignbulgarianfind 1 3244 0 0 /news/551a97190a71f 4 18666 0 0 /news/lovellillgivelocalplayersachance-iftheyregoodenough-exclusive 1 5598 0 0 /news/weneedtostartdragginginthefanssaysthamesmeadtownbosskeithmcmahon 2 8886 0 0 /news/22ndnov04.html 1 0 0 0 /news/551a9677ee7b0 1 4016 0 0 /news/workbeginsonmaidstoneunitedsnewstadium 1 3948 0 1 /news/tonbridge260518 4 12125 0 0 /news/ashfordtown0-5bromley-holdersbromleytostagekentseniorcupfinal 1 4221 0 0 /news/ramsgate220421 61 268320 4 28 /news/teamnightsoutwillhelpourpromotioncausesaysbrady 2 8637 0 0 /news/dartford3chathamtown1-binksithoughtitwasacrackinggameoffootball 1 6143 0 0 /news/sevenerith191016 2 18924 0 1 /news/cordicewarnshisplayersaboutsundaysuspensions 1 4029 0 0 /news/551bc5dfa22d2 1 4058 0 0 /news/fatrophyspecialwardforcedtooffloadonestriker 2 8262 0 0 /news/lordswoodunveilsimonhalseyastheirnewboss 2 8520 0 0 /news/kentleague/greenwich/whitstable141204.html 1 0 0 0 /news/tunvlordswood130803.html 1 0 0 0 /news/551a96787835e 3 20778 0 0 /news/warrilowwantspassionatesupportasheplotsgiantkilling-exclusive 1 5280 0 0 /news/conference/gravesend/8thnov03.html 1 0 0 0 /news/drmartens/eastern/sittingbourne/burnvsitt200304.html 1 0 0 0 /news/30thsept05.html 2 0 0 0 /news/elmsfore300920 8 72962 0 0 /news/margate120218 1 3403 0 0 /news/daishkeepsdebollaatfleet-wingsreceive12000forkedwell 1 3093 0 0 /news/551bc5e45013e 1 3011 0 0 /news/hungerfordtown2-2greenwichboroughaet-last-gaspsmithkeepswembleydreamalive 2 15175 0 0 /news/ashfordputundereighteensideonhold 1 5033 0 0 /news/thirdpartyinterestwithstonesstadium 1 2935 0 0 /news/imnotinterestedinsomeoneplayingformoneysaysglebebossrockymcmillan 4 23830 0 0 /news/ashford180717 1 4126 0 0 /news/kentleague/VCD/20thjuly03.html 2 0 0 0 /news/vcdappointnewchairmanandissuebondstoaidgroundredevelopment 3 10892 0 0 /news/trotttellsboo-boyslookatthebiggerpicture 2 10862 0 0 /news/rochester031117 1 3359 0 0 /news/30thmar05.html 2 0 0 0 /news/folkestoneinvictachairmanpaystributetoretiringjimmyjackson 1 3399 0 0 /news/canterbury170617 1 3712 0 0 /news/GWR251005.html 2 0 0 0 /news/551a9250d2c58 2 6847 0 0 /news/maidstoneunited1beckenhamtown1-humeexpectmoretwistsandturns 2 10674 0 0 /ladies-football/ 1 4448 0 0 /news/thamesmeadtown3-0whitstabletown 2 9500 0 0 /news/thefleetatwembleyletsbringthetrophyhome 1 4405 0 0 /news/hessenthalerwarnsstarnamesthattheymustperform 1 5353 0 0 /assets/uploads/content/Marlon_Patterson.webp 1 67136 0 0 /news/stonessettomakebigannouncement 1 3013 0 1 /news/thescarythingisyoureconstantlylookingoveryourshouldersayssittingbournebossmattwyatt 4 15570 0 0 /news/varleyruescontroversialdecision 5 37107 3 3 /archive-2006-2014/37 1 4970 0 0 /news/daishasksfanstodonatetowardshisbudget 2 6882 0 0 /news/londonbridge040617 3 13502 0 0 /news/551a9cf5507bc 2 11452 0 0 /news/gravesendnorthfleet1herefordunited2-daishwemusthandlethepressure 3 14962 0 1 /news/resultsaprmay2017 3 35069 0 0 /news/hythetown050815 3 11547 0 0 /news/maidstone280319 3 10905 0 0 /news/imreallypleasedparkinsonandpireshavestayedsayswellingunitedbossjamieday 2 6534 0 0 /news/berkhamsted161104.html 1 0 0 0 /news/551a931e80013 4 18765 0 0 /assets/ckeditor/plugins/smiley/dialogs/ 1 372 0 0 /news/conference/gravesend/12thsept03.html 1 0 0 0 /news/kentleague/tunbridgewells/9thnov03.html 1 0 0 0 /news/chathamtown1-2gillingham-thetrophycabinethasntbeenopenedforsolongsayskevinwatson 2 12770 2 2 /news/greenwichboroughbattleagainstalltheoddstotopkentleaguetablewithjust35inthebank 1 5590 0 0 /news/snodland301216 4 13500 0 0 /news/itsacrazyleague-itsscreamingoutforacoupleofteamstopullawaysaysjaysaunders 2 7902 0 0 /southern-counties-east-football-league/5 5 39205 1 1 /news/hollands210419 4 13481 1 0 /news/phoenix271115 4 14776 0 0 /news/whitstabletown1-3folkestoneinvicta-ifwewinourlastfivegameswellbechampions-cugley 3 18734 0 1 /news/itsbeenagreatstarttotheseasonsaysbromleyco-chairmanashleyreading 4 15813 0 1 /news/wellingunited1-2woking-defensiveinjuriescostus-admitspositiveford 3 21606 1 1 /news/1stdec05.html 2 0 0 1 /news/dembeleinaustralia250619 3 15345 0 0 /news/sheppey010916 2 7330 0 0 /news/sittingbournearethedarkhorsesfortheplay-offs-ward 1 4025 0 0 /news/551a9cf5676de 4 53424 0 0 /news/iwantedtoplaythegameinsistshughes 1 4224 0 0 /news/dartfordfacebromleyinlastsixteenoffatrophy 3 10090 0 0 /news/iunderstandgeorgelandaisreasonsforwantingtogosayshernebaybosssimonhalsey 3 9692 0 1 /news/wedoneedtopickupourformadmitssittingbournebossnickdavis 3 13804 0 0 /news/551a95b3bcc1a 2 7448 0 0 /news/stevenage160320 3 10451 0 0 /news/lewisham150419 2 7986 0 0 /news/551bc5e320f32 3 13352 0 1 /news/sctelms160819 5 51440 0 1 /news/corivbrom200903.html 1 0 0 0 /news/kentleague/tunbridgewells/26thaug04.html 1 0 0 0 /news/551bc5e430902 3 8687 0 0 /news/kentcountyleague3hertfordshireseniorcountyleague0 3 12152 0 0 /news/lordswood4-1sportingbengalunited-weveplayedbetterandlostsayslillis 1 5004 0 0 /news/kentleague/sladegreen/3rdsept03.html 1 0 0 0 /news/kentleague/sladegreen/17thjuly03.html 2 0 0 0 /news/crystalpalacerespportsmouthresp 2 5802 0 0 /news/iwanttoavoidsemi-finalheartbreakagainsaysfisk-exclusiveinterview 1 4909 0 0 /news/maidstoneunitedconsiderlegalproceedingsoverturfwarwithconference 2 12338 0 0 /news/doverathleticbossmartinhayesaddstohissquad 1 3892 0 0 /news/19thmar04.html 1 0 0 0 /news/bromvegh021203.html 1 0 0 0 /news/walthamforest1-1ashfordtown 2 18398 1 1 /news/godalmingtown0-0chathamtown 4 13488 0 0 /news/551a97b16b7bc 1 4834 0 0 /news/551bc5e756033 1 3876 0 0 /news/iwasprettysureiwasheadingtohythetownsaysstrikerlukeharvey 3 12668 0 0 /ashford-2003-2006/4 4 12020 0 0 /news/g 1 0 0 1 /news/faversham220620 3 10227 0 0 /news/551a97b093202 3 15447 0 0 /news/conference/margate/9thjuly04.html 1 0 0 0 /news/sevenoaks010718 4 13921 0 0 /news/17thdec03.html 2 0 0 0 /news/departingtuckergoandwinthefinalexclusive 3 12463 0 0 /news/folkestone250615 3 11181 0 0 /news/kentleagueunveiltwo-yearsponsorshipdeal 2 6774 0 0 /news/holmesdalebeginsearchfornewreserveteammanager 2 6698 0 0 /news/wingsgreenlighttostagebluesquarepremierfootball 1 3015 0 0 /news/charlton241116 3 11164 1 0 /news/humeofferstrialistsonelastchancetoimpress 2 8576 1 0 /news/29thjan04.html 2 0 0 0 /news/kentleague/thamesmead/thamesmeadvramsgate160803.html 1 0 0 0 /news/erithbel300715 4 19133 0 0 /news/thedooropensforsomeonetostepinandtakeittothenextlevelsaysmickycollins 5 30805 0 0 /news/551a9c91666bd 2 7106 0 0 /sittingbourne-2003-2006/5 2 5828 0 0 /news/tonbridge271017 2 7839 0 0 /news/drmartens/premier/welling/13thaug04.html 1 0 0 0 /news/doverathleticstartplanningtheirclimbuptheleagues 2 10323 0 0 /news/margate210417 2 7687 0 0 /news/backthebidtobringthewandshome 1 4345 0 0 /news/wemustbattletoavoidthedropsayswhitstablestar 2 7622 0 0 /news/551a9c0e69d58 1 3230 0 0 /news/tunwells220105.html 1 0 0 0 /news/facarlsbergtrophyandvasedraws 1 2960 0 0 /news/weregoingtogivesomeoneagoodgoingoverwarnsramsassistant 1 3790 0 0 /news/551bc99cc8146 1 5288 0 0 /news/551bc99e1fa27 1 6645 0 0 /news/folkestoneinvicta0gillingham2cugleysdelightedwithfirstouting 5 25618 1 0 /news/borehamwood2-1wellingunited-tonightisnotgoingtowinorlosetheleaguesaysjamieday 1 7155 0 0 /news/ineedmoneytoincreasesquadnumbersadmitswarrilow 1 5454 0 0 /news/dover220516 4 14170 0 0 /archive-2006-2014/116 1 4967 0 0 /news/wehaventgotthemoneytosignprovengoalscorerbemoansgibbons 5 19175 0 1 /news/dulwichhamlet240820 4 13774 1 1 /news/sctholm070417 5 56147 0 1 /news/551a967777695 3 20028 0 0 /news/supportfromfreegamewillgivetheteamaliftsayswhitstablechairman 1 3514 0 0 /news/folkvbanb310104.html 2 0 0 0 /news/551a96db46261 2 6603 0 0 /news/fixturelistletskeepthefacupdreamalive 2 6550 0 0 /news/findingournewmanageristopprioritysaysoutgoingwhitstablechairman 1 5053 0 0 /news/drmartens/eastern/erith&belvedere/13thsept04.html 1 0 0 0 /news/551a9cf598f9a 1 5317 0 0 /news/phoewhit181017 2 17786 0 0 /news/551bc5e7594be 2 8780 0 0 /news/wehavehadabrilliantseasonsaysbromleycoachhugolangton 4 16657 0 0 /news/cablestillintwomindsabouthisfuture-exclusive 1 4024 0 0 /news/chatham041015 4 17157 0 0 /news/wewillgetbacktowinningwayssayswalker 2 7501 0 0 /news/tonbridgeangelspmargatep 3 7825 0 0 /news/werereallyworkinghardtopullourselvesupthetablesayserithtownbossenniogonnella 2 7452 0 0 /news/551a95b36a063 1 3122 0 0 /news/awinoverconcordrangerswillliftspiritssayscraybossianjenkins 1 3970 0 0 /news/lydd290718 3 13605 0 0 /news/kentleague/sevenoaks/beckenham131104.html 1 0 0 0 /news/soccershortsjamiekempsterreturnstocraywanderers 7 39523 0 0 /news/holmesdaleskentleagueaspirationsareinmemberclubshands-exclusive 1 3572 0 0 /news/551a979859ceb 4 15234 0 1 /news/canterbury140815 4 20477 0 0 /news/drmartens/eastern/dartford/14thnov04.html 1 0 0 0 /news/551a92504f4c8 2 7004 0 0 /news/kentleaguecupfinalwewillgivesevenoakstheutmostrespectsayshalsey 1 4690 0 0 /news/dulwich250416 4 19374 0 0 /news/kentleague/erithtown/hernebay131204.html 1 0 0 0 /news/getustoyouropeningmatch 1 3071 0 0 /news/wellbepreparedforpottoncupclashinsistsoboyle 1 3797 1 0 /news/bromvbrac270304.html 1 0 0 0 /news/margate250419 4 13502 0 0 /news/kentleague/thamesmead/18thnov04.html 1 0 0 0 /news/hythetown070919 7 24272 1 1 /news/weneedtobringinoneortwothebalanceofthesquadisjustnotrightsaystonyrussell 3 16262 0 0 /news/freedrinkatrusthallsopeningleaguegame 1 3233 0 0 /news/551bc99bd7b3b 2 14702 0 0 /news/croydon1-2lordswood-myplayerscommitmentwasoutofthisworldsaysjasonlillis 4 32872 0 0 /news/pughsolvesdoverstrikercrisis 1 3268 0 0 /news/29thaug05.html 1 0 0 0 /news/wehavetopickourselvesupfornortonsportssaysguttedhernebayskipperlukeharvey 1 5858 0 1 /news/hytheleath030916 3 44755 1 1 /news/twodirectorsstepdownfrommaidstoneunited 2 8115 0 0 /news/burgesshill061104.html 2 0 0 0 /news/crayport211118 4 39868 0 0 /news/ryman/bromley/bromvworth140204.html 1 0 0 0 /news/pennockwereexpectingatoughnight 4 14592 0 0 /news/othernews/13thseptroundup.html 1 0 0 0 /news/15thdec05.html 2 0 0 0 /news/crayburg230920 9 72911 0 0 /news/sladegreen221105.html 1 0 0 0 /archive-2006-2014/74 1 5023 0 0 /news/toomanywrongdecisionsweremadeatthestartoftheseasonsaysdaish 2 6764 0 0 /news/18thmay04.html 2 0 0 0 /news/ramsgate131219 5 18217 0 0 /kent-invicta-league/14 2 9829 0 0 /news/championsfavershamtown8-0corinthian-luchfordifeelontopoftheworld 2 11637 0 0 /news/itsabigseasonforuswiththelightsgoingupwithintwoweekssaysblairbosspaulpiggott 3 11801 0 0 /news/theresabitofpressureonbothteamslookingfortheirfirstwinsaysbromleycoachneilsmith 2 10960 0 0 /news/theplayersaremorethandelightedtheclubhasbeensavedsayscugley 2 8146 1 1 /news/551bc5e0e9994 1 6898 0 0 /news/551a956be4366 2 19392 1 1 /news/551a9250dec79 4 22181 0 0 /news/angelsconfidentofbeatingtitlechasingbromley-exclusiveinterview 2 7778 0 0 /news/tonbridgeangels0-4afcwimbledon-wilfortsayssorryforhiscostlydoubleblunder 2 15208 0 0 /news/bromvashfordfac160903.html 1 0 0 0 /news/restructuringwhosegoingwhere 1 5148 0 0 /news/maidstoneunited2-0hythetown-werebeingpunishedforourmistakessaysscottporter 1 6143 0 1 /news/dulwichhamlet2-0maidstoneunited-youvegottotakeyourchancesadmitsjaysaunders 1 9541 0 0 /news/itsoneofthoseseasonsoflearningsaysgreenwichboroughbossgerrycox 1 4707 0 0 /news/rymanleaguerejecthornetsgroundsharedealatcrawley 1 4144 0 0 /news/roystonwantstoreclaimhisshirtfortelevisedcupclash 1 4635 0 0 /news/fatrophyspecialthepressuresallonhorshamsayslong-servingmorris 2 10607 0 0 /news/captaincookcontinuestoleadbyexampleathythetown 6 20827 0 0 /news/crayvmaid100504.html 1 0 0 0 /news/cugleywaitsforoffersfordryden 1 5129 0 1 /news/daneluchfordfollowsolderbrotherjustintohorsham 2 7880 0 1 /news/chathamtown280820 2 6160 0 0 /news/dartfordhonoursyko-atruegentleman 1 4011 0 0 /news/drmartens/eastern/erith&belvedere/23rdmar04.html 1 0 0 0 /news/kingstonian2-0margate-wecouldvegotsomethingfromthegameadmitsbutler 2 13183 1 0 /news/welling100915 4 18154 0 0 /news/whiteebbs040516 13 250123 7 7 /news/favershamtownunveilreardonastheirnewreserveteamboss 2 8272 0 0 /news/whitstabletown0-5croydonathletic-itwasmenagainstboysadmitsmunday 1 5494 0 0 /news/551bc5e505bad 1 5164 0 0 /news/derestargethalfadozennewfacesforseriouspromotionbid 1 4541 0 0 /news/wewanttogiveagoodaccountforourselvessaysbridonropesbossbenkotey 1 4161 0 0 /news/sutton120216 4 18762 0 0 /news/wellingunitedbossjamiedayunveilshisfirstsummersigning 3 10716 0 0 /news/iwantmysidetoberememberedinthefacupthisseasonsaysnortonbossbentaylor 2 9649 0 0 /news/551bc5e855693 1 2815 0 0 /news/14thfeb04.html 1 0 0 0 /news/wenowneedtostoptherotsayswhitstabletownbossjustinluchford 2 8755 0 0 /news/theeasterfootballprogramme 1 3866 0 0 /news/wearereallylookingforwardtomeetingthefanssayscraywanderersbosskeithbird 5 17936 0 0 /news/margate080618 3 9753 0 0 /news/551bc99cec806 2 24154 1 1 /news/sevenoaks100905.html 1 0 0 0 /news/doverathleticoncourseforthetitlesayshare-exclusive 1 4231 0 0 /news/tonbridgeresidentobrienguttedtobeleavinghamlet 1 3867 0 0 /news/dartford260218 5 24457 0 0 /news/holdersebbsfleetfaceoystermentest 2 5975 0 0 /news/lewishamboroughunveilwillieosullivanastheirnewmanager 1 3566 0 0 /news/551bc5e4e4cde 1 3236 0 0 /news/wingsreceiveclearanceforpairintimeforopeningday 5 14127 0 0 /news/tonbridgeangelsunveilkeithmastersastheirnewsecretary 1 4299 0 0 /news/bridonropes180119 2 6740 0 0 /news/551bc5e657eb0 1 4050 0 0 /news/551bc5e428f3d 3 8690 0 0 /news/drmartens/premier/dover/tonbridge301004.html 1 0 0 0 /news/facupsecondrounddrawdoverathleticpullhomedrawagainstbeesorshots 1 4107 0 0 /news/banscher040419 5 27511 1 1 /news/wewantaclubthatashfordcanbeproudofsayschairmanerniewarren 1 3291 0 0 /news/folkvmarkscfinal280404.html 2 0 0 0 /news/faverams101219 7 69512 0 0 /news/13thjune05G.html 4 0 0 0 /news/beckvlord270304.html 1 0 0 0 /news/doverchairmancallsforvolunteerstopitchinaheadofclubsbiggesteverhomegame 1 3370 0 0 /news/maidstoneunited2-4bognorregistown-imunderpressuretowinpromotionnextyear-saunders 1 8406 0 0 /news/wellstickinthereandwellkeepgoingrighttothedeathsayslewwatts 2 7778 1 0 /news/watford1-2millwalllionesses-lionessesroarbacktowinfirstleaguecupgame 6 57611 2 2 /news/ryman/bromley/8thaug04.html 1 0 0 0 /news/whitstabletown2-2whyteleafe-idliketotaketheseplayersuptothepremiersaysjimward 3 27915 0 0 /news/kentleague/sladegreen/maidstone140804.html 1 0 0 0 /news/franciswaryofopeningdayshock 1 4247 0 0 /news/thamesmeadtown2-0walthamabbey-weregettingbetterandbettereverygamesayskeithmcmahon 3 25166 0 0 /news/tonbridgeangels140720 2 11190 0 0 /news/bromtmead220415 6 117908 1 2 /news/thamsmald110116 3 8808 0 0 /news/hopefullyitsthestartofsomethinggoodfortheclubsaysashfordunitedassistantjohnovard 2 7502 0 0 /news/551a931e9055e 3 10818 0 0 /news/iwanttohelpdoverwintheleaguesaysnewstrikerlovell 1 4130 1 1 /news/allsystemsgoforwhyteleafesstate-of-the-art3gpitchatchruchroad 4 13409 0 0 /news/551a931e40052 2 5018 0 0 /news/wemustliveuptoexpectationssaysburman 1 3882 0 0 /assets/images/icons/referrals/ 5 5458 0 0 /news/hernebaybosssamdenlycontinuestobuildhissquad 4 14140 0 0 /news/corinthianA100220 2 8220 0 0 /news/theroadtowembleyunderdogscanupsetthefavouriteswarnsburman-exclusive 1 4051 0 0 /news/551a9c0eca136 4 14955 0 0 /southern-counties-east-football-league/38 3 14562 0 0 /news/tunwells180817 1 3621 0 0 /news/551a9cf4df079 1 4992 0 0 /news/551a92510d34b 2 11726 0 0 /assets/ckeditor/plugins/scayt/ 5 1933 0 0 /news/551a979864175 1 5182 0 0 /news/canterbury030219 4 23242 0 0 /news/fcelmstead291216 4 14272 0 0 /news/drmartens/eastern/sittingbourne/sittingbournevwhyteleafe130903.html 1 0 0 0 /news/doverchairmanplansforpromotion 2 9029 0 0 /news/wemustwintokeepourseasonalivesayslovell-exclusive 2 10649 0 0 /news/whyteleafe0-3beckenhamtown-wevedeservedallthreetrophiessaysjasonhuntley 4 39028 1 1 /news/olliesstayingunlesswegettherightoffersaysward-exclusive 1 4441 1 0 /news/551bc5e75cf4a 3 19900 1 0 /news/punjgreen020517 3 29624 0 0 /news/551bc5e1b6ae3 2 6192 0 0 /news/551bc5d9c2cd5 2 9338 0 0 /news/551bc99aa1f6d 1 6562 0 0 /news/expectationsarentashighastheywereinthepastsayscash-strappedianjenkins 4 23040 0 0 /news/weneedtosortoutourbudgetfornextyearsaysfolkestoneinvictabossneilcugley 1 3929 0 0 /assets/fileman/Uploads/ 6 2233 0 0 /news/fishermillwall260117 4 13082 0 0 /news/wehavetofightandscrapforeverythingandbelievewecanstayup-nott 2 8129 0 0 /news/dulwich270417 1 4352 0 0 /news/craysct100118 4 43730 0 0 /news/551a96dbf2a42 1 3413 0 0 /news/readersupsetwithbromleysreaction 3 15239 0 0 /news/551a95b3d36c4 4 17381 0 0 /news/werebackintheplay-offracesaysabbott 2 8758 0 0 /news/weneedabigfatrophypay-daysaysthamesmeadtownbosskeithmcmahon 1 5005 0 0 /news/lukeblewden191019 2 6148 0 0 /assets/smartmenus/css/sm-mint/ 5 1823 0 0 /news/17thmar05.html 3 0 0 0 /news/551a97b073d08 3 11826 0 0 /news/24thoct05.html 1 0 0 0 /news/itscrucialwegetbackontrackintheleaguesaysmaidstoneunitedassistantnickysouthall 3 11893 0 0 /news/drmartens/eastern/folkestone/sailsburyvfolkestone200903.html 1 0 0 0 /news/werefinallymovingbacktowherewebelongsaysfisherjoint-managerbillywalton 4 20465 0 0 /news/551a9c91ea9e5 2 8974 0 0 /news/lovellresignsassittingbournemanager 2 6683 0 0 /news/sportingbengal041204.html 1 0 0 0 /news/17thsept05.html 1 0 0 0 /news/dartford1-0crawleytown-jetsettingchampionswonderstrikedumpsfavouritesoutoffatrophy 1 5037 0 0 /news/kennington280218 2 9480 0 0 /news/whitres040904.html 1 0 0 0 /news/551bc5debf5c4 2 7394 0 0 /news/sevenoakstown3-2doverathletic-wevegottheexperiencenowinsistsmoore-exclusive 5 28239 0 0 /news/standardofkentyoungstersisexcellentinsistscoach 3 11771 0 0 /news/stowgleb110120 3 33024 0 0 /news/werelookingforwardtoputtinglastseasonbehindussayscrockenhillbosscraigclark 4 18082 0 0 /news/551a9c933c753 2 8842 0 0 /news/cheshunt131104.html 2 0 0 0 /news/thefacarlsbergvasesecondrounddraw 1 3607 0 0 /news/14thjuly05.html 1 0 0 0 /news/bromley1-1tonbridgeangels-wehavetostarttakingourchancesadmitsbromleycoachneilsmith 2 18264 0 0 /assets/fonts/academy/academy_engraved-webfont.ttf 1 70948 0 0 /news/551bc5e1c6637 2 9400 0 0 /news/craywands221118 3 14565 0 0 /news/margateexpectedtobewithoutmckimmagainstlocalrivals 3 10877 0 0 /news/welling060417 2 7181 0 0 /news/FAStatement240221 7 35016 1 1 /news/3rdjune04.html 1 0 0 0 /news/iwanttobecompetingfortheplay-offsnextseasonsayswhitstabletownbosspeternott 1 3313 0 0 /news/dealtown010819 4 13645 1 0 /news/lewes110220 3 10338 1 1 /news/kentleague/sladegreen/24thjuly04.html 1 0 0 0 /news/craywanderers0-2ashfordtownmatchabandonedathalftime 1 5111 0 0 /news/iexpectustobechallengingforthetitleinthreeyearstimesaysderesbosslonghurst 2 7624 0 0 /news/croyshep200920 7 79047 0 1 /news/ramsgate290915 5 28963 1 1 /news/551a97b0db2ea 3 13479 0 0 /news/plentyofkentishderbiestolookforwardto 1 4967 0 0 /news/ex-stonecalledupforenglandsquad-beforemakingfulhamdebut 1 4871 0 0 /isthmian-league/23 6 29678 0 0 /assets/ckeditor/adapters/ 5 1818 0 0 /archive-2006-2014/274 4 16301 0 0 /news/charlton281217 3 11324 0 0 /news/hernewith261018 4 36871 0 0 /news/stanhaye061220 6 66918 0 0 /news/westwickhamsplitoverleaguefuture 1 5046 0 0 /news/wemustgetchelmsfordoutofoursystemsaystrott-exclusive 1 4993 0 0 /news/wehavetobeinapositionjustincasehernebaywobblesayserithtownbosstonyrussell 1 4579 0 0 /news/551bc5e00bf27 1 4048 0 0 /news/whyteleafe2-0ashfordunited-theyvepushedusallthewaysayswhyteleafebossjohnfowler 3 27204 0 0 /news/551a99e41f032 1 4205 0 0 /news/551a96db8f381 2 6315 0 0 /news/saturdayssoccer25thfebruary2006 3 13722 1 0 /news/drmartens/eastern/tonbridge/26thnov04.html 1 0 0 0 /news/drmartens/eastern/ashford/1stmar04.html 1 0 0 0 /news/551a96dbac679 1 3165 0 0 /news/ryman/bromley/27thoct03.html 1 0 0 0 /news/iwanttotaketheclubforwardbutweneedthefanssupportsayswhitstablechairmangaryjohnson 3 17108 0 0 /news/CEStatement170320 5 29052 0 0 /news/fisherjobwastoohardtoturndownadmitsedinburgh 2 6740 0 0 /news/551bc5ddb38bf 1 4272 0 0 /news/wellkent311018 4 43546 0 0 /news/glebe260720 2 6680 0 0 /news/welldowelleventhoughwehaventgotabudgetinsistsfisk-exclusiveinterview 5 21142 0 0 /news/beckenhamfacinguptomorebrokendreams-exclusive 2 9361 0 0 /news/dolbyquashesstrikerspeculation 6 21843 0 0 /news/craigclarkquitscrockenhilloverpersonalreasons 3 10637 0 0 /news/craywands290318 1 5185 0 0 /news/dartford130518 3 12234 0 0 /news/AFCWimbledon151105.html 2 0 0 0 /news/folkestoneinvicta0-1horsham 1 4726 0 0 /news/seagerhailsteammorale 2 6950 0 0 /news/itsnosecretthatinthedressingroomafterwardsiofferedtoresignsaysmattwyatt 3 12668 0 0 /news/551a9c9242e83 2 11424 0 0 /news/doverathleticunveiledharriscapture 1 3081 0 0 /news/551a97b2309b1 1 4414 0 0 /news/maidstone210320 2 8950 0 0 /news/thamesmeadtown2-2wellingunited-theboysdidtheclubproudsayskeithmcmahon 1 9768 0 0 /news/8thjuly05.html 1 0 0 0 /news/25thjuly05.html 1 0 0 0 /southern-counties-east-football-league/17 10 52854 0 0 /news/grays210705.html 1 0 0 0 /news/sheppey300518 2 6886 0 0 /news/551bc5e0cd1d0 1 3771 0 0 /news/thamesmeadtown1-0tilbury-thisisourmostsuccessfulseasonsayskeithmcmahon 2 19336 0 0 /news/wokifolk241118 3 27450 0 0 /news/18thapr04A.html 1 0 0 0 /news/sevenacresidcup3-0lewishamborough-thereisroomforimprovementsayslouiewalker 2 16855 0 0 /news/harrowborough2-0tonbridgeangels-weweresecondbestadmitsangelsbosstommywarrilow 1 4637 0 0 /news/551a9678ce029 1 5568 0 0 /news/lyddtown291119 3 9862 0 0 /news/edwardswillbebackinsistsford 3 11701 0 1 /news/meridian231218 2 6618 0 0 /news/551a931d95055 1 3943 0 0 /news/551a956c7ccc1 4 20698 1 0 /news/crowborough150416 4 13448 0 0 /news/maidstoneunited2-3bognorregistown-giftedgoalshascostusadmitsjaysaunders 1 5305 0 0 /news/wejustgetblownoutofthewatersaysvcdathleticbosstonyrussell 3 14942 0 0 /news/drmartens/premier/dover/19thsept04.html 1 0 0 0 /news/551bc5e8c3e98 2 6868 0 0 /news/backingboroughtowembleyminnowsfeelhungerforwhitleybayshowdown-exclusive 2 10184 0 0 /news/margate021120 4 15700 0 0 /news/new-lookboroyoungstersraringtogo 1 4667 0 0 /news/21stoct05.html 1 0 0 0 /news/rustgleb050317 4 22282 0 0 /news/bromley040216 4 20030 0 0 /news/bromvdulwlsc030204.html 1 0 0 0 /news/holmcori200116 4 11417 0 0 /news/defendermattturnsdownbourne-exclusive 2 8221 0 0 /news/thefleetatwembleydaishplottingwembleyglory 1 4751 0 0 /news/hythetown3-4maidstoneunited-maidstonewanteditmorethanusadmitsscottporter 3 33305 0 0 /news/hopefullywecanhaveaniceruninthefatrophysayswhitstabletownbossnickysouthall 5 23532 0 0 /assets/images/icons/referrals/Thumbs.db 1 36864 0 0 /news/dereswarmingupaheadoftitlebid 5 20222 0 0 /news/kentleague/beckenham/27thaug03.html 1 0 0 0 /news/soccershortsbeckenhamtownhopefulofsigninglegendarystrikerteddysheringham 1 7720 0 0 /news/oboyleplottingdockersbiggesteverscalp 1 4402 0 1 /news/enfieldtown1-0craywanderers-weredoingallwecantotryandstayupvowskeithbird 1 8507 0 0 /news/reallypleasedtobebacksaysnewly-appointeddealtownbossdarrenanslow 4 15018 0 0 /news/bromvmarl171203.html 1 0 0 0 /news/nineclubsbattleitouttoreachthepromisedland 4 20179 0 0 /news/crockenhillsubmitplanningpermissionforfloodlights-exclusive 1 4081 0 0 /news/itsasaddaytotellahonestanddecentfellowhesoutofajob-doverchairmanjimparmenter 1 3793 1 0 /news/thamesmead310704.html 1 0 0 0 /news/551a97990ce5e 2 10561 0 0 /news/troubledtimeshasmademeabettermanagersayswellingbossjamieday 2 9726 0 0 /news/long-servingcugleyputspentopapertostayatinvicta 2 5780 0 0 /drmartens/eastern/fisher/13thaug04.html 1 9950 1 1 /news/rochbrom041117 1 10130 0 0 /news/craywanderers1-1sittingbourne-idbeguttedifwedontmakeplay-offs-abbott 2 13327 0 0 /news/kentleague/tunbridgewells/whitstable140804A.html 1 0 0 0 /assets/ckeditor/plugins/showblocks/ 5 1823 0 0 /news/551a956b9ab5b 3 11709 0 0 /news/corinthian111116 1 3958 0 0 /news/gillingham210519 5 24302 1 0 /news/551bc99d624ce 1 6912 0 0 /news/ryman/bromley/7thnov03.html 1 0 0 0 /news/thebigfreezecoldsnapwipesoutallkentfootball 1 4387 0 0 /news/lyddtown031117 3 10962 0 0 /news/weneedtogetbackontrack-hessenthaler 2 7395 0 0 /news/551a9797d6919 1 2925 0 0 /news/croydon250421 78 338780 7 43 /news/grayscray011117 2 17828 0 0 /news/greenwichborough0-3westwickham-therewasnofireinourbellytonightadmitsboroughbosscox 2 34528 1 1 /news/craywanderers0-3brackleytown-wedidntgetwhatwedeservedadmitsproudfrancis 1 6402 0 0 /news/wevegottoprovehowgoodwearesayscraywanderersjoint-bossgaryabbott 3 12202 0 0 /archive-2006-2014/246 3 12890 0 0 /news/551a95b3712a0 4 16284 1 0 /news/ourproblemsarebeingresolvedrevealsupbeatcugley 3 12530 0 1 /news/erithbelvedere4-2corinthian-worstteamperformanceihaveseenin50yearssaystonysitford 1 9683 0 0 /news/craysitt131217 1 11317 0 0 /news/whitstabletownbeginsearchfornewmanagerafterpartingcompanywithmarklane 1 4005 0 0 /isthmian-league/30 3 14849 0 0 /news/memberclubsvoteforleaguenamechange 6 19250 0 0 /news/weknowthetaskaheadinsistsboroughboss-exclusiveinterview 5 15569 0 0 /news/ramsgate031120 6 23520 0 0 /news/sctbear271117 4 38658 0 0 /news/spennymoortown2-1tunbridgewells-wegaveiteverythingonadaytoremembersaysjasonbourne 6 89822 2 2 /news/glebe210715 3 18609 0 0 /news/drmartens/eastern/dartford/horshamymca050904.html 1 0 0 0 /news/bromleymanagementteamquitoveruncertaintyathayeslane 1 4295 0 0 /news/ramschiefurgesfanstotakeupclubsfreegameoffer 1 4383 0 0 /news/551a99e55af71 2 22322 1 1 /news/apmacl130216 4 50697 0 0 /news/welling210416 3 10248 0 0 /news/whitstablerelishhessenthalervisit-exclusive 2 7538 0 0 /news/551a9718dcf5d 4 17345 0 0 /news/resultsfebruary2019 4 35147 0 0 /news/ramschat250818 4 42596 0 0 /news/chatharl280315 3 25826 0 0 /news/myoldsidewanttostickoneonmesaysbutler 1 4090 0 0 /news/17thoct03.html 1 0 0 0 /news/itwasprobablytheworstinjuryiveeverseenonapitchclaimskevinwatson 4 23312 0 0 /news/551bc5da2a7aa 2 8068 0 0 /news/canterburycityhasthepotentialtobeoneofthebiggestclubsinkentsaysmurray 2 8097 0 0 /news/551bc99ddb764 2 24753 1 0 /cray-2003-2006/3 4 12121 0 0 /news/wemustretainourfitnessduringthewintermonthssayshessenthaler 1 6177 0 0 /news/kentleague/sladegreen/beckenham041204.html 1 0 0 0 /news/drmartens/eastern/sittingbourne/27thnov04.html 1 0 0 0 /news/lovellstartstorebuildashfordsquad 2 17834 1 0 /news/foleyturningchathamgreenandwhite 1 4604 0 0 /news/hythetown1-2whitstabletownaet 1 3739 0 0 /news/wellturnitaroundinsistscugley 4 20916 0 0 /news/27thjan05.html 1 0 0 0 /news/erithtown201104.html 1 0 0 0 /news/hollands010516 4 20717 0 0 /news/kentleague/whitstable/11thjuly03.html 2 0 0 0 /national-league/35 2 8764 0 0 /news/hythetown270320 2 8344 0 0 /news/corinthian310818 1 3853 0 0 /news/greenwichboroughfc.com 1 0 0 0 /news/theycanttakeawaymyplayersheartanddesiresayshernebaybosssimonhalsey 1 5790 0 0 /news/doyourshoppingwithus 1 3161 0 0 /assets/fileman/css/ 8 3507 0 0 /news/soccershortsjohnovardquitsashfordunited 27 232897 22 22 /news/sheppey230717 2 7974 0 0 /news/dulwtonb040915 4 13657 0 0 /kent-invicta-league/17 2 9510 0 0 /news/beckrust210918 4 42338 0 0 /news/551a9cf55be31 2 11106 0 0 /news/chathamtownvleatherhead 2 5733 0 0 /news/soccershortscrabblepassesfootballleaguegroundgradingrequirements 1 6505 0 0 /news/jamesshermanwillbearamnextseasonsaysbossjustinluchford 6 19873 2 0 /news/january2011results 1 7094 0 0 /news/othernews/1stsept04.html 1 0 0 0 /news/itwouldbedifficultformygirlstoleavehernebaysaysproudbossanthonydeer 4 19285 0 0 /news/551a931e3d02b 1 4133 0 0 /assets/fonts/ 6 2545 0 0 /news/27thaug04.html 1 0 0 0 /news/coverageovertheeasterperiod 1 3579 0 0 /news/iwanttheboystoenjoyplayingdagenhamandshowpeopletheyregoodplayerssaysnickysouthall 6 28628 0 0 /news/fatrophyspecialmcclementsisstillinburmansplans 2 8586 0 0 /news/theashfordsupportersdeservefootballathomelandssayspaulbowden-brown 1 5451 1 0 /news/yorathwemuststartproducingthegoods 2 7085 0 0 /news/vcdphoe291219 5 61062 0 0 /news/11thaug05.html 3 0 0 1 /news/7thsept05.html 2 0 0 0 /news/wewanthomecomfortsduringplay-offssaysmcclements 2 12462 1 0 /news/551a9797e9a50 7 71477 3 3 /index/login/register 1 4703 0 0 /news/hessenthalerbidstoremovestaines 1 3612 0 0 /news/joeford010819 3 11998 0 1 /news/hessenthalerhooksagoalkeeper 1 3638 0 0 /news/erithtownpartcompanywithjamescollinsafterelevengames 3 9814 0 0 /news/wellerit130319 4 41484 0 0 /news/18thapr04.html 2 0 0 0 /news/doverathleticchairmanoffersbossmartinhayesanewcontract 2 6964 0 0 /news/551a9cf578dfc 2 7968 0 0 /news/551a9cf51605e 2 12100 0 0 /news/craywanderers0-5maidstoneunited-a5-0defeatdoesntlookgoodadmitspaulblade 4 38748 0 0 /news/tunwells030816 2 7052 0 0 /news/551bc5dbef81d 2 9990 0 0 /news/hampton220105.html 2 0 0 0 /news/drmartens/eastern/erith&belvedere/26thoct04.html 1 0 0 0 /news/tunwells060716 4 17024 0 0 /news/werehopingwecanchallengetorquayallthewaysaysbromleybossmarkgoldberg 4 21372 0 0 /news/crockenhill300816 4 12396 1 1 /news/551bc5de44677 1 3475 0 0 /news/551a9798192f5 2 6708 0 0 /news/lisneyrelishingmillwallvisit 1 5212 0 0 /news/resultsfebruary2012 1 7901 0 0 /news/craylewe200118 1 10089 0 0 /news/551a9c0e3e40d 1 3184 0 0 /news/551a9b4827118 6 47142 3 2 /news/glebe290116 4 15225 0 0 /news/angelsdayofdestinyitsfinallyhere 1 5415 0 0 /news/weregoingtodartfordtobringthetrophybacktokentsayspcsteele 1 3300 0 0 /news/551a9677c8b9f 1 3312 0 0 /news/resultsdecember2018 4 37550 0 0 /news/wellleyt290119 3 26019 0 0 /news/551a9c0f1f54f 1 7045 0 0 /news/afccroydon281217 2 7529 0 0 /news/wevewaitedalongtimeforthisfacuptiesayscrayvalleybossstevechapman 5 17440 0 0 /news/dartford2-1newportcounty-dartsbosstonyburmanhowcanitoptoday 2 12878 0 0 /news/soccershorts060720 6 33002 1 0 /news/cugleypraiseshisyoungfabbackfour 2 10560 0 0 /news/7thjuly03.html 2 0 0 0 /news/matatasdrivingambitiontosucceed 5 23493 0 0 /news/erithtown1lordswood2 3 9711 0 0 /news/northleigh270805.html 1 0 0 0 /news/tootbags111220 2 20858 1 1 /news/tonbridgejuniordian120715 3 17994 0 0 /news/theresultswillcomeinsistsunder-pressuremunday 1 3701 0 0 /news/dealtown030217 1 3478 0 0 /news/thisismystrongesteversquadsayschathambosspaulfoley 2 26015 1 0 /news/bromley081118 4 23893 0 1 /news/greenwichboroughunveiljohncumberbatchastheirjoint-manager-hugolangtonjoinshorsham 1 15237 1 0 /news/dulwich171016 2 6494 0 0 /news/551bc99b51b02 1 3760 0 0 /news/KentFAStatement060420 3 9988 0 0 /news/NationalLeague130720 2 6604 0 0 /assets/ckeditor/plugins/scayt/dialogs/ 1 394 0 0 /news/drmartens/eastern/erith&belvedere/3rdmar04.html 1 0 0 0 /news/cugleymakesdoublesigningintimeforbigkick-off 1 4825 0 0 /news/sceflstatement060620 3 8977 0 0 /news/551a925088e78 2 6098 0 0 /news/kingstonian2-3ashfordtown-ashfordstunleagueleaders 2 13128 0 0 /news/chathamtown2-0afchayes-wevegotmoreinthelockersayschathamtownbosskevinwatson 5 39747 0 0 /news/Enfitonb160118 1 8145 0 0 /news/lovellrueshisluckduringseven-goalramraid 2 8561 0 0 /news/drmartens/eastern/folkestone/kingstonian201104.html 1 0 0 0 /news/tonbridgeangels4-3lowestofttown-wedeservetogoupsaystommywarrilow 2 17627 0 0 /news/stainestown0-2bromley-istillwantustoscoremoregoalssaysbromleycoachneilsmith 2 17292 0 0 /news/kentcounty/22ndjune03.html 2 0 0 0 /news/thisisthestartofourweekfromhell-burman 2 8860 1 0 /news/dealtown100217 1 4169 0 0 /news/551a9c91d9f95 1 3765 0 0 /news/30thjan05.html 3 0 0 0 /news/kentleague/sladegreen/2ndjuly03.html 2 0 0 0 /news/5thmay05.html 4 0 0 0 /news/551a9799538d8 1 5994 0 0 /news/kentyouthleaguestatement181020 4 15661 0 0 /news/551a96db358f9 1 3682 0 0 /assets/smartmenus/css/sm-blue/ 5 1976 0 0 /news/whitstabletown2-1sittingbourne-lanepraiseforrookiekeepershaunsmith 1 5488 0 0 /news/erithbelvedere3sportingbengal2 4 14186 0 0 /news/chatwhit141117 1 10881 0 0 /news/punjab070220 2 6852 0 0 /news/kcfaclubstochargefirstteampricesforseniorcupties 3 11987 0 0 /news/kentleague/sevenoaks/j'darcy260804.html 1 0 0 0 /news/sittingbourne090715 3 10845 0 0 /news/4thaug05G.html 3 0 0 0 /news/551bc5dd063bc 1 4612 0 0 /news/stainestown030120 6 26513 1 1 /news/dartford020520 2 9292 0 0 /archive-2006-2014/46 4 20498 0 1 /news/folkestoneinvicta3-2eastthurrockunited 1 4515 0 0 /news/551bc5de473b1 1 3777 0 0 /news/paulfoleypartscompanywithchathamtown 1 6254 0 0 /news/resultsseptember2019 4 78929 0 1 /news/551a9c92b2d26 2 11842 0 0 /news/551bc5de9c412 1 3911 0 0 /news/maidstone120218 4 17466 0 0 /news/thefleetatwembleybringthetrophybacktokentsaysthree-timewembleywinnerhyde-exclusive 1 5647 0 1 /news/wecanputaspannerintheworksforotherteamssaysramsgatebossjimward 1 3499 0 0 /news/vcdathletic6-0romford-nooneintheleaguegaveusachancesayschampionbosstonyrussell 4 47596 0 0 /news/hopefullywewillsurpriseafewclubsthisyearsayswellingunitedbossjamieday 5 23285 0 0 /news/kentleague/lordswood/lordvdeal191103.html 1 0 0 0 /news/wellingunited300819 2 6944 0 0 /news/lordsbrac021217 2 16757 0 0 /isthmian-league/12 12 60090 0 0 /news/bromley250321A 17 86179 3 4 /news/ashfordplayersontrial-exclusive 1 4571 0 0 /news/hytheheroesdontwalkoffthepitchwithanyregretssaysscottporter 1 5436 0 0 /news/dartford2-1eastbourneborough-thereseemstobeanegativefeelingaroundtheplace-burman 2 11673 0 0 /news/NationalLeague241220 2 8086 0 0 /news/wingsontheroadagaininlastsixteen 4 12306 0 0 /news/beckenhamtown1-2worthing-weranoutoffabitofsteamsaysjasonhuntley 1 7498 0 0 /news/barton160405.html 1 0 0 0 /news/26thsept05G.html 3 0 0 1 /news/chelmsford211105.html 2 0 0 0 /news/afchornchurch1-2maidstoneunited-kidsemergencehasgivenmefoodforthoughtadmitshume 2 13080 0 0 /news/wemustnotletourhighstandardsslipsayswarrilow-exclusive 2 10158 0 0 /news/lordswood091020 3 10716 0 0 /news/thebigkickoffthamesmeadtown2-0croydon-trademarkdimmockgoalsettlesopeningdayclash 1 6608 0 0 /news/ashfordwelcomegunnersforcunninghambenefitmatch 2 5993 0 0 /news/hopefullywecanmakealittlebitmorehistorysayswhitstabletownbossnickysouthall 2 10484 0 0 /news/fisher200820 3 12247 0 0 /news/551a956c761e5 4 18506 1 1 /news/paperboysreturnhome 4 13126 0 0 /archive-2006-2014/131 4 19643 0 0 /news/sheppeysheernessunited7-0erith147sports-itsafantasticdayfortheclubsayskevinhake 3 32787 0 0 /news/erithbelvedere2-2dealtown 6 38175 3 2 /news/crayvalleycouldbeadarkhorsesaysvickersbossrickybennett 1 4751 0 0 /news/sevelord121217 2 20582 0 0 /news/lymingtonreplay070804.html 2 0 0 0 /news/peckham190618 3 11170 0 0 /news/dover190618 3 9891 0 0 /news/soccershorts160519 3 21668 0 0 /news/551bc5dfa6c3b 1 3669 0 0 /news/551a96dc7350e 3 16923 0 0 /news/drmartens/eastern/erith&belvedere/southall051004.html 1 0 0 0 /news/551bc5daa5317 2 7836 0 0 /news/openingdaywinoverdereswasnotaflukeinsistslonghurst 1 4524 1 0 /news/551bc5e10abc1 1 4531 0 0 /news/welling260518 3 9438 0 0 /news/nickbarnesisthegreatbitforthejigsawtogetourpromotionpushbackontracksaysporter 2 10907 1 1 /news/ebbsfleetunited1-2basingstoketown-thatsabitterpilltoswallowadmitsstevebrown 3 29315 0 0 /news/robbinssignstwomorefromashfordtown 5 17059 0 0 /news/551a9cf5921a4 1 3904 0 0 /news/kentleague/sevenoaks/18thaug04.html 1 0 0 0 /news/abbottscommentsinspiredmysidetoknockoutsittingbourneadmitsproudgorman 2 9118 0 0 /news/rymanleagueannounceprizemoneyawards 3 11023 0 0 /news/19thaug05.html 2 0 1 0 /news/ifiwasagamblingmanidputouropeninggamedownasadrawsaysfisherbossstevefirkins 1 4980 0 0 /news/8thdec03.html 1 0 0 0 /news/weneedtoaskourselvessomeseriousquestionsaboutwhywereverypooratpresentsayspalmer 1 3678 0 0 /news/hollandsandblair.co.uk 2 0 0 0 /news/551bc99ac00b8 1 3436 0 0 /news/551bc5e67aefb 3 16318 0 0 /news/551a96dbeaca2 1 3794 0 0 /news/theplayersaredesperatetoshowtheirgratitudetoawelcomingtruegentlemansaysmattlonghurst 3 15566 0 0 /news/tonbridgeunveilanotherdoublesigning 6 27093 0 0 /news/19thjan04.html 1 0 0 0 /news/lordswood201017 2 6516 0 0 /news/weneedsupporttomoveforwardsaysfavershambossjustinluchford 1 5245 0 0 /news/invictawanttoendreplaymiseryatparkviewroad 3 16021 1 0 /news/walton180105.html 2 0 0 0 /news/welltryandgetthroughpeacehavenandgoasfaraswecansayssittingbournebossrichardbrady 2 7398 0 0 /news/lyddtown081217 3 10503 0 0 /news/corby051105.html 2 0 0 0 /news/maidstoneunited2-0walthamabbey-relegationwouldbeadisasterinsistsnott 1 6505 0 0 /news/551bc5e25ed55 1 4243 0 0 /news/551bc99b9f441 2 8454 0 0 /news/portvale4-0dartford-ourupsetshouldvehappenedathomeadmitsprouddartsbossburman 1 7218 0 0 /news/551a925004f50 2 6620 0 0 /news/24thjune03.html 4 0 1 0 /news/551a967819dcc 1 3590 0 0 /news/february2008resultsfixtures 2 10716 0 0 /news/bradleypritchard140219 3 13353 0 0 /news/tonbridgeangels0-3afcwimbledon-wewerebeatenbythebettersideadmitswarrilow 1 5563 0 0 /news/maidstone260520 2 8724 0 0 /news/ashfordtown1-1chipstead-lovellwhycanttherymanleagueextendtheirseason 1 4912 0 1 /news/craywanderers2-1carshaltonathletic-weneedaplayerlikelaurenthamici-jenkins 1 6011 0 1 /news/551a95b47d027 1 4326 0 0 /news/crayvalleyatwembley160519B 3 15489 0 0 /news/kempsterwinningthefavaseandplayersaccoladewasthecherryonthecake 1 6434 0 0 /news/551bc99b3c739 1 5093 0 0 /news/sevenoakstown1-2hollandsblair-itfeelsgreattowinkentseniortrophysayspaulpiggott 1 8908 0 0 /news/iwouldntcelebrateifiscoredagainsttonbridgeangelssayslewesstrikerlukeblewden 6 45044 2 2 /news/conneallypaystributetoinspirationalrogers-exclusiveinterviews 1 4796 0 0 /news/14thdec05.html 2 0 0 0 /news/holmesdale3-2beckenhamtown-hughesgivesbeckenhamanelectricshock 1 6770 0 0 /news/croydon011220 2 19494 1 1 /news/ryman/bromley/windsorvbrom090903.html 1 0 0 0 /news/drmartens/premier/dover/16thnov04.html 1 0 0 0 /news/soccershortsgledhillaimstoarrestinvictasslide 1 9479 0 0 /news/seageraskstitlerivalswecanhandlethepressurecanyou-exclusiveinterview 1 4434 0 0 /news/tunbshep260917 1 11691 0 0 /news/fcelmstead140719 2 7828 0 0 /news/551bc5e8bbd7d 2 6967 0 0 /news/sladegreen1-1tunbridgewells-wehadenoughchancestoseethemoffadmitsrobbins 1 4510 0 0 /news/551a96db62163 2 6414 0 0 /news/brackvbrom300903.html 1 0 0 0 /news/erithtown1-2greenwichborough-ogoorepaysfirkinsfaith 2 24967 1 0 /archive-2006-2014/162 4 17487 0 0 /news/551bc5e2935fa 1 4739 0 0 /archive-2006-2014/151 4 18559 0 0 /news/gillsatwembley38000ticketsupforgrabs 1 3776 0 0 /news/dartford0-2hastingsunitedarrowsinflictdartsfirstloss 5 22580 0 0 /news/kentleaguepairsnapuprymanleaguemidfielders 5 17248 0 0 /news/sitthythe080416 4 16198 0 0 /news/wemustwinourhomegamessayscugley-exclusive 2 8654 0 0 /news/edboydenphotos.co.uk 2 0 0 0 /news/kentleague/hythe/littlehampton280804.html 1 0 0 0 /news/headcoachdepartstunbridgewells 2 5931 0 0 /news/botterillisthefinalpieceinourjigsawsaysluchford 1 4663 0 0 /news/bromsutt010119 4 38877 0 0 /news/fanspitchinsowingsvisitcangoahead 1 4210 1 0 /news/ryman/bromley/4thjan04.html 1 0 0 0 /news/flanaganwereallyneedtobeatbillericay 1 3960 0 0 /news/tonbridgeangels6-1worthingmaindedicatesfourgoalstohislatemum 5 30370 1 0 /news/chathamlookingtorekindleoldflame 1 3781 0 0 /news/tonbridge111116 1 3925 0 0 /archive-2006-2014/284 2 7945 0 0 /news/four-weekinjuryblowforinfluentialskipperdenly 1 4819 0 0 /news/remyhailsthebestgoalthativescored 2 7974 0 0 /news/margateunveilexcitingplanstotransformhartsdownparkintofootballleaguegradedstadium 1 4271 0 0 /news/fisherencouragedbypositiveresponseovercommunityhubplans 1 5387 0 0 /news/sheppeyunitedfc.co.uk 2 0 0 0 /news/croydon170920 7 25854 1 0 /news/ashfordunited240818 3 10851 0 0 /news/hernebayscrackingrunhasspurredmyboysonsayslordswoodbossjasonlills 3 13220 0 0 /news/551bc5df51d5f 1 3480 0 0 /news/phoenix041215 3 12321 0 0 /news/hamptonrichmond1-1hythetown-hopefullywecanfinishoffthejobathomesaysscottporter 3 24587 0 0 /news/wehavetogotothreebridgesanddoaprofessionaljobsayshythetownbossscottporter 4 16572 0 0 /news/greenwich210417 1 3647 0 0 /news/wevegotnothingtoloseandeverythingtogainsaysfolkestoneinvictabossneilcugley 5 20091 0 0 /news/551bc5e0a18df 1 4516 0 0 /news/crockenhill240916 4 18736 1 1 /news/551a97b1e8a21 1 4551 0 0 /news/molesey170905.html 2 0 0 0 /news/wingshavestrongpresenceatdansonfestival 5 18008 0 0 /news/thamesmeadtown3-0wellingunited-wellmakesurewellgetitrightvowswellingbossjamieday 5 46070 0 0 /news/punjab250118 4 13614 0 0 /news/kentyouthleague240615 3 11415 0 0 /news/551bc5dac03cf 2 5694 0 0 /news/551a931ec658d 3 27379 2 1 /archive-2006-2014/80 1 4913 0 1 /news/newfavershambosscopleymakesdoubletransferswoop 2 7414 0 0 /news/soccershortsmarkarberquitsdartfordoverlengthofcontractoffer 5 26875 0 0 /news/holmesdalesgroundsmanscoopstopfaaward 6 20533 0 1 /news/551a979a2e2e3 2 9413 1 1 /news/551a9cf532c51 2 12888 0 0 /news/wealddart170218 5 46667 1 1 /news/butlerfrustratedwiththeelements 1 4449 0 0 /news/bromley2-0chelmsfordcity-wevegotthepotentialofatop-sixsideadmitsmarkgoldberg 2 17018 0 0 /news/areyoustillsearchingforanewclub 5 15710 0 0 /news/craywanderers2-0hastingsunited-maybewecangettheautomaticpromotionspot-ianjenkins 1 8363 0 0 /news/wecanattractbetterplayersifwegoupsaysfleetleisurebossleerichmond 3 13925 0 0 /news/angelsfavouritestotakecupawayfromtheirneighbours 1 4364 0 0 /news/werenotgoingtosit-backtoprotectourtwo-goalleadsaysmcphee 2 7258 0 0 /news/dover311016 3 13977 0 0 /news/bromley1-2craywanderers-iwanttogoonandwinthelondonseniorcupsaysianjenkins 1 7137 0 0 /news/lordswood220219 4 14220 0 0 /news/bromley1eastthurrockunited1 4 19134 0 0 /news/thefacupprizemoneyisthemajoraspectatthemomentadmitsthamesmeadtownbosskeithmcmahon 3 12875 0 0 /news/debutantwestermenleftinthedarkonderesdebut 1 3561 0 0 /news/551bc5e466ed5 1 4390 0 0 /news/greenslim130915 4 35842 0 0 /news/551a9c921de48 1 4119 0 0 /news/551bc5dd64000 3 13553 0 0 /news/phoenixsports1-2suttonathletic-ithinkthatstheperfectseasonsaysjamescollins 3 29091 0 0 /news/sutton161004.html 1 0 0 0 /news/soccershorts130516 4 34619 0 0 /news/ryman/bromley/30thjuly03.html 2 0 0 0 /news/deal130217 1 3658 0 0 /news/matchreportschathampulloffanothershockresult 2 22998 0 0 /news/threeplacesareupforgrabsinmyopeningdayteamrevealsward 2 8900 1 1 /news/wedeservetobehigherupinthedivisionsayswhitstabletownjoint-bossjimward 2 8978 0 0 /news/welltrytobringanicebrandoffootballtobromleysaysmurrayjones 2 8405 0 0 /news/daishappealstokeepstarsatclub 1 4590 0 0 /news/551a9cf4d4a57 1 3276 0 0 /news/resultsfebruary2021 5 19461 0 0 /news/551a9718bcea4 2 6218 0 0 /news/maidstone080616 4 12210 0 0 /news/burmanletsmakedartfordbetterthanitalreadyis 3 10201 0 0 /news/faversham260117 1 4186 0 0 /news/551bc99b09843 1 3131 0 0 /news/neilsonhopetestswillenablehimtoplaylonger 1 5277 0 0 /news/iwouldloveoneyeartotakeasidewithabigcrowdsaysvcdathleticbosstonyrussell 1 4812 0 0 /news/wereinapositiontoberespectedsaysbridonropesmanagergarylisney 3 12972 0 0 /assets/uploads/print-commands/ 4 1290 0 0 /news/6thfeb05.html 1 0 0 0 /news/arlesey031205.html 1 0 0 0 /news/letsmakeitaneveningeveryoneatdartfordwillneverforgetsaysacademycoachderenibrahim 1 4788 0 0 /news/glebe290518 2 8401 0 0 /news/othernews/KYLFIX110204.html 1 0 0 0 /news/stanselt140716 6 26890 3 2 /news/soccershortsbromleystrengthensquadtocontinuepromotionpush 4 33764 0 0 /news/ashford281119 3 12182 0 0 /news/31stoct04.html 1 0 0 0 /news/chathamtownunveilnewgoalkeepersigning 1 3228 0 0 /news/gotanynews-1 1 2775 0 0 /news/beckenham291120 7 26943 0 0 /news/9thoct03.html 1 0 0 0 /news/ksports-fc.co.uk 1 0 0 0 /news/favmerst280415 5 43401 0 0 /news/maidbrom280418 4 40130 0 0 /news/551a956c0233d 4 18474 0 0 /news/551bc5e5ec317 1 5262 0 0 /news/wellingunitedbossjodybrownringsthechangesatthestartoftransferwindow 4 20192 0 0 /news/551bc5d9203ca 2 6622 0 0 /news/tunbridgewells2-3tonbridgeangels-icantfaulttheireffortsayswellsbossdavewilliamson 1 6769 0 0 /news/fisher021019 7 26138 0 0 /news/wehavetobeontopofourgamesayslangton 1 4074 0 0 /news/551a96dbc2ae7 1 3351 0 0 /assets/select2/tests/data/minimumInputLength.html 1 251 0 0 /news/pottersbartown4sittingbourne4includestodaysresults 3 19663 0 1 /news/551a92506a90a 2 10120 0 0 /news/kennington111019 3 10808 0 0 /news/dulwichhamlet280720 3 9377 0 0 /news/itmakesabsolutesenseforthepeopletosupportmyplanssayschairmangaryhillman 5 18292 0 0 /news/551a931e1fc0f 1 4077 0 0 /news/hesshashighhopesfornewsigningbrowning 1 3894 0 0 /news/hessenthalerfacesteamselectionnightmareformidweektriptofleetwood 1 4568 0 0 /news/itsgoingtobeagreatmarchandaprilbecauseeveryonesgottoplayeachother-simonhalsey 2 8179 0 0 /assets/images/jquery-ui/Thumbs.db 1 3584 0 0 /news/weseemtobeingheldbackbyabitofalackofambitionsaysmetrogasbossroydavies 3 13257 0 0 /news/glebe270716 4 16997 0 0 /news/wehavealottolookforwardtosaysgillinghamskippervickyashton-jones 2 9036 1 1 /news/551a979824bfd 4 17685 0 0 /news/soccershortskentsidesgiveyouthachancetoimpress 2 7737 0 0 /archive-2006-2014/103 2 10078 0 0 /news/margate0-1tonbridgeangels-mymargatesidelackedpassionfumesbossiainoconnell 1 6314 0 0 /news/allweregoingtodoisgiveitourbestshotsayscroydonbossdicksongill 3 13684 0 0 /news/551a95b3c632f 1 3860 0 0 /news/551bc5e1124a4 1 3202 0 0 /news/551bc99b560b5 1 3449 0 0 /news/551a979aa16f1 2 23302 1 1 /news/lewiswellgetusedtooneanother 1 4007 1 0 /news/551bc5e33c3ce 3 13010 0 0 /news/17thaug04.html 2 0 0 0 /news/doverdonnelly070515 5 20952 0 0 /news/gillingham060121 3 9870 0 0 /news/551a99e3b2eed 1 5372 0 0 /news/gillsunveilstimsonasnewboss 2 6679 0 0 /news/thamhorn081017 1 9260 0 0 /news/chathamtown0-5aveley-theresaseverelackofqualityadmitsembarrassedkevinwatson 4 37284 0 0 /news/ourplayersbelievewecanwinboththeleagueandfavasesaysphoenixsportsbosssteveoboyle 3 15119 0 0 /news/28thapr04.html 1 0 0 0 /news/facarlsbergvasethirdrounddraw 1 3459 0 0 /news/soccershortsgreenwichboroughapproachdutchsuperstaredgardavidstosignforclub 4 23289 0 0 /news/tonbdul020116 3 34437 0 0 /news/wellingunited140121 3 19813 1 1 /news/glebe260317 4 14874 0 0 /news/sittvstam280204.html 2 0 0 0 /news/nationwide/gillingham/1stjuly03.html 2 0 0 0 /news/551a99e3e9841 3 12894 0 0 /news/cumberbatchreturnstohomelands 4 12390 0 0 /news/sevenhors200816 2 20673 0 0 /news/folkestoneinvicta1-1eastbourneborough 1 4325 0 0 /news/nationwideconferencefixturesannounced 5 13412 0 0 /assets/select2/docs/vendor/fonts/ 1 442 0 0 /news/551a97b179881 1 6205 0 0 /news/551bc99b34fe9 1 3867 0 0 /news/551bc5e898a4a 2 7196 0 0 /news/kentleague/4thsept03.html 1 0 0 0 /news/burmanwantstoenjoythenextsevendays 4 18536 0 0 /news/551a96db3f4a4 1 3625 0 0 /assets/images/icons/payments/Thumbs.db 1 14848 0 0 /news/glebtunb120320 6 67971 1 0 /news/erithdartfordtowntiemanagergaryabbottdowntoathree-yearcontract 2 7941 0 0 /archive-2006-2014/23 3 15188 0 0 /news/creditcrunchkentclubssufferincurrenteconomicclimate 1 4520 0 0 /news/arleseytown0chathamtown1 1 3506 0 0 /news/drmartens/eastern/erith&belvedere/9thaug04.html 1 0 0 0 /news/erithandbelvedere010320 6 24151 0 0 /news/phoenix080319 2 8400 0 0 /news/27thoct03.html 2 0 0 0 /news/lillisstepsdownashernebaymanager 1 3619 0 0 /news/facarlsbergtrophyfirstrounddraw-1 1 3195 0 0 // 1 3278 0 1 /news/FAStatement110920 3 10519 0 0 /news/dartford6-1whitstabletown-wecouldhavegivenabetteraccountofourselvesadmitsnott 2 15736 0 0 /news/tonbridgeangels3-1chelmsfordcitymainiwanttoturnpro-exclusiveinterviews 2 13440 0 0 /news/webelievejamiedayistherightmantobringsuccesstoebbsfleetunitedsayspetervarney 3 14255 0 0 /news/drmartens/eastern/tonbridge/20thoct04.html 1 0 0 0 /news/drmartens/eastern/tonbridge/7thsept04.html 1 0 0 0 /news/vice-chairmanstepsdownasclubgoesfromonecrisistoanother-exclusive 1 4926 0 0 /assets/select2/docs/_includes/footer.html 1 239 0 0 /news/hollands050617 1 4476 0 0 /news/canterbury250219 4 22830 0 0 /news/kentleague/ramsgate/11thnov03.html 1 0 0 0 /news/17thjan05.html 4 0 0 0 /news/wforest021004.html 2 0 0 0 /news/chatham271205.html 2 0 0 0 /news/wellcauserebelsproblemssayscugley 1 5660 0 0 /news/ryman/bromley/8thjuly03.html 2 0 0 0 /news/bremneroptstoleavefolkestone 1 3539 1 1 /news/wegotoutofjailadmitshessenthaler 2 7466 0 0 /news/metrstan300419 6 53425 0 0 /news/spenbrom270218 4 17470 0 0 /news/crayvalleycollins210817 1 4824 0 0 /drmartens/premier/dover/folkestone280305.html 2 5064 2 2 /news/wardyouhavetoearnyourpremierpoints-exclusiveinterview 3 12548 0 0 /news/ramsgate180817 1 3664 0 0 /news/alanjulianhasacceptedanofferhecouldntrefusesaysdartfordbosstonyburman 3 10305 0 0 /news/wevegottobeatteamslikesevenoaksinsistscordice 5 23346 0 0 /news/tooting031205.html 2 0 0 0 /news/iwantaleaderoutonthepitchsaysseager 1 3857 0 0 /news/ryman/bromley/bromvnorthleighfac300803.html 1 0 0 0 /news/harrbrom070320 4 36556 0 0 /news/areyoulookingformorepublicity 1 2848 0 0 /news/beckenham020120 4 14688 0 0 /news/theresnoreasonwhywecantbeattheleagueleaderssayscugley 3 16715 0 0 /news/phoenix250915 4 13474 0 0 /news/smallingscashwillcomeinhandysaysstoneschairman 2 8938 0 0 /news/eastshep131020 4 39596 0 0 /news/thechallengefortheplayersnowistobemoreconsistantsaysfavershambossrayturner 1 3955 0 0 /news/kentleagueunveilnewsponsorshipdeal 1 3412 0 0 /news/bromley1-2hamptonrichd-werecognisewereinamassiverelegationbattleadmitsgoldberg 1 7311 0 0 /news/burmantellshissidetogetontheirbike 1 3862 0 0 /news/imjustgladwereprovingquiteafewpeoplewrongsayswarrilow 1 4007 0 0 /news/triomakewayascugleyswoopsforstarstriker 3 13349 0 0 /news/551a97b098897 1 3076 0 0 /news/whitstabletown1-0redhill-seagerkeenonsecuringmunday 2 39444 2 2 /news/551a9c0e8b31d 1 3436 0 0 /news/breakingnewsfacupfirstrounddraw 3 8302 0 0 /news/eltham201116 4 18874 0 0 /news/shameasmanagerpunchesrefereeatanundersevensfootballmatch 2 7476 0 0 /news/551a9bafda2af 3 10008 0 0 /news/ramsgate2-0margate-goalswerebetterthanpremierleaguehailsward 2 9630 0 0 /news/tommywarrilowbringsjohnbealesbackhometolongmeadstadium 1 13315 1 0 /news/sevenoaks030905.html 1 0 0 0 /news/bracbrom200518 8 102023 1 1 /news/wellingunitedtoldtokeeptheirtaxpaymentsuptodate 1 4877 0 0 /news/erithandbelvedere310820 2 8444 0 0 /news/seagerhitsbackatfansabuse 1 3804 0 0 /news/hillingdon291005.html 1 0 0 0 /news/welling110817 1 4140 0 0 /news/hendon0folkestoneinvicta0 4 15877 1 0 /news/mcmahonmakesroystonhisfirstbignamesigning 6 21751 0 0 /news/NationalLeagueStatement060421 39 168379 1 22 /news/faversham221216 1 4676 0 0 /news/fansquizfavershamtownmanagementduo 2 6231 0 1 /news/meridian221119 3 9860 0 1 /national-league/14 2 10040 1 0 /news/craywanderers3burgesshilltown0francisoneswallowdoesntmakeasummerexclusive 3 16540 0 0 /news/drmartens/eastern/folkestone/folkvbht070204.html 1 0 0 0 /news/dealvcray011103.html 1 0 0 0 /news/551bc5dbc6021 3 12545 0 0 /news/UKGovernmentStatement240920 3 20216 0 0 /news/551a931e5d7d8 4 20538 0 0 /news/itwouldbetheclubsdreamtogetintotheplay-offssaysthamesmeadtownbosskeithmcmahon 2 11166 0 0 /news/wevenotthrowninthetowelsayscosgrove 1 4702 0 0 /news/8thmay04.html 2 0 1 0 /news/croydon020418 2 6452 0 0 /news/551a97b201d0f 1 4197 0 0 /news/bridon170915 3 10701 0 0 /news/greenwich030217 1 4054 0 0 /news/deal270718 3 11738 0 0 /news/551bc5e44de7c 1 3295 0 0 /news/tunbknap170919 4 41476 0 0 /news/bromley070618 3 13368 0 0 /news/kentleague/cray/crayvhoddlsc011003.html 1 0 0 0 /news/margatesyoungstersputpentopaper 2 6349 0 0 /news/iexpectmyplayerstolookafterthemselvessayscraybossianjenkins 2 11058 0 0 /news/ramsgateladies3woodstockpark1 4 14070 0 0 /news/enfieldtown3-1margate-itwasntourdaytodayadmitsterrybrown 2 15330 0 0 /news/ebbsfleetunited2-1stalybridgeceltic-fleetkeeponehandonthetrophy 2 22302 1 1 /news/fourwinswillkeepusupsaysbromleycoachneilsmith 2 8772 0 0 /news/doversweekofdestinywewontliedownanddieagainstterrorssayschatsboss-exclusive 1 5470 0 1 /news/soccershorts220519 4 19054 0 0 /news/elmstead030217 3 10317 0 0 /news/margatevaldershot120803.html 2 0 0 0 /news/ashfshep100416 9 143131 2 3 /news/glebe2105217 3 13230 0 0 /news/erithholmlew221015 3 12447 0 0 /news/dealmarg080717 4 39986 0 0 /news/551bc5dd868b5 3 11792 0 0 /news/birchallturnsdownfull-timeofferstosignforhessenthaler 1 4249 0 0 /news/ksports280218 4 18754 0 0 /news/ireallyreallytrulybelieveweregoingtostayupsaysmikepaye 2 9489 0 0 /news/21stjuly05.html 1 0 0 0 /news/551bc5de5c1c0 1 3365 0 0 /news/551bc5e37a082 1 3697 0 0 /news/everyoneisupforourtriptosalisburysaysdoverathleticbosschriskinnear 2 7350 0 0 /news/551a97b23c140 2 17350 1 1 /news/bathcity4-0sittingbourne 2 8245 0 0 /news/8thaug04.html 1 0 0 0 /news/wewontgivethistrophyuplightlyinsistshythetownbossscottporter 3 12727 0 0 /news/551bc5dedc57e 3 13127 0 0 /news/wellingfazakerley051215 4 20290 0 0 /news/mehmetrekindleshisloveaffairwithfisherathletic 1 3843 0 0 /news/beckenhamtown1leatherhead2 4 16968 0 0 /news/crowborough290616 3 10293 0 0 /news/sittingbourne161020 3 12239 0 0 /news/theroadtowembleyrevisedfacupsecondqualifyingrounddraw 1 3060 0 0 /news/bromley301019 3 15473 0 0 /kent-invicta-league/8 5 40884 1 1 /archive-2006-2014/100 1 4976 0 1 /news/millwalllionesses0-0doncasterroversbelles-imdelightedwiththepointsaysalbertokurti 4 32554 1 0 /news/6thoct03.html 2 0 0 0 /news/afcsudbury0-0ramsgateramswon5-4onpensramsgatesbiggestandbestnightsayschairman 1 7770 0 0 /news/maidstone260705.html 2 0 0 0 /news/applicantsforchathamvacancyhavebeenremarkablyhigh 2 6794 0 0 /news/551a9c0ece399 3 13713 0 0 /news/welling150617 2 6952 0 0 /news/ramsgateunveiljustinluchfordastheirnewmanager 2 6595 0 0 /news/championsdoverathleticwinpromotionandchairmanvowswereonourwayback 1 4010 0 0 /news/sladegreenjobisupforgrabssayscaretakermalin 2 10765 0 0 /news/kentseniorcupfinal020504.html 2 0 0 0 /news/resultsnovember2012 3 25409 0 0 /news/tonbridgeangels5-1eastbourneborough-itsthebestweveplayedsaystommywarrilow 1 7482 0 0 /news/15thjuly05.html 3 0 0 0 /news/phoecray280717 3 32997 0 0 /news/551bc99bb8b74 1 6006 0 0 /news/wehavetodriveforwardandfinishintheplay-offssayswellingunitedbossjamieday 1 3878 0 0 /news/tunbridgewells1-0vcdathletic-cableshocksthetitlefavourites 1 6487 0 0 /news/chathamtown290916 2 6341 0 0 /news/weneedtoplaymoreofthefootballwerecapableofsaysfolkestoneinvictabossneilcugley 3 12732 0 0 /news/shorts290515 4 18181 0 0 /news/hessenthalerclosesinondeals 1 3583 0 0 /news/gravesham090718 3 9351 0 0 /news/greenwich061218 3 13590 0 0 /archive-2006-2014/38 1 4842 0 0 /news/551bc99d68788 4 51948 0 1 /news/ithinkmostteamswillfearcomingtoourgroundsaysfavershamtownskipperjohnscarborough 3 15367 0 0 /assets/css/ 8 4339 0 0 /news/bromley3-1craywanderers-icantwaittogetstartedsaysjenkins 2 10409 0 0 /news/tozercontractsswinefluinibiza 1 4676 0 0 /news/wivenhoetown1sittingbourne0 1 4184 0 0 /news/551a979a598f6 1 4674 0 0 /news/dartfordcoachinvitesgoalkeeperstobattleitout-exclusive 1 4400 0 0 /news/ryman/bromley/bromvtonb270104.html 1 0 0 0 /news/sittingbourne3-1croydonathletic 1 4751 0 0 /news/justiceasfathrowouttrophycheatshiston 2 8023 0 0 /news/wemustimproveinbothpenaltyboxessaysyorath 1 3406 0 0 /news/bromleians270918 3 13847 0 0 /news/551bc5db3fefd 4 14262 0 0 /news/ryman/bromley/24thoct03.html 1 0 0 0 /news/kentleague/tunbridgewells/17thjuly03.html 2 0 0 0 /news/braintree271104.html 2 0 0 0 /news/drmartens/eastern/tonbridge/16thnov04.html 1 0 0 0 /news/10thaug05.html 2 0 0 0 /news/sevenoaksinacupfinalwouldbemiraculoussaysjones 2 9577 0 0 /news/pattersonreservesmustremainpatient 1 4656 0 0 /news/lordswood191115 3 15300 0 0 /folkestone-2003-2006/3 4 12417 0 0 /news/horsash030519 6 52472 1 0 /assets/select2/dist/css/ 5 1872 0 0 /news/551bc5de1d25f 1 3253 0 0 /news/soccershortsownerstomeetdulwichhamletfansoverstadiumdevelopment 4 28434 0 0 /news/551bc99e4fd4f 1 8841 0 0 /news/phoenixsports3-0holmesdale-clubshardworkhasbeenpaidoffsayssteveoboyle 1 10130 0 0 /news/cray040805.html 1 0 0 0 /news/wellwinifweplaywellatwaltoncasualssaysfavershamassistantclivewalker 1 3828 0 0 /news/drmartens/premier/dover/dovervfolk170204.html 1 0 0 0 /tier-football 78 363625 5 17 /news/towewell090920 5 62207 0 0 /news/tunbridgewells3-4erithtown-goodsidesfindwaysofwinningsaystonyrussell 1 8997 0 0 /news/551a9c0e51e3e 1 3076 0 0 /news/551a9250216d7 2 8178 0 0 /news/lovellgivessquadmembersachancetoimpress-exclusive 1 4446 0 0 /news/drmartens/eastern/sittingbourne/ashford091104.html 1 0 0 0 /thamesmead-2003-2006/3 2 5762 0 0 /news/hollcray050419 5 48062 1 0 /isthmian-league/38 4 19244 0 0 /news/onemorewinwillmaintainourstatuspredictscugley 2 9658 0 1 /news/551bc5df67755 1 4582 0 0 /news/wewouldlovetogothroughtothenextroundsaysdartfordbosstonyburman 1 4701 0 0 /news/backingboroughtowembleywemustconcentrateonthejobinhandsaysmalin-exclusive 2 11538 0 0 /news/formermanchesterunitedstrikersignsforkentleaguecroydon-exclusive 3 11626 0 0 /news/myambitionistoprogressmycoachingcareerashighasitwilltakemesayswillgraham 3 13617 0 0 /news/matchreportslilywhitessmashtenpastbengal 1 9477 0 0 /news/14thoct05.html 2 0 0 0 /news/11thmar04.html 2 0 0 0 /news/imsurprisedno-onescomeinforandypughsaysbaffledwellingbossjamieday 1 4295 0 0 /news/27thmar05.html 2 0 0 0 /news/551a96774afc2 1 5897 0 0 /news/crowborough270117 1 3491 0 0 /news/bromleyaresingingintherainastheygoelevenpointsclear 1 4400 0 0 /news/canterbury080617 2 7385 0 0 /news/551bc5e4a3424 1 5267 0 0 /news/everyonesfullyawarewhattheprizeissaystunbridgewellsbossmartinlarkin 2 9920 0 0 /news/hollands&blair130920 5 23452 1 1 /news/hornchurch120305.html 2 0 0 0 /news/crowborough020719 3 17559 0 0 /news/thebiggertheyarethehardertheyfall 3 10499 0 0 /archive-2006-2014/265 2 8378 0 0 /news/ireallywanttogetourseasongoingsaystonbridgeangelsbosstommywarrilow 2 9377 0 0 /news/hugheswantstobowlthemover 1 4075 0 0 /news/wevejustgottoputanotherruntogethersaysmaidstoneunitedbossjaysaunders 1 4641 0 0 /archive-2006-2014/25 3 15349 0 0 /news/pleasedosomethingfortheseteamsthatarestrugglingmacraetellsfa 1 5778 1 0 /news/gillsold110516 4 11586 0 0 /news/wethriveonbeingtheunderdogssayshythetownbossscottporter 1 5073 0 0 /news/pennockpraisesteamfortengameunbeatenrun 1 3363 0 0 /assets/smartmenus/libs/demo-assets/shjs/ 1 385 0 0 /news/erithtown180915 4 13994 0 0 /news/bromley250318 4 21769 0 0 /news/keithmcmahonbringsryanbriggstobaylissavenue 1 3436 0 0 /news/doverreadyforonefinalpush 3 9944 0 0 /news/matchreportsderesunveildimmocksigning 3 39338 1 2 /news/j'darcy260804.html 1 0 0 0 /news/crockenhill070916 4 18448 0 1 /news/551a9c0edbed9 3 13557 0 0 /news/thefleetatwembleymywembleyexperienceschangedmylifereflectsgarystevens-exclusive 1 5573 0 0 /news/dartsareflyingreportssawyer-exclusive 1 4411 0 0 /news/thesykochallenge-update 2 6258 0 0 /news/facupthirdrounddrawnoglamourtieforheroesdoverathletic 1 5168 0 0 /news/ilford111005.html 1 0 0 0 /news/starsturnoutforgoalkeepinglegendrogerstestimonialmatch 1 4019 0 0 /news/livecoverageedgwaretown2-1dartford-recalldartstitlewinningday 1 9172 0 0 /news/milespleasedwithopeningdaypoint-exclusive 2 9597 0 0 /thamesmead-2003-2006/2 2 5988 0 0 /news/wellingunited1-1dartford-theresnoblameonleeclarkesayswingsbossjamieday 1 6752 0 0 /news/551a9c0e3530f 1 3225 0 0 /news/thefacupfirstrounddrawtherewillbeamassivecrowdagainstdartfordsaysrobswaine 2 9460 0 0 /news/ramsgate100816 2 6920 0 0 /news/thefutureoftheclubisbrightinsistscriticisedwellsboss-exclusiveinterviews 3 15074 0 0 /news/folkestoneinvictabossneilcugleysnapsupjakebeecroftfromwhitstabletown 6 21445 0 0 /news/longlane100516 2 9902 0 0 /news/551a96dc9a5df 2 7840 0 0 /news/werenotgoingtolookforquickfixessayssuttonathleticbossjamescollins 5 21395 0 0 /news/werenotfeelinganypressuresayscugley 1 4153 0 0 /news/drmartens/eastern/dartford/3rdnov04.html 1 0 0 0 /news/lowkeyleaguecupisnothighontheagendaforlocalrivals 3 12950 0 0 /southern-counties-east-football-league/36 5 24537 0 0 /news/NationalLeagueStatement010221 5 26412 1 1 /folkestone-2003-2006/2 4 12398 0 0 /news/551bc5e7c41b2 2 10508 0 0 /news/rochwhit250418 2 20694 0 1 /news/thurrockvbfcfac141003.html 1 0 0 0 /news/maidstone150619 3 11811 0 0 /news/tonbhyth071117 4 38786 0 0 /news/craywands160716 1 3686 0 0 /news/cablebrothersreturntothamesmead 5 14674 0 0 /news/thefacaremoreaboutenglandthantherestofusfumesfolkestoneinvictasecretary 1 4359 0 1 /news/551bc5dc872c0 2 8260 0 0 /news/kentleague/thamesmead/20thjuly03.html 2 0 0 0 /news/folkestone220218 1 5602 0 0 /news/dartsbosstonyburmanrelishingfirstfleetclashfor18years 1 4665 0 0 /news/croydon070319 5 17523 0 0 /news/givetheramsthesupporttheydeserve 4 14762 0 0 /news/551a9c0ed8c50 3 12123 0 0 /news/beckinghamsshockresignationhasrockedusadmitsthurgood 1 4483 0 0 /news/foresthillpark161118 4 14599 0 0 /news/erithandbelvedere270820 3 13216 0 0 /news/collier120615 6 44184 2 2 /news/Resultsmarch2020 3 18653 0 0 /news/enfield230805.html 1 0 0 0 /news/hytheboundshearerscoopshat-trickofawards 1 3461 0 0 /news/rymanreportsmargatereclaimtopspot 3 25888 0 0 /news/chathamunveildoublesigning 3 9388 0 0 /news/551a96dbbaa2b 1 6189 0 0 /news/551a96dca59d1 2 8577 0 0 /news/shorts050615 7 96190 4 4 /news/drmartens/eastern/dartford/8thaug04.html 1 0 0 0 /news/kentleague/maidstone/11thdec03.html 1 0 0 0 /news/Soccershorts190517 4 14598 0 0 /news/news/tonbridge%20invicta%20030104.html 1 0 0 0 /news/551a9c9247459 3 20398 0 0 /news/oldbroms260317 3 17570 0 0 /news/551bc5de1062d 1 3378 0 0 /news/itwasfunknockingtonbridgeoutsayshadden 6 27944 3 3 /news/favershamtown1-1merstham-icanseeusgettingbetterandstrongersaysrayturner 3 27144 0 0 /news/soccershortsrhyslawsonre-signsforhernebay 1 5962 0 0 /news/everyonehereisdesperatetogoupandwewillbetryinghardtoachievethatsayschriskinnear 2 8270 0 0 /news/margate011017 2 7646 0 0 /news/craybrig240215 6 103200 3 3 /news/thebigkickoffdolbyfacesselectionheadacheforswansopener 1 4428 0 0 /tonbridge-2003-2006/2 2 6138 0 0 /news/551bc5dee9569 2 14628 0 0 /news/favershamtownunveilstadiumsponsorshipdealwithlocalbrewery 1 5025 0 0 /news/19thmay04.html 1 0 0 0 /news/metcalfproudoflordswoodstrainingfacilities 2 9914 0 1 /news/theweekahead-9 2 7168 0 0 /news/folkestoneinvicta0-3ramsgate 2 11722 0 0 /news/tonbridge021015 4 15869 0 0 /news/wingate230405.html 2 0 0 0 /news/mcmahonrelisheskentvasederby-exclusive 1 4018 0 0 /news/ebelvwhit250715 5 73727 1 1 /news/wemustwinallthreeofthemsaysbromleydefenderliamharwood 1 4854 0 0 /news/hythram160319 5 58755 0 0 /news/craywands240616 1 4683 0 0 /news/kentleague/greenwich/greenwich.html 1 0 0 0 /news/crayvsevenoaks200903.html 1 0 0 0 /news/lovellstartsnewbuildingjobatashfordtown 2 9070 0 0 /news/scottporterresignsafterdisagreementovernextseasonsplayingbudget 4 15846 0 0 /news/551a9250ad419 2 8325 0 0 /news/fishmill120719 6 51188 0 0 /news/afewwinswilldoeveryoneaworldofgoodsaystonbridgeangelsbosstommywarrilow 3 12818 0 0 /news/551bc5dc9cbc7 2 8208 0 0 /news/troubledfishergivenstayofexecutionandmayfinishtheseason 2 6049 0 0 /news/idontthinkwegetenoughcreditsayswellingunitedbossjamieday 3 13351 0 0 /news/folkestone300916 2 8366 0 0 /news/fisher070718 2 7400 0 0 /news/welling250118 3 11721 0 0 /national-league/34 2 8780 0 0 /news/rymanreports-1 3 37480 1 1 /news/ryman/bromley/tilbury240704.html 1 0 0 0 /news/fcelmstead2-1oldroan-theclubsreallybuzzingsayselmsteadbossfabiorossi 4 37406 0 0 /news/wedeservetobewherewearesaystable-toppingseager 1 4553 0 0 /news/wellingreleasefour 1 2710 0 0 /news/kentseniorcupquarter-finalexclusivepreviews 3 23846 0 1 /news/551a99e497b9a 3 15657 0 0 /news/peoplewanttocomeandplayforlordswoodnowsaysguest 1 4692 0 0 /news/551a924fe8a30 1 3217 0 0 /news/wellingunited0bromley7exclusiveinterviews 4 38864 0 1 /news/greenways060718 4 15620 1 1 /news/ithinktheplayerswillbehurtingandtheyllwanttoputitrightagainstwhyteleafesaysclews 1 4621 0 0 /news/epsom&ewellstatement111020 3 10576 0 0 /news/hythetownmakelloydblackmantheirfirstsummersigning 1 4494 0 0 /news/17thapr05.html 2 0 1 0 /news/theroadtowembleyhytherelishingreturntothebig-stage-exclusive 1 5231 0 0 /news/kentleague/beckenham/27thoct03.html 1 0 0 0 /news/551bc5e1d6673 2 8090 0 0 /news/fisher2-2ashfordunited-wevegottolickourwoundssaysjohnovard 2 21578 0 0 /news/dartford220518 4 16577 0 0 /news/kentfootballunited220219 2 9044 0 0 /news/itshurtmetostopplayingformycountrysaysashleycole 3 10221 0 0 /news/beck191115 3 11028 0 0 /news/bromley1-0worcestercity-weredelightedwereinthehatsaysbromleybossmarkgoldberg 3 30646 0 0 /news/28thaug05.html 2 0 0 0 /news/sittvchar170704.html 2 0 0 0 /news/thamesmead261105.html 2 0 0 0 /news/551a96dc559d4 4 23126 0 0 /tonbridge-2003-2006 12 36314 0 0 /news/hythetown4-0eastbournetown-porterwerescoringgoalsforfun 3 41917 2 0 /news/whyteleafe181005.html 2 0 0 0 /news/fordsoptionslimitedduetoopeningdayinjuries 1 4516 0 0 /news/sittingbourne0wivenhoetown2 2 9418 0 0 /news/rusthall150320 3 14602 0 0 /news/551a956c56c51 4 17502 0 0 /news/visitingsideswillraisetheirgamesatprincesparkwarnsburman 2 8075 0 0 /Home/GetInitSource 1 3457 0 0 /news/1stmar04.html 1 0 0 0 /assets/smartmenus/css/ 8 3366 0 0 /news/bidforitemsinourshop 2 5354 0 0 /news/bromdove171017 1 9928 0 0 /news/banburyvsitt111003.html 2 0 0 0 /news/kentleague/sladegreen/sladegreen.html 1 0 0 0 /news/30thDec2003.html 1 0 0 0 /news/28thjan04.html 1 0 0 0 /news/hayesdiplock140316 4 20070 0 0 /news/thebigkickoffwemustavoidopeningdaydefeatsaysmiles-exclusive 1 3888 0 0 /news/30thmay05.html 1 0 0 0 /news/richardlawsonstepsdownafter25yearsasramsgatechairman 6 29906 0 0 /news/thisisabigjobturningtheclubsfortunesandreputationaroundsaysmattlonghurst 4 18206 0 0 /news/maidstoneunited0-2carshaltonathletic-lackofbeliefisworryingadmitshume 1 4171 0 0 /news/fishlord180317 1 11718 0 0 /news/ryman/bromley/15thaug03.html 1 0 0 0 /news/osbornegoeswithhisheadheldhigh-burman 1 5344 0 0 /news/beingunderdogsthepressurewillbewithbromleytowinsaystonbrigeangelsbossstevemckimm 3 13246 0 0 /news/resultsmarch2008 5 28455 1 2 /news/westartasunderdogsagainstastrongbeckenhamsidesaysfleetleisurebossleerichmond 2 10812 0 0 /news/551a979821640 1 3728 0 0 /news/rymanreportssaturday9thdecember2006 3 19883 0 0 /assets/ckeditor/skins/icy_orange/images/ 1 459 0 0 /news/551a97b25403d 1 4037 0 0 /news/rivalmanagerscondemnhillingdonovertheiramaterishantics 1 4551 0 0 /news/cray091104.html 2 0 0 0 /news/webelieveinplayingfootballinsistskentleaguesbottomside 1 3383 0 0 /news/corinthian070116 2 7354 0 0 /news/551bc5e32e879 3 14045 0 0 /news/walton230805.html 1 0 0 0 /news/551a95b446f65 2 8250 0 0 /news/drmartens/eastern/tonbridge/17thaug04.html 1 0 0 0 /news/basingstoketown2-2dartford-weredisappointedcomingawaywithonlyonepointadmitsburman 1 6548 0 0 /news/dartford1-0wellingunited-wellendeavourtocatchwellingsaysdartsbosstonyburman 1 5798 0 0 /news/bromley020717 1 3839 0 0 /news/bridonropes050619 4 12984 0 0 /news/wealdstone091205.html 2 0 0 0 /news/weretryingtomakeoxfordroadourhomesayssevenacresidcupbossleehill 1 4972 0 0 /news/phoetunw280115 2 16992 0 0 /news/tonbridge091117 3 14525 0 1 /news/kfu171116 3 11442 0 0 /news/thurrock0-1maidstoneunited-ahwanscreamergetsstonesofftowinningstart 1 3533 0 0 /news/ETU270805.html 1 0 0 0 /news/tunbridgewells020715 4 19401 0 0 /news/greenwich210518 1 3025 0 0 /southern-counties-east-football-league/35 3 14493 0 0 /news/harlow261105.html 2 0 0 0 /news/551a9c91ede44 2 10366 0 0 /news/hessenthalerexpectsfireworksagainstarch-rivals 2 8845 0 0 /news/vcdathletic2-2croydon 3 16406 0 0 /news/martinfordquitsfishertotakechargeoferithbelvederewithchriscosgrove 6 20418 0 1 /news/obviouslymanagementandcoachingiswhatiwanttodosaysdual-registeredtonydolby 1 5503 1 0 /news/551bc5dc26b4b 2 9120 0 0 /news/chatvfolk200304.html 2 0 0 0 /news/craymers120918 3 29370 0 0 /news/14jan04.html 1 0 0 0 /news/stonescoachwehavethesquadtopushforthetitle 3 10058 0 0 /news/dolbywereinaprimeposition 2 7550 0 0 /news/551bc5e5dc00a 3 23233 0 1 /news/551a95b4747b8 2 8845 0 0 /news/ourhomeformdrivesmemadadmitsdoverathleticbossmartinhayes 1 3968 0 0 /news/conference/margate/15thoct04.html 1 0 0 0 /news/lovelllookingforreactionafterback-to-backdefeats 2 7585 0 1 /news/551a9798ad395 4 27258 0 0 /news/itwouldbeadreamtogetintotheplay-offssaysmcmahon 1 4307 0 0 /news/farnboroughobg1-8bromley-idliketoseemoreinterestinmyplayerssaysbromleybossdryland 3 31238 0 0 /news/kentleague/sladegreen/sladevlord170104.html 1 0 0 0 /news/gillingham140121 3 10509 1 0 /news/551a956c0f456 1 5338 0 0 /news/ifyougetaruninthefacupitsolveseverythingsaysfolkestoneinvictabossneilcugley 4 18604 0 0 /news/itsagreatopportunitytogetsomesilverwarefortheclubsaysashfordassistantjohnovard 4 16230 0 0 /news/wevegotachancetoputourselvesintherecordbookssaysdoverathleticbossmartinhayes 2 8780 0 0 /news/hollands171116 2 7048 0 0 /news/hollands040816 2 7746 0 0 /news/thishasbeenaveryharddecisiontoleavehernebayforhastingssayshugolangton 2 8742 0 0 /news/NationalLeague170920 2 7280 0 0 /news/rymanleaguecupdrawfivekentderbiesinchampionshipmanagercupdraw 2 7149 0 1 /news/drmartens/eastern/tonbridge/29thjune03.html 2 0 0 0 /news/doverunveilloansigningfrombarnet 1 3354 0 0 /news/Harlow210804.html 2 0 0 0 /news/tonbridge210617 2 6444 0 0 /news/drmartens/eastern/tonbridge/26thjune03.html 2 0 0 0 /news/551a9c92962aa 1 5433 0 0 /news/weletdolbydownadmitsskippergooding-exclusive 2 10110 0 0 /news/wereoncoursetobeatthedropinsistswhitstablechairman-exclusive 1 4742 0 0 /news/corinthian100120 2 8300 0 0 /news/551bc5dd91be7 3 22294 1 1 /news/ourgateswillbefineinthenorthsaysfoley 1 4546 0 1 /news/wehavetogetbackintoplay-offhuntsayspennock 1 3639 0 0 /news/tonbridgeangels1-1canveyisland-ourperformanceisntacceptable-warrilow 2 12863 0 0 /news/kentleagueclubsstruggletomakeendsmeetsayslarkin 1 5221 0 0 /news/3rdJuly05A.html 1 0 0 0 /news/idbedisappointedifwedontgetaplay-offspotsayscraywanderersbossianjenkins 1 5094 1 0 /news/othernews/MUSHDec2004.html 1 0 0 0 /news/kentleague/beckenham/sladegreen180904.html 1 0 0 0 /news/suttonathleticunveilstalwartbenyoungastheirnewmanager 4 13590 0 0 /news/soccershortsfleetpasesideplayinmaddamstestimonialmatch 2 10452 0 0 /news/thedressingroomiffullofconfidenceandsmilingfacessayscraywanderersbossianjenkins 1 4704 0 1 /news/folkestonesignbenjaminfromwellingunited 2 8396 0 0 /news/staines081005.html 2 0 0 0 /news/favershamtown1-0afcsudbury-wereraisingtheprofileoftheclubsaysrayturner 1 7015 0 0 /assets/select2/tests/options/deprecated.html 1 242 0 0 /news/westaucklandtown2-1hernebay-imdisappointedthatwerenotgoingtoplayatwembley-halsey 4 34573 0 1 /news/551bc5e8712fd 2 7568 0 0 /news/thecloseryougettothatfirstroundthebetteritbecomessaysmargatejoint-bosssimonosborn 6 27182 0 0 /archive-2006-2014/214 2 9089 1 0 /news/daishbringssouthafricandefendertostonebridgeroad 2 6423 0 0 /news/igenerallythinktheabilitythatwevegotinthesquadwecandowellsayssimonaustin 2 8276 0 0 /news/lordbear301216 2 7753 0 0 /news/551bc5e3ca021 1 5060 0 0 /assets/images/third-party/Thumbs.db 1 8704 0 0 /news/ramsgate171116 1 3464 0 0 /news/kentderbiesgiverymanleagueaddedspice 2 12352 0 0 /news/craywands220218 2 7957 0 0 /news/rothwellvsittingbourne20903.html 2 0 0 0 /news/kentleaguenetnewsponsor 1 3325 0 0 /news/vcd130717 1 3878 0 0 /news/ebbsfleetunited1-0woking-daishpraiseshiswinningcrewe 2 12350 0 0 /news/werenotgoingtokickpeoplesaysrusthallbossgarysharman 5 18080 1 1 /news/hernebay2-2westaucklandtown-wemakelifehardforourselvesadmitssimonhalsey 1 9438 0 0 /news/551bc99dae254 1 5801 0 0 /isthmian-league/18 8 39894 0 0 /news/551a95b390b05 4 26706 0 0 /news/FAStatement170720 3 9606 0 1 /archive-2006-2014/120 4 19097 0 0 /news/specialofferwebsitesponsorshipupforgrabs 1 2837 0 0 /news/erithbelvedere2dealtown1 3 11495 0 0 /news/551a9b482aab6 4 14933 0 1 /news/bromalde300121 10 78687 1 1 /news/theweekahead 5 21981 0 0 /bromley-2003-2006/ 1 3055 0 0 /news/551a967786a96 1 4022 0 0 /news/dartford1-1sittingbourne-latesherwoodstrikestunswastefuldarts 2 13660 0 0 /news/drmartens/eastern/folkestone/stamvfolk240104.html 1 0 0 0 /news/drmartens/eastern/sittingbourne/sittvchat281003.html 1 0 0 0 /news/vcd250816 2 7912 1 0 /news/sportingbengal0-1vcdathletic-weturnedupwiththewrongmentalityadmitsrickybennett 1 6645 0 0 /news/ourdaysarenumberedatsittingbourneadmitsbossgaryabbott 1 4521 0 0 /assets/images/social/Thumbs.db 1 8704 0 0 /news/fishcrow140915 4 41698 0 0 /news/wemuststayintouchwiththeleaderssaysjenkins 1 4851 0 0 /news/falanaillmakeadecisionwithinthenextweek-exclusiveinterview 7 33941 1 1 /news/kinchwillstrengthenmymidfieldsaysjenkins 1 3824 0 0 /news/bromley151219 2 9114 0 0 /news/gravesendnorthfleet1accringtonstanley3 3 16425 1 1 /news/ifweregoingtostayaroundtheplay-offswehavetolooktodoreasonablywellthismonth-day 1 5454 0 0 /news/551a97982b2c8 1 6586 0 0 /news/drmartens/premier/dover/dover.html 3 0 1 1 /news/551bc5e8dea7d 3 13595 0 0 /news/551bc5daed878 2 8672 0 0 /news/margate130617 2 10020 0 0 /news/franniecollinheadsgoalscoringchartsinkent 5 17696 0 0 /news/russellvcdcray040515 6 29072 1 0 /news/kentleague/sladegreen/Hamble250904.html 1 0 0 0 /news/dartford2-2folkestoneinvictaaetdartfordwin5-3onpenalties 2 10752 0 0 /news/drmartens/eastern/folkestone/newpvfolk060304.html 1 0 0 0 /news/cankinnearmakeitfouroutoffour 5 47239 0 0 /news/hernebay101218 3 12891 0 0 /news/newownersploughinhalfamillionquidintoconferenceboundashfordtown-exclusive 1 6421 0 0 /news/erithtown300817 1 3542 0 0 /news/glebe210321 16 59736 4 5 /news/conference/margate/margate.html 2 0 0 0 /news/whitstabletownreceive20applicationsforvacantmanagersjob 1 3914 0 1 /news/ryman/bromley/26thjune03.html 2 0 0 0 /news/clubdoesnotgenerateenoughmoneytopayplayersrevealsangelschief 1 3949 0 0 /news/551bc99c3aad5 1 4569 0 0 /news/551bc5e3ab125 1 4420 0 0 /news/551a956c32659 3 13554 0 0 /news/butlerpreparesforhishardestgameinchargeofmargate 2 9157 0 0 /news/crayave080915 3 29382 0 0 /news/551a9250254ae 1 6339 0 0 /news/fleetappointnewchairman-daishbeginstorebuildhissquad 2 8830 0 0 /news/margate2-2dartford-kentsidesdrawlittlecomfortwithapointapiece 2 13572 1 0 /news/hythetown281020 4 14620 0 0 /news/tundeaderonmustaysfaithfultocrayvalley 6 20691 0 0 /news/dartford120317 2 8423 0 0 /news/stonesexplainhiscocksnewrole 4 14367 0 0 /news/snodland080917 4 15358 0 0 /news/doverathletic3-2craywanderers 2 8474 0 0 /news/erithbelv290818 3 9651 0 0 /news/bromley100120 2 8182 0 0 /news/othernews/gotravelkentleaguetables170304.html 1 0 0 0 /news/rochester080718 4 15120 0 0 /news/collholl020920 4 34592 0 1 /news/doverathleticacceptthirdbidforstarstrikeradambirchall 1 3302 0 0 /news/margatelaunchshareissuetohelppaytaxmandebt 2 7997 0 0 /news/ineedbigbuckstobringin20-goalstrikersayshuntley 1 3909 0 0 /news/551bc5e0ab8c8 1 3847 0 0 /news/wereconfidentgoingintopolicevisitsayslovell 2 7433 0 0 /news/wereatrockbottomadmitserithtownbosstonyrussell 1 4099 0 0 /news/daishkeelingwilladdadimensiontoourplay 6 20745 0 0 /archive-2006-2014/176 2 8853 0 0 /news/drmartens/eastern/tonbridge/12thaug04.html 1 0 0 0 /news/craywanderers0-1lewes-wellgetintotheplay-offsifwewinallthreesaysianjenkins 1 7588 0 0 /news/werestillaimingfortheplayoffsinsistsward-exclusive 1 4361 0 0 /news/burmanfacupdefeatletdowntheclub 2 7584 0 0 /news/551a956cecccb 1 5050 0 0 /news/gillsold190516 4 35054 0 0 /isthmian-league/32 9 43548 0 0 /news/551bc5e44abc3 1 3917 0 0 /news/13thoct04.html 1 0 0 0 /news/concordwontlookforwardtocomingtoebbsfleetsaysstevebrown 2 8025 0 0 /news/tunbridgewells4-2tonbridgeangelsgibbonsafewofourguyslookedutterlyterrified 5 32430 0 0 /news/wevefinishedourseasononahighsayshythetownbossscottporter 1 3686 0 0 /news/brisbrom101119 5 47787 0 0 /news/drmartens/premier/dover/21stoct04.html 1 0 0 0 /news/dartvburn010504.html 1 0 0 0 /news/551a979af22b3 2 9385 0 0 /news/551a9799117a9 2 9990 0 0 /news/seagersheroessecurerymanleaguestatus 2 7099 0 0 /isthmian-league/26 7 32845 0 0 /isthmian-league/49 10 56404 2 1 /news/sittingbournevwhyteleafe130903.html 2 0 0 0 /news/turnersettosigndealtostaywithramsgate 2 7596 0 0 /news/pennockrelishestoughtestfromcharltonsstars-exclusive 5 22907 0 0 /news/551a956b69570 1 5206 0 0 /news/kentleague/sladegreen/chessingtonvsladefr260703.html 2 0 0 0 /news/lordswood201218 4 15381 0 0 /news/afccroydonathletic030120 4 17200 0 0 /news/551a97b281dfc 1 4804 0 0 /news/wegotohassocksfullofconfidenceafterholmesdalehidingsayscorinthianbossjamescollins 2 7292 0 0 /assets/ckeditor/lang/ 5 1780 0 0 /news/greenwich100616 4 16241 0 0 /news/twenty-fivegoalstrikeralfiemaysignsforconferencesouthfarnborough 3 16637 0 0 /news/fisher140716 5 22802 0 1 /news/suttbill220716 4 35320 0 0 /news/werekeepingacertainlevelofperformanceeveryweeksaysdulwichhamletbossgavinrose 1 4210 0 0 /drmartens/eastern/sittingbourne/sittvchar170704.html 1 9950 1 1 /news/newbosssimonhalseykeepslordswoodmanagementteamtogether 6 20791 0 0 /news/kentleaguethamesmeadreceivepositivefeedbackafterrymaninspection-exclusive 2 15240 0 0 /news/15thjune04.html 1 0 0 0 /news/thefacupmeanstheworldtoussaysbromleymanagermarkgoldberg 5 21897 0 0 /news/wereconfidentwellgetoutoftherelegationzonesaysthamesmeadtownbosskeithmcmahon 2 8604 0 0 /news/stonesswoopforcharltonyouthcoach 1 3572 0 0 /news/teenagersgivemcmahonmoreoptions-exclusive 1 4330 0 0 /news/losingonourbigdaywasabitterpilltoswallowadmitsburman-exclusive 1 4877 0 0 /news/sheppey180817 1 4050 0 0 /news/bromley200718 3 12333 0 0 /news/ifitoldyouihaventbeendreamingofatriptoguernseyidbelyingsayskfubosssammacneil 2 12614 0 0 /news/doverathleticgothatextrainchtoclinchtitle 1 3659 0 0 /news/crayvtunb271203.html 2 0 0 0 /news/kentleague/beckenham/whitstable301004.html 1 0 0 0 /news/erithtown4-0holmesdale-weknowwehaventwonanythingadmitserithtownbosstonyrussell 1 8372 0 0 /news/holmesdale300916 4 16378 0 0 /news/drmartens/eastern/folkestone/slough201004.html 1 0 0 0 /news/corbyvfolk181003.html 2 0 0 0 /news/551bc5e21a88e 1 5422 0 0 /news/hernebay0-3charltonathletic-wejustcouldntlivewiththemadmitssimonhalsey 2 14684 0 0 /news/gillingham200615 2 14034 0 0 /news/551bc5e7ce7ba 2 8734 0 0 /news/iwanttodowellatthefleetinsistsdebolla 5 19838 0 0 /news/30thapr05.html 2 0 0 0 /news/beatingbenficawasjustamazingsayssevenoakstowncoachmickyhazard 2 6516 0 0 /news/crayvalley100319 4 18642 0 0 /news/cantknap121215 3 27918 0 0 /news/551a92505bffc 2 6652 0 0 /news/larkinconsignedtolosingstarcharliesharman 1 4097 0 0 /news/seveayle151019 2 19906 0 0 /news/551a956b9fb57 1 3195 0 0 /news/thingswillchangeatfarnboroughnextseasonsaysoldboysmanagerbyronbeard 4 19321 0 0 /news/craywands270817 2 8048 0 0 /news/wellgivecashkingsarunfortheirmoneyvowsabbott 1 4894 0 0 /news/coneyhallmanagershotdeadbeforetrainingsession 2 7917 0 0 /news/angelsdayofdestinyyoucantdoallthishardworkandthrowitallawayalexobrien 2 10644 0 0 /news/itallaboutusandwhatwedosaysangelsassistantalexobrien 3 11631 2 2 /news/suffolkshowdownthisisntthetitledecidersaysburman-exclusive 2 9670 0 0 /news/iwantawinninghabitsaysobrien 1 4587 1 0 /news/gillingham0-1norwichcity-iwanteddartfordacemcdonaldrevealsstimson 1 5950 0 0 /news/551bc5e2cbf33 1 3631 0 0 /news/551a99e5076aa 1 5204 0 0 /news/punjab230519 5 17565 0 0 /news/ashford270518 2 9474 0 0 /news/ultimatelytheplayersperformundermydirectiveandthebuckstopswithmeadmitssimonosborn 1 4314 0 0 /news/ebbsfleetunited2-1stevenageborough-daishpleasedwithshockhomewin 1 6308 0 0 /news/werepreparingfornextyearsayslarkin 2 8787 0 0 /news/551a97b2667b7 1 5501 0 0 /news/551bc99bf3551 2 9694 0 0 /news/iwasntgoingtochangemybeliefsandprinciples-justinluchford 2 10388 1 1 /news/tunbridgewells030715 7 36876 3 3 /archive-2006-2014/158 4 17916 0 1 /news/othernews/facup3.html 1 0 0 0 /news/tonbridgereserveteambossleighoptimisticwinningkentintermediatecup-exclusiveinterview 2 19566 2 2 /news/bromley3-2crystalpalace-ourplaywasthecreamonthetopsaysbromleybossmarkgoldberg 3 23568 0 0 /news/folkestonearebuzzingwithnewdirectorsatthehelm 1 7094 0 0 /news/margate4-1clevedontown-ithoughtwehandledthepressurewellsaysmargatebosssimonosborn 2 18941 0 0 /news/doverathleticbosschriskinnearisstilllearningabouthissquad 4 20289 0 0 /news/fcelmssct211016 4 47182 0 0 /news/favershamtownsearchfortheirlifemembers 6 23013 0 0 /news/foresthillpark080319 2 7672 0 0 /news/rymanpremplayoffs260415 4 20154 0 0 /news/kentleague/hythe/hythe.html 1 0 0 0 /news/dulwicharethefavourites-thepressureisonthemsayshythetownbossscottporter 2 8160 0 0 /news/othernews/17thjuly03.html 3 0 0 0 /news/17thmay05.html 1 0 0 0 /news/othernews/FixDec2004.html 1 0 0 0 /news/humewaryofangelscostlyfirepower 2 9982 0 0 /news/wewanttogetoutofthekentleaguesaysporter 2 10609 0 0 /news/fisher1-4bridonropes-ithinkitsaveryspecialnightfortheclubsaysproudbenkotey 5 49107 0 0 /news/whytetonb070715 3 14085 0 0 /news/youngstrikerfightsback 6 26691 0 0 /news/dartford020519 3 9870 0 0 /news/551bc5e8e4266 3 14402 0 0 /search 75 1907792 1 5 /news/551bc99c08ed2 2 8486 0 0 /news/ifwedontwinfingerswillbepointingatmesayssittingbournejoint-bossjimward 5 26270 0 1 /news/lyddtown281016 4 13306 0 0 /news/bearsted240416 3 12003 0 0 /news/wewillturnthecornervowsdack 1 3770 0 0 /news/551a931e98ce6 4 19053 0 0 /news/greenwich050818 3 11235 0 0 /news/theteamschuckingbigmoneyaroundaretheonesunderpressuresaysbromleycoachhugolangton 2 8535 0 0 /news/wereconcentratingontryingtowinthekentleaguesaysvcdathleticbossrickybennett 3 13943 0 0 /news/imlookingforagoodconfidentstartsayslyddtownbossdavejohncock 1 3973 0 0 /news/daishbolstershissquadwithloansigninghearn 2 6569 0 0 /news/551a9c92d9a37 1 4898 0 0 /news/kimbleslamsdismaldefenderduringcupshocker-exclusiveinterview 3 9674 0 0 /news/kentleague/lordswood/dealvlord230304.html 1 0 0 0 /news/bexfav140516 14 420489 7 9 /news/phoenixsports011119 2 7316 0 0 /news/westillhaveachancetoresurrectourseasonsayswarrilow 1 5581 0 0 /news/wevejustbeennowhereconsistentreallysaysfolkestoneinvictabossneilcugley 5 21345 0 0 /news/bromvstai041103.html 1 0 0 0 /news/fleetvigorouslyfightforbestdealforboroboundbostwick 2 6982 0 0 /news/vcdchic061020 3 31274 0 0 /news/wewanttoclaimthekentleaguedoublesayshythetownbossscottporter 1 5139 0 0 /news/whyteleafesnew3gpitchfailsitsfirsttestduetodrainagesystemfailure 3 13976 0 1 /news/551a97b06c6f2 1 3595 0 0 /news/cray090915 4 23241 0 0 /news/kentcountyleagueselectssquad 2 6497 0 0 /news/551a97b09c114 3 14169 0 0 /news/resultspreseason2015 4 33102 0 0 /archive-2006-2014/123 3 13873 0 0 /news/551bc5e60f203 1 3815 0 0 /news/othernews/26thoct03.html 1 0 0 0 /news/holmesdale031117 3 10095 0 0 /news/chatham250816 2 7867 0 0 /news/bromley070519 3 12657 0 0 /news/fcelmstead230715 6 57807 1 2 /news/551bc5e020a2a 3 14186 0 0 /news/551bc5da8a215 2 15210 0 0 /news/margate100818 4 13725 0 0 /news/16thnov04.html 1 0 0 0 /news/wellingunitedappointnewnumbertwo 2 5843 0 0 /news/stalbanscity2-2bromley-werebehindtargetatthemomentadmitsbromleybossmarkgoldberg 3 25391 0 0 /archive-2006-2014/138 2 9466 0 0 /news/dartford2-3woking-thetitleraceisnotoveryetinsistsdartfordbosstonyburman 1 6147 0 0 /news/burmancursinghissidesbadluck 1 5275 1 0 /news/deresfanssponsorshipdealisjusttheticket 2 8636 0 0 /news/othernews/fatrophy4thround.html 1 0 0 0 /news/walkervowstoendhisbarrenfacuphistory 2 6968 0 0 /news/crowborough280520 2 6536 0 0 /news/iwanttokeepasuccesfulsquadtogethersaysoconnell 1 4287 0 0 /news/osborniswelcomebackanytimesaysfrancis 1 4628 0 0 /news/ithinkweregoingtoproveafewpeoplewrongsaystonbridgeangelsbosstommywarrilow 1 4570 0 0 /news/ifeltfordealleakingtenaswevebeeninthatpositionbeforesayscorinthianbosstonysitford 1 5100 0 0 /news/itakeeverygameseriouslysaysramsboss-exclusive 3 31554 1 0 /news/551bc5e1f3943 2 13874 0 0 /news/551bc5dad6b34 2 7826 0 0 /news/loansigningapossibilityifconneallyfailsfitnesstest 1 4021 0 0 /news/drmartens/premier/dover/15thaug03.html 1 0 0 0 /news/fishersreturntorotherhithemovesastepcloser 1 5098 0 0 /news/sittingbournemeetwithcounciltodiscusstheirfuture 1 3812 0 0 /assets/uploads/signatures/ 4 1274 0 0 /news/lewesvbrom160304.html 1 0 0 0 /news/idehill301219 2 6506 0 0 /news/tonbridgeladies151015 4 15014 0 0 /news/crowborough210518 2 8445 0 1 /news/ebbsfleetunited2-2afcwimbledon-gutteddaishaskswheredidhegettheextratimefrom 1 7462 0 1 /archive-2006-2014/31 5 25893 0 0 /news/551bc5dcc84ef 1 3784 0 0 /news/551a9c93399c7 2 9430 0 0 /news/theseareexcitingtimesforphoenixsportssayschairmanandymortlock 1 3763 0 0 /news/wehavetorespondtoback-to-backdefeatssaysfavershamtownbossrayturner 1 3478 0 0 /news/craywanderers3molesey3exclusiveinterview 6 51883 2 2 /archive-2006-2014/82 1 4922 0 0 /news/snodlandtown070520 3 14228 0 0 /news/sittingbourne0-1dartford-handsupwelosttoagreatgoaladmitsabbott 2 14751 0 0 /news/551bc5e6ee423 3 16754 0 0 /news/21stjune04.html 2 0 0 0 /news/therealdeal-wembleymanuscriptchapters1-10 8 275072 1 2 /news/ashfordtownp-pwaltoncasuals 1 2638 0 0 /news/drmartens/eastern/dartford/27thnov03.html 1 0 0 0 /news/keisteriwantsuccessatdoverathletic 1 4223 0 0 /news/wevegotagroupofplayerswhogiveeverythingthattheyvegotfortheclubsaysjimward 3 12943 0 0 /news/kentleague/lordswood/lordvseve061203.html 1 0 0 0 /news/weshoulddefinatelybesittinginthetopfivesayslordswoodbossjasonlillis 3 11297 0 0 /archive-2006-2014/64 2 10162 0 0 /news/stonesunveiltheirsixthsummersigning 2 6648 0 0 /news/hythewillcontinuetobuildforthefutureduringthisperiodoftransitionsayspaulmarkland 4 16737 0 0 /news/stonesinsisttheywillremainathomelands 1 3993 0 0 /news/craywands310318 1 3646 0 0 /news/wellingspreadtheirwingsintheirlocalcommunity 1 3141 0 0 /news/iwanthomeadvantageintheplay-offssayswarrilow 2 9336 0 0 /news/ashford160217 1 5302 0 0 /news/ebbsfleet210720 2 7850 0 0 /news/10thmay04.html 2 0 0 0 /news/drmartens/eastern/fisher/7thjuly04.html 1 0 0 0 /news/stevenageswoopforfleetace 1 3388 0 0 /news/sittingbourne0-1merstham-imalwaysconcernedaboutourhomerecordadmitsbrady 2 10129 0 0 /news/croydon270219 5 16707 0 0 /news/wingatefinchleyhavefivesentofftoabandonkickitoutmatchagainstthurrock 2 7168 0 0 /news/thechairmansambitiousandwantstomovebearstedforwardsaysbosstonycornwell 1 4751 0 0 /news/hallsathletic150517 3 15533 0 0 /news/wereclosinginonleaguetitlesayshessenthaler 1 4067 0 0 /news/anotherseasonlikethelastwillnothappenagaininsistslewishamboroughchairmanraysimpson 6 22178 0 0 /news/backingborotowembleyhubbardturnshisbackonborough-exclusive 2 10898 0 1 /assets/select2/dist/js/ 5 2226 0 0 /news/idontthinktopspotisdoneanddustedyetsayscraywanderersbossianjenkins 1 5312 0 0 /news/tonbridgeangels300420 3 10103 0 0 /news/551a9cf525d84 2 13358 0 0 /news/551a92501d7b8 1 3729 0 0 /news/cirencester221005.html 2 0 0 0 /news/ithoughtwethrownitawayadmitserithbelvedererbossmickycollins 2 14894 0 0 /news/bromvcroy131203.html 1 0 0 0 /news/hollands010219 4 17693 0 0 /news/elmstead190615 4 45796 1 1 /news/551bc5e695d2e 4 36855 1 1 /news/hollands200117 1 3968 0 0 /news/FAStatement101120 4 15662 0 0 /news/drydenwearemorethancapableofwinningleague 3 10700 0 0 /news/hollands010916 2 6890 0 0 /news/sittingbourne030219 3 13092 0 0 /news/nowletsgoandwinthetitlesayshume-exclusiveinterview 1 3594 0 1 /news/facupthirdqualifyingrounddraw 3 10079 1 0 /news/551a9cf54ada2 2 12600 0 0 /news/kenttitlechasershavealltoplayfor 1 3774 1 0 /news/dartchel070517 2 18433 0 0 /archive-2006-2014/144 3 13825 0 0 /news/551bc5e3b30a5 1 4057 0 0 /news/551bc99dee697 1 6654 0 0 /news/margatesearchforanothernewmanagerasbutlerresignsafter12leaguegames 2 6710 0 0 /news/wehavethequalitytogetthejobfinishedsayscloke 1 3726 0 0 /news/fisher1-1croydonathletic4-5pens-wevegiventhemarunfortheirmoneysaysproudlisney 2 13446 0 0 /news/folkestone301219 2 8922 0 0 /news/hytheheroesstainescouldntcopewithus 2 13182 0 0 /news/2ndmay05.html 2 0 0 0 /news/soccershorts160916 4 52614 0 0 /news/awinoverheybridgeswiftswillputusinagreatpositionsaysthamesmeadtownbosskeithmcmahon 2 9042 0 0 /news/craysev200817 2 24410 0 0 /gravesend-2003-2006/4 4 11825 0 0 /news/hernchic241020 6 54054 0 0 /news/13thfeb05.html 2 0 0 0 /news/551a9cf510d22 2 12232 0 0 /news/doverreadyfordartsvisit 2 6674 1 0 /news/dover221015 4 28579 1 1 /news/collbeck140818 1 9069 0 0 /news/bromwrex281120 6 60426 0 0 /news/splitloyaltiesforsuttonsvisittoangels 1 4200 0 0 /news/hythe090915 5 18377 1 0 /news/551a97b066db3 3 14223 0 0 /news/wewereshockingadmitsupsettrott 1 3490 0 0 /southern-counties-east-football-league/48 2 9208 0 0 /news/wejustwerentgoodenoughadmitsrelegatedward 3 13686 0 0 /news/crisisclubholmesdalebringindavies 1 3867 0 0 /news/kentyouth/02-03finaltables.html 2 0 0 0 /news/doverathletic051018 3 11706 0 0 /news/551bc5e4389dd 3 8548 0 0 /news/551a931e0287f 1 3758 0 0 /assets/uploads/content/1908_Challenge%20-%20Copy%201.htm 1 30083 0 0 /news/breakingnews11pmrymanleagueagmdegeneratedintoalittlebitofmayhem-exclusive 1 4207 0 0 /news/thebottomlineissurvivalinsistsangelschairman-exclusiveinterview 5 25353 0 0 /news/craywands290915 4 20270 0 0 /tier-football/ 1 4376 0 0 /news/ifweturnupwithabadattitudewewilllosetoorpingtonwarnserithtownbosstonyrussell 3 15202 0 1 /news/deal050205.html 1 0 0 0 /news/fisher091020 3 10659 0 0 /news/leadinggoalscorers 11 231288 6 6 /news/wellschairmanwantstobringcupbacktoculverden 1 3500 0 0 /archive-2006-2014/290 3 11791 0 0 /news/kickitoutisproudtoberepresentedatthefixturebetweenbromleyandwellingsayspaulelliott 3 11915 0 0 /news/2ndaug05.html 2 0 0 0 /news/551a9718db68d 4 12110 0 0 /news/trioquitwhitstableduetofamilyreasons 4 12502 0 0 /news/wellingtown050620 4 14690 2 1 /news/rustfore140320 4 51540 0 0 /news/lossoftrainingfacilitiessentusintofreefallreflectsobrien 2 7632 0 0 /news/drmartens/eastern/erith&belvedere/19thjuly04.html 1 0 0 0 /news/kieronmccann100121 3 11127 0 0 /news/kfu250518 4 13501 0 0 /news/551a95b3c3a3f 4 18113 0 0 /news/LettertoTheFA300320 6 41455 0 0 /news/supportwillgetusthroughsaysjenner 1 3460 0 0 /news/bowey310105.html 2 0 0 0 /news/dartford071116 3 12930 0 0 /news/ashfordmaketripleloanswoop-exclusiveinterivew 2 10796 0 0 /news/maidstoneunited1-1margate-wevegottoturnourownfortunesaroundsayshume 1 7000 0 0 /news/punjab130919 3 10116 0 0 /news/peckham060517 3 11843 0 0 /news/doversigncumbersonloan 1 3345 0 0 /news/doverappointdixonasnewreserveteamboss 1 4021 0 0 /archive-2006-2014/169 4 18195 0 0 /news/kentleague/cray/croydon171104.html 1 0 0 0 /news/corbettpartscompanywithcash-strappedfolkestone 2 7920 0 0 /news/kentleague/VCD/31stjan04.html 1 0 0 0 /archive-2006-2014/4 5 23680 0 0 /news/lovellpleasedwithimpressiveperformancesaheadofvitalfestiveperiod 2 9117 0 0 /news/wingsmakeswiftoffertohelpoutdockers 1 3114 0 0 /news/idontseelyddasateamatthebottomofthetablesaysdavesmith-crockenhillsettopullout 3 13532 0 0 /news/dulwtonbvcd050815 3 11880 0 0 /news/fisher160804.html 2 0 0 0 /news/clivewalkerreturnstochathamtown 6 17683 0 0 /news/ivegotajobtodoandrectifywhatsgoingwrongawayfromhomesaystonbridgebossstevemckimm 3 14630 0 0 /news/phoenixsports270919 3 12314 0 0 /news/kentcountyleaguestatement170321 9 40309 3 3 /news/29thmay04A.html 1 0 0 0 /news/kennington130919 3 11543 0 0 /news/ashfordsufferwidespreaddamageaftervandalsransackhomelands 1 4028 0 0 /news/wellingunited3-1bromley-wedidntplayparticularlygreattonightadmitsjamieday 3 27771 0 0 /news/crayvalley220319 4 15439 0 0 /assets/select2/tests/data/tags.html 1 272 0 0 /news/ashfordmustsplashout106000toalleviatewaterlogging 1 3650 0 0 /news/eastthurrock010105.html 2 0 0 0 /news/theteamspiritthatwevegothereenablesustogetthroughthefixturessaysmartinlarkin 3 12986 0 0 /news/sladevsport170404.html 2 0 0 0 /news/dovermakelastsummersigning-addingspicetotheirsquad 6 21764 0 1 /news/chelmsfordcity130819 3 10499 1 0 /news/idontwantittostartfallingapartsaysdartfordbosstonyburman 2 9806 0 0 /news/sheppey220917 1 3432 0 0 /news/551bc5e365fcd 1 4429 0 0 /news/theseasonsofarisaboutasgoodaswecouldhaveexpectedsayselthampalaceschrismccarthy 4 16598 0 0 /news/551bc5dd8a115 3 14317 0 0 /news/dulwich011105.html 1 0 0 0 /news/coneyhallbeginsearchtofindtheirfifthmanagerin2006-exclusiveinterview 3 12791 0 0 /news/551a99e4b8a79 3 15636 0 0 /news/dulwichhamletp-pcraywanderers 1 2738 0 0 /news/hernebay0-3hayesyeadingunited-wemissedourchanceonsaturdayadmitsproudlillis 1 5960 0 0 /news/meridianunveilricharddimmockasjoint-manager 7 43792 1 1 /news/fisher010219 4 13697 0 0 /news/margate060917 2 8104 0 0 /news/playersletmedownfumesporter 1 3743 1 0 /news/othernews/cafcladies30thdec03.html 1 0 0 0 /news/551a925045078 3 13038 0 0 /news/ashfordtownaremadeofthewrightstuff 2 8630 0 0 /news/favsf080617 2 7620 0 0 /news/knaptwells211115 3 26100 0 0 /news/weneedasmanypointsfromournextfourgamestoknowwherewestandsaysneilcugley 1 4673 0 0 /news/551a97b1ba0bb 1 4678 0 0 /news/sometimesyouvegottogobacktobasicsandwinuglysaysbeckenhamtownbossjasonhuntley 5 22671 0 0 /news/resultsoctober2019 3 31253 0 0 /news/flamingoparkticksalltheboxes-sayscraywanderersvice-chairmandavidfrancis 3 13433 0 0 /news/4thnov04.html 1 0 0 0 /news/conference/margate/11thnov04.html 1 0 0 0 /news/kentleague/cray/15thaug04.html 1 0 0 0 /news/thamesmead270615 3 13749 0 0 /news/drmartens/eastern/folkestone/hitchinvfolkefac270903.html 1 0 0 0 /news/chathamtown0-3sittingbourne-wecantdothejobwithourhandstiedbehindourbacksaysward 4 38472 0 0 /news/551a95b3c8112 1 3482 0 0 /news/augustseptember2008results 2 15440 0 0 /news/werehopingforagoodcrowdagainstmaidstoneunitedsaysbearstedbosstonycornwell 1 3418 0 0 /news/551bc99b86af3 1 6634 0 0 /news/chester051105.html 2 0 0 0 /news/sladeverit100404.html 2 0 0 0 /news/pre-seasonfriendlies2010 1 6280 0 0 /southern-counties-east-football-league/16 4 20768 1 0 /news/dartvsitt160304.html 2 0 0 0 /news/bromley090318 4 22218 0 0 /news/whitgraham110515 4 19845 0 0 /news/haringeyborough201019 3 18920 0 0 /news/gillingham1-2queensparkrangers-idgivethepunterstheirmoneybacksaysjamesmarrs 2 15474 0 0 /news/drmartens/eastern/folkestone/folkvsali030104.html 1 0 0 0 /news/IsthmianLeague140320 4 16312 0 0 /news/werehavingtocatchupadmitsconcernedcanterburycitybossadegower 2 8340 0 0 /news/wembleywinnerswhitstablepraiseforkingakinde-exclusive 2 8307 0 0 /news/wevegotnothingtoloseandeverythingtogainsaysvickersbossrickybennett 1 4630 0 0 /news/canterbury010219 4 15541 0 0 /news/kentleague/deal/Sampson1.html 1 0 0 0 /news/maidstoneunited2-2hendon-itsnotgoingtobeaquickfixwarnsnewstonesbossandyford 2 12098 0 0 /news/551bc5e40b233 2 9296 0 0 /news/ramsgate150818 3 9657 0 0 /news/ifeelihaveputinplacethefoundationsforthestonestoreturnhome-paulbowden-brown 1 3925 1 0 /news/28thmar04.html 2 0 0 0 /news/dalersbossdismissestitletalk 1 5171 0 0 /news/fewellwantstoreachsurvivalearlierthannormal 2 9572 1 0 /news/551a94af42cff 4 14001 0 0 /news/crowborough230617 1 3279 0 0 /news/sporerit180419 2 21714 0 0 /news/imveryexcitedaboutwhatliesaheadforhythetownsaystimdixon 3 10797 0 0 /news/ryman/bromley/10thjuly03.html 2 0 0 0 /news/20thapr04A.html 1 0 0 0 /news/wilkinslooksforwardtomakinghiscomeback 2 10500 1 0 /news/sittveastthurrockfac270903.html 2 0 0 0 /news/beingjoint-managerisnotformeadmitssimonhalsey 3 11120 0 0 /news/551a97996a468 2 9436 0 0 /news/551bc5e4cc107 1 3423 0 0 /news/webeleivewecanturnitaroundsayslangton 1 4348 0 0 /news/551bc5dc0a6e1 1 4775 0 0 /news/greenwich031117 2 6825 1 0 /news/551bc99cba741 1 4939 0 0 /news/kingstonian0-3maidstoneunited-illbesurprisedifwerenotallowedtogoup-jaysaunders 2 17738 0 0 /news/kentleague/greenwich/20thjuly03.html 2 0 0 0 /news/ramsgate230216 4 14673 0 0 /news/kentleague/sladegreen/31stjuly04.html 1 0 0 0 /news/wecancompeteagainstteamsinhigherdivisionswarnshernebaybossanthonydeer 3 11735 0 0 /news/itstimetogetseriousinsistsdolby-exclusiveinterview 5 25755 0 0 /news/spartanspulloutofdalersopeningwarm-upmatch 1 3063 0 0 /news/wellingtown241118 6 25650 0 1 /assets/ckeditor/plugins/liststyle/dialogs/ 1 374 0 0 /news/ilovebeinginvolvedinbiggamessaysphoenixsportsbosssteveoboyle 3 11891 0 0 /news/werestayingupandwerestayingputsaysarelievedstoneschairman 2 9411 0 0 /news/wehavetotickalltheboxesbeforewesubmitplanningapplicationsayscraywandererschairman 1 5836 0 1 /news/551a99e50bfbd 1 4590 0 0 /news/daishbeatstransferdeadlinebecauseheknowshowe 1 3113 0 0 /news/soccershortsderesbringinquartet 2 15089 0 0 /news/phoenix270818 3 12489 0 0 /news/erithsev210317 1 11590 0 0 /news/551a97994de72 2 12246 0 0 /news/obrienwillbeasuccessinsistsbinks 2 8356 0 0 /news/fleetappointatthetop 1 3786 0 0 /news/vickersgunningformaximumpointsduringcrazyperiodoffixtures 2 7498 0 0 /news/551bc5e13ca4a 1 3332 0 0 /news/kentfootballunited151119 4 15313 1 1 /news/kentleague/cray/9thfeb04.html 2 0 0 0 /news/corinthian210220 2 9932 0 0 /news/barking190305.html 2 0 0 0 /news/illbetryingtomaketheplay-offsandgetoutoftheleaguesaysangelsbosstommywarrilow 1 5363 0 0 /news/morehelpwillbeappreciatedsaysseager 2 10667 0 0 /news/cugleyalotofprideisatstakeagainstmargate 2 10568 0 1 /news/wintryblastbringskenttoastandstill 1 3528 0 0 /news/11thapr04.html 1 0 0 0 /news/551bc5e6e2e10 3 19337 0 0 /news/tonbridgeangels1-0havantwaterlooville-everyonesputinashifttonightsaystommywarrilow 3 25521 0 0 /news/dockerrelishingcupshowdownwithrivalstonbridge 1 4949 0 0 /news/27thapr05.html 2 0 0 0 /news/livecoveragetonbridgeangels1-0craywanderers-craneheaderclinchescup 1 6885 0 0 /news/551bc5e1493c1 2 12198 0 0 /news/kentleague/maidstone/15thaug03.html 1 0 0 0 /news/crowborough290419 3 12468 0 0 /news/hastvfolklgecup281003.html 2 0 0 0 /news/18thaug05.html 1 0 0 0 /news/551bc5e878dc6 2 6336 0 0 /news/daishwevegottogopart-time 2 6904 0 0 /news/heybridge051105.html 1 0 0 0 /news/lindseywaitingforsummeroffers-exclusiveinterview 1 3852 0 0 /news/ashfordunited271118 3 13362 0 0 /news/kentleague/sevenoaks/erithtown261004.html 1 0 0 0 /national-league/15 2 9828 0 0 /news/551a9bafdfec3 3 9369 0 0 /news/margatesvisittoeastthurrockismindovermattersaystabletoppingtrott 1 4002 0 0 /news/othernews/15thoct04.html 1 0 0 0 /news/afccroydonathletic310820 3 10367 0 0 /news/iwontupsetanyofourrivalsbysayingstupidthings-burman 1 4214 0 1 /news/551bc99d6d03f 1 5898 0 0 /news/kennington280320 3 10808 0 0 /news/greenrams291116 3 30642 0 0 /news/ebbsfleet300620 3 21162 1 1 /news/favasespecialfordwantshisunderdogstoreachvasefinal-exclusiveinterview 2 9850 0 0 /news/551a9250aa4fd 6 20053 0 0 /news/whitstable241004.html 1 0 0 0 /news/ifimgiventimeibelievewecanwintheleaguesayslordswoodbosssimonhalsey 2 10348 0 0 /news/rustcray071118 4 44254 0 0 /news/lordswood010219 4 15906 0 0 /news/dockersfightoffcompetitiontolandshinners 2 7250 0 0 /news/thamesmead140917 1 5566 0 0 /news/glebe010520 3 13393 0 0 /news/ivebeengiventhego-aheadtogooutandgetaforwardsayskeithmcmahon 2 8428 0 0 /news/weregoingtoeastleightowinsaysdoverathleticbosschriskinnear 2 8262 0 0 /news/clubsinvitedtonewleaguemeeting 1 4468 0 0 /news/itsgoodthatotherpeoplearenoticingourprogresssaysabbott 2 8225 0 0 /news/wedontwanttobeontheendofafatrophyshocksaysmargatebosssimonosborn 2 9181 0 0 /news/doverathleticappointtwonewboardmembers 1 4069 0 0 /news/winfolk140217 1 9598 0 0 /news/nickysouthallresignsaswhitstabletownbossfollowingdisagreementwithbudgets 4 15281 0 0 /news/fordlookstoinstillconfidenceintohisside 1 4810 0 0 /isthmian-league/10 15 92873 2 1 /news/fisher270704.html 1 0 0 0 /news/becktunw100315 2 16022 0 0 /news/noonewantstogodown-itsnotgoodforthecvsayscraywanderersbossianjenkins 3 14038 0 0 /news/champions-electdoverhaveoneeyeonnextseason 2 9460 0 0 /archive-2006-2014/186 5 22012 1 0 /news/551bc5dcf0c0d 1 5250 0 0 /news/playingyouthisourpolicysaysnewmargatebossashby 2 10574 0 0 /isthmian-league/3 8 55847 2 1 /news/tunbridgewells0-2hernebay-wevegottostayfocusedanddisciplinedsayssimonhalsey 1 7852 0 0 /news/letshopeitsfolkestoneandramsgateinthenextroundsaysjimward 2 7664 0 0 /news/dulwich121115 4 26176 1 1 /news/551a97b086b86 1 6359 0 0 /news/walkerplaysdowncoxquitclaims 2 6237 0 0 /news/wellbecapableofdealingwitheithersectionoftheleagueinsistsfoley 1 3938 0 0 /news/therewillalwaysbehiccupsandbumpsalongthewaywarnswellsbossmartinlarkin 2 9516 1 1 /news/dartford1-4millwall-wewerechasingshadowsadmitsupbeatburman 1 7119 0 0 /news/imoptimisticwelldoprettywellsaysdealbossderekhares 2 8872 0 0 /news/itsbusinessasusualformeatashfordtowninsistslovell 1 5330 0 0 /news/nationwide/gillingham/25thjuly03.html 2 0 0 0 /news/myoperationwasaresoundingsuccesssayswalker 1 3002 0 0 /news/kentleague/lordswood/22ndaug04A.html 1 0 0 0 /news/thestonesaregoingup 1 2666 0 0 /news/craywhyt100320 3 28591 1 0 /news/551bc5e4dac76 2 6840 0 0 /news/eighthwonder241016 4 22970 0 0 /news/lovellrueshisbadluckbutaimstoshakeupinjuryhitsquad 1 4160 0 0 /news/riocomestosittingbourne 1 3280 0 0 /news/folkestoneinvictayouthteamskippercallumwraighttogethisfirstteambreak 2 7622 0 0 /news/551bc5e61bf62 2 9113 0 0 /news/londonfirmskrillsecuredealtosponsorconferenceforthreeseasons 5 20555 0 0 /news/greenwich200217 1 3919 0 0 /news/soccershortshythetownunveiltimdixonastheirnewboss 3 31185 0 0 /news/kentleague/beckenham/greenwich071204.html 1 0 0 0 /news/englandfansfacetravelchaos 2 8125 0 0 /news/bromley100116 4 17238 0 0 /news/wellingtown300819 3 11151 0 0 /news/lewisham240417 4 20454 0 0 /news/louifazackerleypensnewone-yearcontracttostayatwellingunited 1 3711 0 0 /news/thamesmead120317A 1 3975 0 0 /news/551bc5e7ef294 1 2931 0 0 /news/kentleague/lordswood/lordswoodvvcd160803.html 1 0 0 0 /news/wellbeupforfolkestoneinsistsashfordbosslovell 1 4173 0 0 /news/kentseniortrophyfinalidswaptrophygloryforrymanfootballsaysmcmahon-exclusive 1 4401 0 0 /news/tunwells171116 1 3743 0 0 /news/othernews/FixNov2004.html 1 0 0 0 /news/canterbury211218 3 11349 0 0 /news/551a9798d1c00 2 11630 0 1 /news/ijusthopegavynhasgooddayesatdaggerssayswarrilow 1 4297 0 0 /news/28thmar04A.html 1 0 0 0 /news/551a931eaa5cc 1 5477 0 0 /news/heybridge301004.html 2 0 0 0 /news/imlookingforwardtothechallengesaysnewwhitstabletownbossjustinluchford 1 4989 0 0 /news/fcelmstead200119 4 13244 0 0 /news/drmartens/eastern/erith&belvedere/e&bvfolk010104.html 1 0 0 0 /news/seangloverleavesorpingtonaftertwosuccessfulseasons 8 57217 4 2 /news/551a97b10d81c 3 13041 0 0 /news/ihopeoursupporterscanallplaytheirpartsaysfavershamtownbossrayturner 3 13016 0 0 /news/metrtonb110519 6 45284 0 0 /news/holmes100915 4 16998 0 0 /news/conference/gravesend/3rdoct04.html 1 0 0 0 /news/shorts061115 3 26685 0 0 /news/wemustgetclosertohythesaysdalerscoachdean 2 8704 0 0 /news/kentleaguetitledualwewerechampionsfor25secondsadmitsstunnedseager 1 5283 0 0 /news/kentseniortrophyfinalbeckenhamtown0-2thamesmeadtown 1 5323 0 0 /news/dartford3-2ashfordtownmiddlesex-werebetterthanthatinsistsburman 2 10408 0 0 /news/551bc5e0873f9 1 4655 0 0 /news/relegatederithbelvederepartcompanywithchriscosgrove 4 16914 0 0 /news/whoevercomesfifthwillhavethelowestamountofpointspredictssittingbournesjimward 3 14192 1 0 /news/cugleymakesplansfornextseason 4 19018 0 0 /news/battleofthegiantsdartsdidntseetherealuslasttimeinsistsnott 1 5447 0 0 /news/resultsnovember2020 4 26054 0 0 /news/fordwantstheplauditstogotofrostandwallis-exclusiveinterview 1 5730 0 0 /news/551a9677e9d30 1 4604 0 0 /news/wellgoaboutourbusinessquietlysayscrayvalleybosspaulgross 4 20874 0 0 /news/551a979aaa044 1 4963 0 0 /news/kentleague/sevenoaks/22ndaug04.html 1 0 0 0 /news/margate300705.html 2 0 0 0 /news/dontgetintoyourcarwithanyregretssaystonbridgeangelsassistantalexobrien 1 4634 0 0 /news/brombwood040415 4 34182 0 0 /news/soccershortshernebaychairmancondemnsnortonsalehousetactics 2 22114 0 0 /news/gillingham5-0haverhillrovers-retainingbothcupswasourtargetsaysjackwheeler 4 32418 0 0 /news/sitteast171020 8 82306 1 0 /news/barking160405.html 2 0 0 0 /news/551a9c91bc449 4 20306 0 1 /news/erithfisher020916 2 20616 0 0 /news/tonbridgeangels0doverathletic0exclusiveinterviews 3 17867 0 0 /news/drmartens/eastern/erith&belvedere/4thoct04.html 1 0 0 0 /news/551bc5e478069 1 2828 0 0 /assets/ckeditor/plugins/forms/images/ 1 374 0 0 /news/551bc99be3e45 3 15513 1 1 /news/dartford5-0hendon-haworthsbookingignitedfansandteam-burman 2 11656 0 0 /news/tonbridgeangels1-4suttonunited-wevejustgottosticktogethersaystommywarrilow 1 6954 0 0 /news/canterbury030217 1 3718 0 0 /fixture-board-advertising 69 505436 3 36 /news/551bc99b79bb1 1 4681 0 0 /news/iwouldlikeacrackatfootballmanagementsaysmunday 2 8712 0 0 /news/tunwells191004A.html 2 0 0 0 /news/sittingbourne2-3stainestown-fumingabbotttherefereehadanabsolutenightmare 2 14193 0 0 /news/kingstonianholdthecardsintitleraceadmitskempster 2 8967 0 1 /news/tunwellsbeck101019 5 20580 0 0 /news/notrophiesarehandedoutinaugustsaystable-toppingerithbelvederebossmattlonghurst 3 13262 0 0 /news/sittingbourne070420 3 11178 0 0 /news/ihaveeveryconfidencethatmysquadisgoodenoughtobeateastprestonsaysjohn-paulcollier 4 17704 1 1 /news/whyteleafegivengo-aheadtolay3gpitchatchurchroad 1 4374 0 0 /news/idontfeelpressureatfootballsaysfisherbossbillywalton 5 20865 0 0 /news/wewillnotrolloveranddieinsistsheaslewood-exclusiveinterview 1 3168 0 0 /news/FAStatement150520 3 10313 0 0 /news/kentleague/hythe/erith210804.html 1 0 0 0 /news/perfectionistlegendarystrikerwillnotplayforashfordtownclaimscumberbatch-exclusive 1 4339 0 0 /news/kentleague/beckenham/12thdec04.html 1 0 0 0 /news/tonbridgeistherightmoveforgeorgepurcellsaystommywarrilow 1 4226 0 0 /news/chathamtown0stamford1 2 7394 0 0 /news/thepitchwastoodangeroustoplayonsayswarrilow 1 5340 0 0 /news/20thmay04.html 1 0 0 0 /news/idhatetoseesittingbournegounder-butitisthatbadsaysconcernedjoint-bossjimward 2 7764 0 0 /news/broadstairs040517 2 6368 0 0 /news/borehamwood1-2folkestoneinvicta 1 5108 0 0 /news/551bc5e3729b1 1 5740 0 0 /news/kentseniortrophyfinallivecoveragebeckenhamtown0-2thamesmeadtown-howthetrophywaswon 1 6762 0 0 /isthmian-league/ 1 4404 0 0 /news/resultsareimportantandthechairmanwantstogetawayfromthebottomthreesaysnickdavis 5 26517 0 0 /news/folkestoneinvictachairmanstandsdownafternineyearsatthehelm 1 3313 0 0 /news/resultsaugust-september2014 4 54686 0 0 /news/whitstabletown0-4dagenhamredbridge-ithoughtweputfantasticeffortinsaysnickysouthall 8 69263 1 1 /news/hessenthalerhailschairmansfreefootballgesture 2 9491 0 1 /news/balham170920 4 18182 0 0 /news/margate220116 4 13988 0 0 /news/drmartens/eastern/ashford/ashford.html 2 0 0 0 /news/joefordcup210719 3 10478 0 0 /news/lewisham210917 3 11688 0 0 /news/erith&belvedere031205.html 1 0 0 0 /news/26thnov04.html 2 0 0 0 /news/tunwells261015 20 89597 8 9 /news/cugleyyoungstersarepartofourfuture 2 10444 0 0 /news/gillsdefenderbryantendsinvictaloanspell 2 8263 0 0 /news/ashfcray090417 6 68766 3 2 /news/breakingnews11pmdartfordreluctantlyacceptleagueswitch 1 3731 0 0 /news/clubsbidtoimprovefacilitiesatdansonyouthcentre-holmesdaleconfirmdaviesisstayingput 2 8956 0 1 /news/fansupsetasfavouritefalanaisshownthedoor 3 11430 0 0 /news/fairplay300515 4 18850 0 0 /news/wivenhoe121105.html 1 0 0 0 /news/551bc99a93b0b 2 9878 0 0 /news/letshopewecantaketheclubforwardsaysnewsittingbournejoint-managerjimward 1 4691 0 0 /news/tonbridgeangels1-1wellingunited-wevedeservedmorethanwhatwevegotsaystommywarrilow 2 12102 0 0 /news/4thapr05.html 2 0 0 0 /news/551bc5db772d3 3 16591 0 0 /news/sevenoaksshockwillkickusupthebacksideadmitsporter 1 4292 0 0 /news/soccershortsnineteenapplyforsittingbournemanagersjob-exclusive 1 4280 0 0 /news/sevenerith130218 2 22180 0 0 /news/sportingbengal290105.html 2 0 0 0 /news/margate200905.html 1 0 0 0 /news/margate020618 4 16625 0 1 /news/drydenreturnstofolkestoneontwo-yearcontract 2 6223 0 0 /news/overthetwogameswewerethebettersideagainstgrayssayshernebaybosssamdenly 5 23627 0 0 /archive-2006-2014/293 2 8121 0 0 /news/dolbypicksuphistroopsafterhamptonrichmondrobbery 1 5294 0 0 /news/jepsonresignsafterlosingfiveoutofsix 1 3269 0 0 /news/fisher3-2canterburycity-ithinkwellturnitoversayscanterburycitybossadegower 2 16890 0 0 /news/boroughconfidentofobtaininglowestgroundgrading-exclusive 5 16934 0 0 /news/sevenoaks070916 2 9266 0 0 /news/tonbridgeangels2-1eastleigh-thisisamassivethreepointsforustonightsaystommywarrilow 1 9253 0 0 /news/551bc99ac5ca4 1 6421 0 0 /news/pitchero.com/clubs/crowboroughathletic 2 0 0 0 /news/kentleague/whitstable/3rdnov03.html 1 0 0 0 /news/billericay080105.html 2 0 0 0 /news/farnbex090516 2 9700 0 0 /news/soccershortsgloverturnshisbackonashfordtown 1 5438 0 0 /news/whitstable010218 1 3749 0 0 /news/kentishfootballaresoproudofthefleetwewerespotonsaystwo-goalheromcphee 2 10311 0 0 /news/ryman/bromley/harrvbromlgecup181103.html 1 0 0 0 /news/welling200217 4 15904 0 0 /assets/fileman/php/downloaddir.php 1 45 0 0 /news/bradbrookboostforabbott 1 4076 0 0 /news/sittingbourneappealforfinancialhelptoassistwithpitchimprovements 2 7980 0 0 /news/itsveryhardtosellrymanonefootballtolocalbusinesspeopleadmitsdoverdirector 4 14383 0 0 /news/drmartens/premier/dover/eastbournedover250803.html 2 0 0 0 /news/551bc5e655a12 3 11057 0 0 /news/resultsaprilmay2013 3 33986 0 0 /news/kentleague/ramsgate/30thjune03.html 2 0 0 0 /news/therescertainlynobottomlesspitofmoneyatdoverinsistschairman 6 27963 0 0 /news/greenwich240217 1 3996 0 0 /news/lovellwemusthaveapositiveattitudeifwearetoachieveourgoals-exclusive 1 4810 0 0 /news/sittingbourne1-0corinthian-casuals-itsagoldenopportunityforouryoungsters-abbott 2 22949 0 1 /news/formerchairmanmarkjennerinsistsfootballwillcontinueathomelands 2 13581 0 0 /news/hernebaydeer210515 2 6498 0 0 /news/essexsidelaunchinitiative 2 6623 0 0 /news/wellcomeoutfightingvowsburman 1 4378 0 0 /news/soccershortsstrikercarlrookquitswhitstabletownbytextmessage 5 30975 0 0 /news/tonbridgeangels3-3folkestoneinvicta 1 4939 0 0 /news/imstrugglingtoputateamoutadmitsfisherbossstevefirkins 1 3925 0 0 /news/itwasaneasydecisiontosignfordartfordsaysrichardrose 1 3581 0 0 /news/theplayersaresufferingfromalackofconfidenceatthemomentsayswhitstablesjustinluchford 2 9122 0 1 /home/loadmymanager 1 3575 0 0 /news/folkestone200220 2 6574 0 0 /news/soccershortskentishfootballfamilyrallyaroundfortommysampson 1 14808 0 0 /news/bromvworth140204.html 1 0 0 0 /news/551a97983f23a 1 3628 0 0 /news/551bc5e64f67e 1 4239 0 0 /news/drmartens/eastern/folkestone/braintree091004.html 1 0 0 0 /news/binkskeepfaithsfaithwithlocalplayersintheirnewsurroundings-exclusive 2 9128 0 0 /news/551bc5dc2ab7d 1 5359 0 0 /news/wellingunited3-1bromley-wereprovinghowgoodwearesaysford 3 32269 1 2 /news/favershamtownandcroydonacceptedintokentleague 1 3441 0 0 /news/chatham201116 1 3472 0 0 /news/kfu180617 4 18817 0 0 /news/551bc5e36d9c0 1 5474 0 0 /southern-counties-east-football-league/18 7 36030 0 0 /news/phoenix080416 4 13349 0 0 /news/saturdayssoccer25thmarch2006 2 6337 0 0 /news/gravesendnorthfleet4-1tamworth-daishdebollasfreekickswerefrightening 5 27227 0 0 /news/theclubismovingintherightdirectionsayscorinthianbossmattlonghurst 1 4224 0 0 /news/ryman/bromley/bromvdulwlsc030204.html 1 0 0 0 /news/551a96db7e0c6 1 5033 0 0 /news/craywanderers1-1ware-itsaboutstayingintheleaguenowadmitsgaryabbott 4 36114 0 0 /news/ashford080716 3 11838 0 0 /news/ryman/bromley/MolevBrom010104.html 1 0 0 0 /news/robbinslookingforwardtomassivegameagainstdalers 1 3407 0 0 /news/werenotexpectedtogetanythingfrommaidstoneandfolkestonesaysjustinluchford 1 4099 0 0 /news/chathamtowncraywanderersandthamesmeadtowntoplayrymanonenorthfootballnextseason 3 10689 0 0 /news/551a92510aa8b 2 8408 0 0 /news/551a956ce269b 1 4034 0 0 /news/bromley010316 3 10872 0 0 /news/drmartens/eastern/erith&belvedere/24thsept04.html 1 0 0 0 /news/dulwichhamlet310121 4 29392 1 1 /news/favershamtownscoop3000growthegamegrantfromthefootballfoundation 4 15554 0 0 /southern-counties-east-football-league/44 2 9134 0 0 /news/ebbsfleet231120 3 10375 0 0 /news/wevegottokeepimprovingandlearnfromourmistakessaysfolkestonebossneilcugley 2 9838 0 0 /news/tunwells200117 1 3800 0 0 /news/551bc5e6452cc 1 4384 0 0 /news/itwillbenicetogetoneoveronbromleysaysdartfordbosstonyburman 2 7760 0 0 /news/horsham1-3dartford-thatsansweredafewofourcriticssaysburman 2 41362 1 1 /news/margatefanspitchintopurchasenewtools 5 16604 0 0 /news/saturdayssoccer11thmarch2006 3 9641 0 1 /news/buryshowinterestinmeadteenagerhopkins 2 9422 0 0 /news/iknowitwillbereallytough-italwaysisatramsgatesayssittingbournebossnickdavis 2 10223 1 0 /news/results/londonseniorcup.html 2 0 0 0 /news/ryman/bromley/bromvdartksc071003.html 1 0 0 0 /news/hernebay0-2erithbelvedere 1 4185 0 0 /news/phoenix200918 3 12429 0 0 /news/ifweplaytoourbestwevegotachanceofstayingupsaysthamesmeadtownbosskeithmcmahon 2 9354 0 0 /news/mileswevetakentheclubasfaraswefeltitcouldgoexclusive 2 11433 0 0 /news/therewillbeareactionbecauseivetoldtheminnouncertaintermswhatiexpectsayssitford 1 4774 0 0 /news/551bc5e9086fb 7 75006 2 2 /news/dulwichhamlet1-1ashfordtown-wewouldntswapanyofourplayerssayslangton 1 5773 0 0 /news/staines171205.html 2 0 0 0 /news/lyddtown211119 6 19951 0 0 /news/maidstoneunitedappointjackparkinsonastheirunder21manager 5 19030 0 0 /news/hernebay0-2ramsgate-itsprobablyoneofourworstperformancesof2013admitstimdixon 3 25721 0 0 /news/551a99e3bd205 1 4019 0 0 /news/ebbsfleetunited0-1stevenageborough-thedaywhenstevenageshatteredourdreams 2 22444 0 0 /news/551a96dbe762a 1 4446 0 0 /news/DCMSStatement140820 3 11402 0 0 /news/myplayershavebeenwarnedaboutlyddsayscorinthianbossjamescollins 4 15850 0 0 /news/ramsgate3-1eastbournetown-ramsmanagerjimwardhailsheroicgroundsmanmartinjeffreys 3 35008 2 1 /assets/fileman/php/fileslist.php 1 22068 0 0 /news/ebbsfleetunited2-3afcwimbledon-exdoverstarsammymooresendsebbsfleetcrashingout 1 5696 0 0 /news/kentleague/cray/19thjan04.html 1 0 0 0 /news/mychairmanwantsmetowinthetitlesaysward 2 8718 0 0 /news/weneedtoaddabitofflairsayswhitstabletownbosspeternott 1 4161 1 0 /news/myexpectationsaretodothebestwecanandwinasmanygamesaswecansayssimonhalsey 1 4770 0 0 /news/wewontbetakinganyprisionersoverthefestiveperiodsaysward 1 4659 0 1 /news/chathamtown2-4merstham-wejustdidntperformthewaywecanadmitskeithlevett 6 66656 0 0 /news/wellingtown250920 5 20412 0 0 /news/551bc5e567b86 2 9044 0 0 /news/afccroybeck280916 2 20952 0 0 /news/drmartens/eastern/tonbridge/12thnov04.html 1 0 0 0 /news/wealwaysbouncebackfromabaddefeatinsistsbecksnumbertwomichaelmarks 1 4239 0 0 /news/kentleague/whitstable/27thoct04.html 1 0 0 0 /news/hessenthalerputsrecordstraightoverhocktonspeculation 2 6586 0 0 /news/kentleague/cray/favaseqfpreviewA.html 1 0 0 0 /news/cray090405.html 1 0 0 0 /news/551bc99ddfaae 1 4697 0 0 /news/wereinvolvedinfootballforgameslikethesesaysmichaelmarks 1 4505 0 0 /news/alltheleaguesinonepaper 2 6505 0 0 /news/borehamwood190819 3 17068 0 0 /southern-counties-east-football-league/20 10 50379 0 0 /news/livecoveragefolkestoneinvicta0-0afchornchurch-survivalhopesgotolastdaystonesshootout 1 6322 0 0 /news/551bc5e8b58b6 2 6527 0 0 /news/jepsonbringshisfirstteamstarstodoverathletic 1 3392 0 0 /news/kentleague/hernebay/hernvslad061203.html 1 0 0 0 /news/bromchelt131015 3 29262 0 0 /news/othernews/YL280104.html 1 0 0 0 /news/drmartens/eastern/ashford/11thnov03.html 1 0 0 0 /news/kentleague/thamesmead/18thnov03.html 1 0 0 0 /news/beckenhamtown2-1carterton-beckenhamstartdreamingaboutadayoutatwembley 1 7125 0 1 /news/551bc5db116bb 2 9034 0 0 /news/youdontwinthekentleaguebyplayingprettyfootballallthetimeadmitshalsey 1 4975 0 0 /news/25thjune04.html 3 0 0 0 /news/CONIFAWorldCup280518 4 25675 0 0 /news/soccershortsbeckenhamtownforcedtopostponevcdclashduetoburglaryatedenparkavenue 1 8382 0 0 /news/dartfordsignstrikerlewissmithfromafchornchurch 6 18895 0 0 /news/wereataveryadvancedstageofgetting15acresoflandsaysglebechiefrockymcmillan 4 18684 0 0 /news/hythetown1-0burgesshilltown-itsabouttimewegotalatewinnersaysscottporter 1 7534 0 0 /news/warrilowimnotgivinguponfinishinginplay-offplaces 1 5178 0 0 /assets/ckeditor/plugins/youtube/images/ 1 375 0 0 /news/margateunveilyouthprogramme 6 21811 0 0 /news/wellenjoythedayandcomebackwithsomegreatmemoriesfrombradfordsaystonyburman 3 13585 0 0 /news/ramsgate231104A.html 1 0 0 0 /news/551a956c1500f 1 4803 0 0 /news/folkestoneapplyforpromotion 3 12413 0 0 /news/fleetcouldfacecutsif19000membersdontrenewsubscriptions 2 9678 0 0 /news/worthing050905.html 2 0 0 0 /news/othernews/7thjuly03.html 2 0 0 0 /news/goalkeepersearchesfornewrecruitsforacademythatgavecorinthiandefenderdanbenthischance 5 22430 0 0 /news/kentleague/erithtown/10thsept04.html 1 0 0 0 /news/welling210917 1 4432 0 0 /news/theresnothingtoworryaboutinsistsupbeatlangton 2 8440 0 0 /news/dolbypromiseschangesaftersickeninghendondefeat-exclusive 2 8832 0 0 /news/wewillneedtobeatourbestifwearetohaveachanceofbeatingeastbournesayshugolangton 1 3737 0 0 /news/wemustconcentrateonpickingupleaguepointssaysfocusedmunday 2 7759 0 1 /assets/select2/tests/data/maximumSelectionLength.html 1 255 0 0 /news/bromley080217 4 16386 0 0 /news/13thaug03.html 2 0 0 0 /news/heinekenbuy-outforcesbulmerscidertopulloutofkentleaguesponsorship 2 6379 0 0 /news/thamesmead250916 2 7878 0 0 /news/cugleyswoopsforbrightonkeeper 1 3180 0 0 /news/mattsollyreturnstochathamtown 1 4045 0 0 /news/othernews/facup7thjuly03.html 2 0 0 0 /news/newromneyhelphytheintheirhourofneed 1 3735 0 0 /news/wecanentertainmanchesterunitedbutnotthreebridgessayssittingbournechairmanmauricedunk 4 14152 0 0 /news/NationalLeagueStatement221220 3 10648 0 0 /news/mersthambird270415 4 19749 0 0 /news/favasespecialsampsontellsvickersnottobottleit-exclusive 2 10194 0 0 /news/wemustchopdownsomewoodsaystrott 1 3343 0 0 /news/crayvalley061117 1 3742 0 0 /news/dawsonstartsknockingonmcmahonsdoor 1 4208 1 0 /news/vickersunveilrickybennettastheirnewmanager 1 3527 0 0 /news/551bc5e4d8cba 1 3397 0 0 /news/berkhamsted250904.html 2 0 0 0 /assets/select2/docs/examples.html 1 6433 0 0 /news/glebe291119 2 6970 0 0 /news/hampton170905.html 2 0 0 0 /news/wewanttomakehistoryforthegillssaysskipperjayblackie 3 20724 0 0 /news/spenbrom060318 4 13686 0 0 /news/corinthian090819 3 10752 0 0 /news/webelievewecangetintotheplay-offsinsiststwo-goalherocade 2 10729 0 0 /news/folkestone120618 4 15525 0 0 /news/wevegottoconcentrateongoingasfaraswecansayshernebaybosssimonhalsey 2 9630 0 0 /news/551bc5e50cf48 1 4263 0 0 /news/soccershorts050216 4 26182 0 0 /news/ashford010116 3 10131 0 0 /news/23rdnov03.html 1 0 0 0 /news/theboardhavemulledoverthevariouspermutationsthatcouldhaveseenusmovesaysjefftalbot 5 20430 0 0 /news/551a979a3f26e 1 5202 0 0 /news/savethewingscampaignkentsgreatfanscanplaytheirparttosavewellingunited 1 5045 0 0 /news/foleystepsdownasvcdathleticboss 1 3798 0 0 /news/551a9c0e6828a 1 3423 0 0 /news/watsonblundercoulddefineourseasonadmitscugley 1 5857 0 0 /news/iwalkawayfromrefereeingwithfabulousmemoriesandnoregretssaysproudmartinyerby 1 4425 0 0 /news/soccershorts220516 4 27166 0 0 /news/kentleague/cray/5thnov04.html 1 0 0 0 /news/ownersdontputanypressureonmetohaveafacuprunsayswellingunitedbossjamieday 3 13973 0 0 /news/lewisham310818 3 11598 0 0 /news/ramsgate3-0leatherhead-quinnlaysthefoundationsofcomfortableramsgatetrophywin 1 5371 0 0 /news/fixtures34march2006 4 14437 0 0 /news/canterburycity5-1greenwichborough-togoroundkickingourplayersisadisgraceblastsaustin 1 8856 0 0 /news/gillinghampartcompanywithpetertaylorafterfourteenmonthsincharge 2 8828 0 0 /news/sittingbourne3-1waltoncasuals-wehaveonehellofachanceofmakingtheplay-offs-abbott 1 4656 0 0 /news/bromgrims190116 4 11498 0 0 /news/othernews/bearsted251104.html 1 0 0 0 /news/bearsted150615 3 12027 0 0 /news/crayvsandhurstfac130903.html 1 0 0 0 /news/slough210405.html 2 0 0 0 /news/wewantaruninthecupsayshernebaybosssamdenly 5 20232 0 0 /news/dover290416 4 16710 0 0 /news/kentleague/lordswood/30thjune03.html 2 0 0 0 /news/imgettingnopressurefromtheclubsaysmcmahon 1 4642 0 0 /news/westhamlegendcotteecomestokent 4 12998 0 0 /news/ibelievethaticanscoreineverygameandifidontthenimdisappointedsaysadambirchall 4 16966 0 0 /news/sctjoeford310319 4 13136 0 0 /news/sittingbourne030217 1 3927 0 0 /news/10thsept05.html 1 0 0 0 /news/othernews/lsc03-04.html 1 0 0 0 /news/chathamtown0-3dulwichhamlet 2 9018 0 0 /news/therewillbenolapsesinconcentrationatchipsteadinsistsburman 1 3855 0 0 /news/551a9bafdc65a 3 10791 0 0 /news/jamiedaycontinueshissquadreshapingatebbsfleetunited 4 23132 0 0 /news/trotttheleagueistougherthisyear-exclusiveinterview 3 10495 0 0 /news/craywanderers0-2concordrangers-itjustdidnthappenforustonightadmitsianjenkins 3 23414 0 0 /news/heaslewoodtellshisplayerswemustkeepourheads-exclusiveinterview 6 28334 2 2 /news/soccershortshythesearchforyoungkeepertogainexperienceunderhyde 2 12751 0 0 /news/wewillputonashowaswealwaysdosayssheppeyunitedbosskevinhake 3 10805 0 0 /news/ournewstrikepartnershipwereexcellenttogethersaysmargatebossiainoconnell 1 4172 0 0 /archive-2006-2014/203 2 9118 0 0 /news/wevegottobeatourbesttoclaimback-to-backwinssaysyorath 1 3731 0 0 /news/551a9250e4f33 4 18282 0 0 /news/glebe030217 3 10839 0 0 /news/tommywarrilowreturnstostonebridgeroadaschiefscout 3 11438 0 0 /news/551bc5e73a834 2 10498 0 0 /news/21stoct04.html 2 0 0 0 /news/10thmar05.html 2 0 0 0 /news/551a97b162892 1 4907 0 0 /news/stamford1chathamtown1 1 3624 0 0 /news/canterbury111116 2 6962 0 0 /news/drmartens/eastern/sittingbourne/sittvstam280204.html 1 0 0 0 /news/beckenham201218 4 15544 0 0 /news/facarlsbergtrophyfirstrounddrawangelshandeddreamdrawatoxfordunited 1 4245 0 0 /news/backbypopulardemandgreeniesfridaypreview-footballreturnstokent 5 23166 0 1 /news/phoenixsports1-0hollandsblair-weshouldthankthecommiteefortitlewinsaysbeckingham 3 24533 0 0 /news/551a9718d9330 4 12954 0 0 /news/glebdart190919 3 40670 0 0 /news/551bc5e70eedd 2 9488 1 0 /news/dartford0-1hamptonrichmondborough-welackedthecuttingedgeadmitsmuggedburman 1 6937 0 1 /news/551bc5e128b95 1 4532 0 0 /news/ramsgatevice-chairmanaskswherewaseverybody 1 3557 0 0 /assets/ckeditor/plugins/a11yhelp/dialogs/ 1 392 0 0 /news/bromgill100718 3 26727 0 0 /news/shirleyrose141019 2 6574 0 0 /news/551a9c0f0e9b3 3 10179 0 0 /news/23rdjune05.html 2 0 0 0 /news/551bc99aba30e 2 7806 0 0 /news/551bc5e26831f 2 8654 0 0 /news/bromley200220 2 6452 0 0 /news/bromleyjackholland130518 4 20410 0 0 /news/longservingpettitbidsfarewelltoramsgate 2 6730 0 0 /news/wereonabitofalearningcurvesaysramsgatebossjimward 1 5294 0 0 /news/dealtown080920 4 18904 0 0 /news/7thsept04.html 2 0 0 0 /archive-2006-2014/184 5 22341 0 0 /news/imdelightedtohavejean-michelsigereonboardsayschathamtownbosskevinwatson 1 3242 0 0 /news/wellingunited3-2tonbridgeangels-bestweveplayedforalongtimesaysjackparkinson 1 7712 0 0 /news/kentcountyleaguestatement240121 5 27620 1 1 /news/greendork040217 1 9690 0 0 /news/551a99e4c5822 3 17670 0 0 /news/551bc99abdc46 2 7844 0 0 /news/551bc5ddf3bcd 6 54050 2 1 /news/teammoraleisexcellentrevealsdartsbossburman 4 14410 0 1 /news/551bc5de86312 1 3733 0 0 /archive-2006-2014/262 6 25520 0 1 /news/glebesutt070516 4 49937 0 0 /news/18thapr05.html 1 0 0 0 /news/551bc5dba624e 4 18162 0 0 /news/wevegottobewellpreparedfortheplay-offsaswecansaysproudbromleybossmarkgoldberg 3 13062 0 0 /news/topscorersindenquitsvickers 2 7883 0 0 /news/chatham200217 1 3562 0 0 /news/fansflocktocountyplay-offfinal 1 3013 0 0 /news/stonessearchforfreshmanagerialblood 2 6629 0 0 /news/wevegotanopportunitytodosomethingspecialsaysebbsfleetunitedbossstevebrown 3 19218 0 0 /news/kentfootballunited170920 4 20828 0 0 /news/safetyconcernscausepostponementofrelegationbattle 1 3184 0 1 /news/thepressuresallonwellingandnotonussaysthamesmeadtownbosskeithmcmahon 1 4614 0 0 /archive-2006-2014/251 3 13109 0 0 /news/551bc5da9f638 2 8114 0 0 /assets/ckeditor/plugins/imagepaste/ 5 1913 0 0 /news/othernews/favase3rdround.html 1 0 0 0 /news/20thaug04A.html 1 0 0 0 /news/hernebay220620 3 10586 0 0 /news/folkestonechappell060715 3 12375 0 0 /news/cafcwomen140717 4 13725 0 0 /news/farnierelishingfacupclashagainsthisformerclub-exclusive 5 36198 0 0 /archive-2006-2014/68 2 9643 0 0 /news/wedontknowwhattoexpectfromnortonadmitsluchford 1 4723 0 0 /news/woking1-0ebbsfleetunited-daishbemoanescontentiousdecisionsagainsthisside 2 12192 0 0 /news/stay-awayfansflockbacktoresurgentashfordtown 1 3605 0 0 /news/551bc5e4bcdb2 1 4592 0 0 /news/soccershortsbromleysignconvicteddrugdealer 2 25441 1 1 /news/hernebay3-0camberleytown-wecannowmixitwiththebigteamssayssimonhalsey 4 18581 0 0 /news/canterburycityfc.net 2 0 0 1 /news/ifweplaythewaywecandothenwerepositivewecangetaresultsaysjackparkinson 1 5627 0 0 /news/wemustmaintaintherightattitudetoavoidgiantkilling-hessenthaler 1 3483 0 0 /news/kentleague/cray/13jan04.html 1 0 0 0 /news/dartford3-1doverathletic-weneedtopulltogethertogetoutofthisholesaysshanehuke 1 7703 0 0 /news/ourambitionsfortheseasonareblunt-wewantpromotionsayskfubosssammacneil 6 24548 0 0 /news/drmartens/eastern/ashford/10thaug04.html 1 0 0 0 /news/11thjan05.html 2 0 0 0 /news/soccershortskingstoniansignstrikernathanielpinneyfromtonbridgeangels 4 24726 0 0 /news/551bc5e5977c7 2 8304 0 0 /news/beckchat040120 5 59885 0 0 /news/newromney100517 3 13487 0 0 /news/551bc99d86ce9 1 4692 0 0 /news/chatham080205.html 2 0 0 0 /news/millwallchairman200320 3 11539 0 0 /news/551bc5de5e7b2 1 3386 0 0 /news/kentclubsandfiveplayerspickupaccoladesatconferenceawardsnight 2 8666 0 1 /news/wecertainlywontbegoingtoplymouthwithanyfearsayswellingunitedcoachdeanfrost 1 4172 0 0 /news/brombar140417 2 21190 0 0 /news/foleyiamhappiertobeinrymanonenorth 1 5890 0 0 /news/imdelightedtobebacksaysbinks-exclusive 1 4634 0 0 /news/IsthmianLeague210320 3 9098 0 0 /news/imustsayitisapleasuretoworkwithsuchatalentinerhunoztumersaysgavinrose 4 20654 0 0 /news/551bc99a84eeb 1 3751 0 0 /news/lordvdeal191103.html 1 0 0 0 /news/gillingham200705.html 2 0 0 0 /news/langtonlooksforwardtoworkingwithlovell 1 4802 0 0 /news/iwanttoputpressureonmyforwardssaysmcmahon 1 4174 0 0 /news/facarlsbergtrophyfirstrounddraw-wingsbossjamiedayrelishingtriptolutontown 1 4276 0 0 /news/ithinkwerebetterthanamid-tablesidesayswoodstocksportsassistantscottappleton 1 3912 0 0 /news/fisher090218 3 11082 0 0 /news/kentleague/cray/4thmar04.html 1 0 0 0 /news/ryman/bromley/bromvcroy131203.html 1 0 0 0 /news/doverathletic1-2newportcounty-wehaventbecomeabadsideovernightsayshessenthaler 1 5514 0 0 /news/chatham260305.html 2 0 0 0 /assets/fileman/ 9 6848 0 0 /news/everyoneexpectsustogetpromotedthisyearadmitsmaidstoneunitedbossjaysaunders 1 4217 0 0 /news/551a956c8db89 3 14259 0 0 /news/551bc5df47397 1 4119 0 0 /national-league/24 3 14454 0 0 /assets/fileman/php/functions.inc.php 1 27 0 0 /deal-2003-2006 12 35354 0 0 /news/chathamtown1-1horshamymca-strikershadnoluckinfrontofgoalsaysobrien 1 5367 0 0 /news/sittingbourne100119 3 10899 0 0 /news/sittvcorb070204.html 2 0 0 0 /news/551a9718a8399 4 16738 0 0 /news/stonesenticepettitandrichmondbacktotheclub 4 53879 2 2 /news/551a9c0e4c4f7 1 3378 0 0 /news/16thsept04.html 2 0 0 0 /news/mysquadisgoodenoughandcapableofwinningsomethingsaysvcdathleticbossrickybennett 1 3750 0 0 /news/burmanpricedoutoftransfermarket 2 8124 0 0 /news/margate221217 1 4193 0 0 /news/thamesmeadtown2beckenhamtown1 4 16605 0 0 /news/kenthavemademassiveimprovementsinsistscoach 4 15168 0 0 /news/garyabbotttakessolechargeofcraywanderersaftermichaelpayestandsdown 3 12228 0 0 /news/whatweofferedhimwastoogoodforhimtoturndownsaysthamesmeadtownbosskeithmcmahon 2 10882 0 0 /news/deanharrison090320 5 20153 2 2 /news/lanewantstocurbfridaynightdrinkingtoimproveresults 1 3928 0 0 /news/sittingbourne1-1merstham-theressomethingnotquiterightaboutmysquadadmitsgaryabbott 1 4984 0 0 /news/3rdjune05.html 2 0 0 0 /archive-2006-2014/231 2 8458 0 0 /news/facuprunwillstandusingoodsteadingettinganewgroundsaysgreenwichboroughspaulblade 3 14870 0 0 /news/drmartens/eastern/ashford/18thsept03.html 1 0 0 0 /news/cometothegametoseewhowevesigned 1 3146 0 0 /news/tunwells120205.html 1 0 0 0 /news/holmesdale200116 4 21306 0 0 /news/dulwbrom211015 3 32187 0 0 /news/craydiscussingtermswithstrikerbeveney 1 3812 0 0 /news/551bc5e8d8be7 3 16277 0 0 /news/27apr04A.html 1 0 0 0 /news/wardwantstomakeupforrecentcupdisappointment 3 12122 0 0 /news/bromleyjackholland070218 4 18865 0 0 /news/ebbsfleetunited0-0ketteringtown-daishasksformoresupportfromchoir 1 6029 0 0 /news/theroadtowembleyfacupthirdqualifyingrounddraw 1 2918 0 0 /assets/uploads/content/Louis_Dennis_scores_that_Boxing_.htm 1 2578 0 0 /news/14thaug03.html 2 0 0 0 /news/cablebrothersreunitedatthamesmead 1 3238 0 0 /news/551a956bb1709 4 16810 0 0 /news/craywanderers3-0haringeyborough-yougettothisstageofacupyouwanttowinit-francis 1 6625 0 0 /news/thefacupcomestokentforcraystelevisedtie 1 4188 0 0 /news/favershamfaceautomaticfineof150 4 23392 0 0 /news/isthmianleaguestatement031220 4 12024 0 0 /news/551a96dbc8aa6 1 5747 0 0 /news/7thJan04.html 1 0 0 0 /news/hopefullywecangetagoodresultinfrontofagoodcrowdsaysmaidstoneunitedbossjaysaunders 2 8454 0 0 /news/iamhopefulthatwecanfinishtheseasoninabetterpositionsaysfisherjoint-bossmartinford 3 11429 0 0 /news/wewontbeeasytobeatsaysfisherjoint-bossbillywalton 3 14367 0 0 /news/imsopleasedforscottlindseysaysfolkestonebossneilcugley 2 10333 0 0 /news/12thjuly04.html 1 0 0 0 /news/bromley091216 4 15574 1 0 /news/dockersbossoboylewantsglamourtie 1 3746 0 0 /news/fleetdreamingofwembleyreturn 1 4817 0 0 /news/itsreallyimportanttostartwellsaysmaidstoneunitedbossjaysaunders 5 22086 0 0 /news/croydon270919 3 11443 0 0 /news/551bc99b1d955 1 3381 0 0 /news/isthmianleague121118 4 13294 0 1 /news/551a925075bab 1 4882 0 0 /news/soccershortskentplayersignsdealwithswedishclub 1 6069 0 0 /news/SASSCT060616 4 13297 0 1 /news/othernews/PSF0405.html 1 0 0 0 /news/extrafansgivesboxingdaygamesaddedspicesayswarrilow 1 4549 0 0 /news/maidstoneunited4-0whitstabletown 1 5097 0 0 /news/yourchancetoplayformaidstoneunited 2 5923 0 0 /bromley-2003-2006/4 3 9423 0 0 /news/551bc5db6544c 3 18656 0 0 /assets/uploads/content/Nick_Davis.htm 1 8895 0 0 /news/eastbourneisadifficultplacetogoandgetaresultwarnsdartfordbosstonyburman 1 3451 0 0 /news/margate200718 4 12605 0 0 /news/bromleians060718 3 14615 0 0 /news/banburyunited1-2tonbridgeangels-dolbyhailsvaluablewin-exclusive 1 6151 0 0 /news/wardfeelsreallypositiveonplayerfront 2 11193 0 0 /news/13thjune04.html 1 0 0 0 /news/chathamtown0-2charltonathletic-weevntuallygaveagoodaccountofourselves-kevinwatson 3 14885 0 0 /news/kentleague/erithtown/16thsept04.html 1 0 0 0 /news/bromley210920 8 108260 5 6 /news/floodsareahugeblowtotheclubsayshildenboroughcaretakerbossandrewmckechnie 1 3658 0 0 /news/unfortunatelytherehasbeenabridgethatcantbemendedsaysnickdavis 4 19901 0 0 /news/NationalLeagueStatement181020 4 15856 0 0 /news/10thoct03.html 2 0 0 0 /news/551bc5dccbf7e 1 4205 0 0 /news/craydulw200417 4 44202 0 0 /news/551bc5e475001 1 3616 0 0 /news/cvalley230615 4 23502 0 0 /news/551a92507d611 2 7830 0 0 /news/seethefleetforfreeinplayoffpush 2 8634 0 0 /news/551a979815c1c 4 14953 0 0 /news/dulwich040116 3 12552 0 0 /news/hollands&amp 1 0 1 1 /news/chatham210917 1 3188 0 0 /news/bordtud210516 2 21670 0 0 /news/maidstoneunited4-1ramsgate-ijustthinkwellgetbettersaysstonesbossjaysaunders 1 6532 0 0 /news/wellslinkupwithforesterstodeveloplocalpotential 4 13469 0 1 /news/whitehawk2-2favershamtown-iwouldhavetakenapointbeforethegameadmitshappyluchford 2 15221 0 0 /news/551a956c4ca55 3 11664 0 0 /news/wemassivelyunderachievedlastyearadmitsmiltonfulstonbossaaronperry 5 21640 0 0 /news/margateproposeone-yearcva 1 3437 0 0 /news/kentleague/deal/dealvcray011103.html 1 0 0 0 /news/playerscantcommandhighwagesanymoresayscraychairmanhillman 1 5651 0 0 /news/soccershorts120517 1 6834 0 0 /news/scoringgoalscomesnaturaltomeadmitsfree-kickspecialist 4 16380 0 0 /news/15thoct04.html 1 0 0 0 /news/20thjan05.html 1 0 0 0 /news/imexpectingthatweregoingtobeacomfortablemidtablesidesaysmartinford 4 20412 0 0 /news/ournexttwohomegamesareveryimportantsaysburman 4 14457 0 0 /news/gravesham110817 3 12126 0 0 /news/ryman/bromley/16thnov03.html 1 0 0 0 /news/ihavethebackingtoturnthingsaroundsaysunderfirelovell 1 4511 0 0 /news/powershownthedoorfollowinghalf-timedifferenceofopinionwithjenkins 2 8154 0 0 /news/flanaganaimingformidtable 3 18434 0 0 /news/chathamtown2-0folkestoneinvicta-keepersredcardovershadowschatstrophywin 1 7246 0 0 /news/20thaug04.html 2 0 0 0 /news/KSTSF030305.html 1 0 0 0 /news/beckenham121105.html 2 0 0 0 /news/theprizeishugesayswembleywinnertommysampson 1 6801 0 0 /news/551a92508eed0 2 6668 0 0 /news/drmartens/eastern/chatham/ChatvSitt010104a.html 1 0 0 0 /news/ramsgate291216 1 3631 0 0 /news/wehavetostandupandcompeteagainsttheleagueleadersbillericaysaysianjenkins 1 3788 0 0 /news/tonbwort100318 1 9436 0 0 /news/glebe01112019 2 7126 0 0 /news/lackofraininhernebaycausespostponement-exclusiveinterview 5 21362 0 0 /news/harrow020405.html 2 0 0 0 /news/drmartens/premier/dover/22ndnov04.html 1 0 0 0 /news/woodbidsfarewelltocraywanderers 1 4450 0 0 /news/conference/margate/24thjune03.html 2 0 0 0 /news/551a92506349a 4 17594 0 0 /assets/ckeditor/plugins/image/images/ 1 369 0 0 /news/25thaug03.html 1 0 0 0 /news/freefootballsaturdaywasasuccesssaysdelightedbournechairman 1 4537 0 0 /news/tonbridgeangels1-0oxfordunited-bestdayinclubshistory-warrilow 1 8032 0 0 /news/faversham040520 3 9619 0 0 /news/551bc5e796c8b 1 5200 0 0 /news/brentfordsignleggeforundiclosedfee 1 3898 0 0 /news/brom3gpitch010515 4 17226 0 0 /news/551bc5db49a83 2 5934 0 0 /news/whytefowler270415 4 19966 0 0 /news/ashfordtown1-2thamesmeadtown-mcmahonpraisesheroickessell 2 11356 0 0 /news/551bc5e3c666f 1 4314 0 0 /news/marfixtures03-04.html 2 0 0 0 /archive-2006-2014/165 2 9465 0 0 /news/20thJan04.html 2 0 0 0 /news/sevenoakstownunveildouble-winnermickycollinsastheirnewboss 3 13260 0 0 /news/folkestoneinvicta2-4carshaltonathleticineedcashorwewillgodownwarnscugley-exclusive 3 18521 0 0 /news/chatham130815 3 12399 0 0 /news/551a99e4847ce 1 3730 0 0 /news/551a9c926c7d8 3 22793 0 0 /news/551bc5df8a8b9 1 4351 0 0 /news/hopefullyladyluckwillshineonusalittlebitmoresaystonbridgeangelsbosstommywarrilow 2 9526 0 0 /news/551bc5e18776d 3 33583 1 1 /news/551bc5e347afd 2 8892 1 1 /news/551a97b0b7f2a 1 3079 0 0 /archive-2006-2014/15 2 9914 0 0 /news/fansaimtoraise1000forchildrenscharity 1 3511 0 1 /news/25thfeb05.html 3 0 0 0 /news/seatsinstalledatnorthfleetend 5 17492 0 0 /news/thamesmead171018 5 36795 0 0 /news/drmartens/eastern/sittingbourne/10thjuly03.html 2 0 0 0 /news/aveley280305.html 1 0 0 0 /news/lewishamborough1-6sevenoakstown-wewasashamblesadmitslewishambosskevinharris 4 40622 0 0 /news/theweekahead-4 3 10811 0 0 /news/folkestone140917 1 3826 0 0 /news/kentleague/deal/Sampson4.html 1 0 0 0 /news/maidstone191117 4 32219 0 1 /news/trottkeepsfaithashechasesplay-offspot 1 3827 0 0 /news/FAV3rewview121204.html 1 0 0 0 /news/tonbascot060916 4 72576 1 0 /news/margate180119 3 11628 0 0 /news/551a9798621b7 2 6610 1 0 /news/29thaug04.html 1 0 0 0 /news/othernews/10thaug04.html 1 0 0 0 /news/backdowntoearthforfacupheroeshythetown 2 8639 0 0 /news/phoevcd240715 5 100158 0 2 /news/croydonisthenextstopformuch-travelledsodje 2 10612 0 0 /news/kennington120620 3 10910 0 0 /news/thamesmead271115 3 10440 0 0 /news/sevensitt280815 4 44370 0 0 /news/stay-awayfansarekillingashfordtownwarnsthorogood 2 7988 0 0 /news/2ndaug04.html 2 0 0 0 /news/29thjan05.html 1 0 0 0 /news/fisher310820 2 7292 0 0 /news/SportsMinisterStatement180820 5 17396 0 0 /news/drmartens/eastern/folkestone/ashford240704.html 1 0 0 0 /news/expectationswillneedtochangesaysdoverathleticchairmanjimparmenter 4 16270 0 0 /news/551a97b1e0157 1 4049 0 0 /news/551a9677404e0 3 13656 0 0 /news/dulwich311217 1 3158 0 0 /news/craywanderers0-1tonbridgeangels-idsettlefor1-0becauseawinsawinsaysalexobrien 1 7806 0 0 /news/werefindingitverydifficultatthemomentadmitsramsgatebosstimdixon 1 4524 0 0 /news/itsabigweekendforalotofclubssaysdartfordbosstonyburman 1 4110 0 0 /news/fisher201218 4 13793 0 0 /news/wellingunited0-1doverathletic-werenotquitereadytogetintoplay-offsadmitsday 1 5099 0 0 /news/thepressureisoffusandwereconfidentofcausingashockinsistshythebossscottporter 1 4741 0 0 /news/greenwich290616 1 3232 0 0 /news/francis060804.html 2 0 0 0 /news/doverathleticunveilsigningofhighly-ratedmoore 1 5628 0 0 /news/soccershorts160516 4 27635 0 0 /news/rochester110917 1 3406 0 0 /news/tonbridgeangels5-1tunbridgewells-wewanttoclosethegapbetweenthetwoteamssayslarkin 8 151750 3 3 /news/551a9baff2647 3 9327 0 0 /news/24thdec04.html 2 0 0 0 /news/sittfav120416 6 65509 0 0 /news/551bc5e23cf59 1 3739 0 0 /news/ChallengeCupFinal040519 3 13656 0 0 /news/fansraise1600forfolkestoneinvicta 2 9593 0 0 /news/hernebay040919 3 11168 0 0 /news/weregoingtogivesomeonearightpastingwarnsmargatebossashby 1 3484 1 0 /news/margate150416 4 14637 0 0 /news/managementpairsignnewcontractstostayatstonebridgeroad 1 3072 0 0 /news/14thfeb05.html 1 0 0 0 /news/braithwaitesscanhasbearingonchasesdoverfuture 1 4510 0 0 /news/abbottlooksforwardtohisvisittothepolice 2 7556 0 0 /news/camberley250905.html 2 0 0 0 /news/iwillputasidetogetherthatthetownofsittingbournewillbeproudoffsaysnickdavis 2 8054 0 0 /news/ashfcrow010417 1 10902 0 0 /news/fishcori120319 4 53753 0 0 /news/551a931e2c02d 1 3580 0 0 /news/whyteleafe140919 4 13518 0 0 /news/551bc5e011d98 1 4886 0 0 /news/dulwichhamlet1-1thamesmeadtown5-3p-ithoughtwewasexcellentsaysproudkeithmcmahon 3 28883 0 0 /archive-2006-2014/200 5 20892 0 0 /news/hendonmccann160515 3 18231 0 0 /news/imdelightedstillwithhowtheclubisprogressingsayssammacneil 3 12179 0 0 /news/fisher1-2canterburycity-wevemadehistoryfortheclubsaysproudbosssimonaustin 2 20066 0 0 /news/holmesdale130815 4 16400 0 0 /news/551a9678ef740 1 6310 0 0 /assets/fileman/css/images/ 5 3072 0 0 /news/551a97b25f72c 1 4580 0 0 /news/551a9c92bbeb1 2 9546 0 0 /news/chelmsford170804.html 2 0 0 0 /news/lordswood150520A 8 77039 5 4 /news/leaguefixturesaugust-september2009 2 13526 0 0 /news/wewillnotfinishbottominsistslordswoodsjohnguest 2 8244 0 0 /news/lovellshakesupreserveside-exclusive 1 5266 0 1 /news/wellbebetternextseasonsaysdartfordbosstonyburman 1 3943 0 0 /news/hythe200915 3 11190 0 0 /news/mrniceguysmithfollowshisamericandream 1 6130 0 0 /news/roystonwemustcutoutindividualerrors-exclusiveinterview 2 7375 0 0 /news/leyton041005.html 1 0 0 0 /news/resultsjanuary2018 4 37154 0 0 /news/4thnov05.html 2 0 0 0 /news/551bc5e84a2ac 2 6370 0 0 /news/kentleague/maidstone/15thdec03.html 1 0 0 0 /news/551a931e4c8b2 1 5925 0 0 /news/18thmay05.html 1 0 0 0 /assets/select2/tests/data/select.html 1 400 0 0 /news/welling191017 1 4104 0 0 /news/othernews/youthleaguetables160204.html 1 0 0 0 /assets/ckeditor/plugins/liststyle/ 5 1818 0 0 /news/551a979837c89 1 6721 0 0 /news/dulwichhamlet6-1sittingbourne-brickiesshockerendsplay-offhopes 1 5804 0 0 /news/hollandsblair4-3lyddtown-wewerentatourbesttodayadmitsblairbosspaulpiggott 2 20858 0 0 /news/bromley300417 2 7240 0 0 /news/chathamtownbosspaulfoleyquizzesfaoverconcernsoverplayerssafety 2 9315 0 0 /news/nationalleague200516 4 19417 0 0 /news/wehavesignedamanwhohaswonlotsinnon-leaguefootballsaysvcdathleticbosstonyrussell 4 14394 0 0 /news/551bc99b99777 2 10546 0 0 /news/eritroch100215 3 30245 0 0 /news/erithbelvedere0-4afcsudbury-iwillneverresigninsistsstrugglingbosschriscosgrove 1 9333 0 0 /news/fisher191117 3 14265 0 0 /news/saturdaysmatchreports-2 1 2542 0 0 /news/551bc5de04a88 3 10532 0 0 /news/chinoreturnstosladegreen-exclusive 1 2946 0 0 /news/dawsonpenslengthydealtostayatthamesmead 2 8161 0 1 /news/rochseve220316 8 177797 3 3 /news/cumberbatchrallieshistroopsfordoverdate 2 7630 0 0 /news/whitstable030720 4 16529 1 1 /news/551a9798a59c5 4 18706 0 0 /news/551a9678173fb 1 3993 0 0 /news/551a9cf4ef32f 2 13190 0 0 /news/ticketsforprincesparkopenernowonsale 3 11230 0 1 /news/551bc5dce0939 1 3915 0 0 /news/551a96dc50199 4 25243 0 0 /news/unbeatenchatsexpectstonesreaction-exclusiveinterviews 4 18348 0 0 /news/wedonotwantneilcugleytoleavesaysfolkestoneinvictachairmanmarkjenner 2 7184 0 0 /news/551bc5dbd8ba0 4 28191 1 1 /news/551bc5e8a40df 2 6584 0 0 /news/ebbsfleetunitedyourviews 1 2699 0 0 /news/phoenix281217 1 3868 0 0 /news/faversham280816 2 8905 0 0 /news/ihopetoseedeanhillinaramsgateshirtagainsayschairmanphilfennell 4 16068 0 0 /news/kentleague/hernebay/1stjuly03.html 2 0 0 0 /news/vcdgreen081016 2 21852 0 0 /news/kentleaguecupfinalfiskdelightedwithtop-fourfinish-exclusive 1 4342 0 0 /news/drmartens/eastern/sittingbourne/sittvbash061203.html 1 0 0 0 /news/imlookingforwardtothefuturesayskinnearexclusiveinterview 1 3518 0 0 /news/mersmarg141118 3 30204 0 0 /news/sittingbourne1walthamforest1 4 17782 1 0 /news/551a99e4102d9 1 3154 0 0 /news/iwantedafreshchallengeadmitsgoodwin 1 4198 0 0 /news/wevegottobeatourbesttowinitsayscorinthianbosstonysitford 1 4326 1 0 /news/25thfeb05A.html 2 0 0 0 /news/3rdnov03.html 1 0 0 0 /news/tunvseven240404A.html 1 0 0 0 /news/favershamtown4-4mersthamaetfavershamwon5-4onpenalties-anexcitingnight-saysluchford 2 14129 1 0 /news/551bc99de29cd 1 4709 0 0 /news/martineedestepsdownasfisherchairman 1 3549 0 0 /news/21stdec04.html 1 0 0 0 /news/craywanderers220221 4 23128 1 1 /news/fisherp-pharingeyborough-cuptiefallsforthesixthtime 1 2894 0 0 /isthmian-league/22 8 39699 1 0 /news/551a97995dbaa 2 8454 0 1 /news/weretryingtoprogresstothenextlevelsaysfavershamtownbossrayturner 1 4650 0 0 /news/ryman/bromley/slouvbrom121103.html 1 0 0 0 /isthmian-league/36 10 48085 0 0 /news/howtomakeadonationtoassistwithrunningcosts 2 5343 0 0 /news/craywanderers1-2maidstoneunited-probablyoneofmyworstdefeatsivesufferedadmitsjenkins 2 12369 2 1 /news/23rdjuly03.html 2 0 0 1 /news/harewecanhandleexpectationlevels-exclusive 2 11342 0 0 /news/tabletoppingdoverfaceselectionheadache 2 7620 0 1 /news/bromley211117 3 14751 0 0 /news/therewillbemanymoretwistsandturnssaysdoverathleticbossnickyforster 1 4364 0 0 /news/lashingsownerpullsoutofstonestakeoverbid 2 8184 0 0 /news/grantwantstocasthisspellatfirstteamlevel-exclusiveinterviews 1 5198 0 0 /news/winningthekentleaguetitlewillbeamiracleforusadmitsfavershambossluchford-exclusive 1 4265 0 0 /news/thamesmeadtown1-0tunbridgewells-cablesclassprovestobedifference-exclusive 1 6656 0 0 /news/weregoingtogiveiteverythingthatwevegotsaysbromleybossmarkgoldberg 3 19302 0 0 /beckenham-2003-2006/3 3 8268 0 0 /news/551a96db3d2c3 1 3353 0 0 /news/551a9677c63ca 1 3670 0 0 /news/thefacupprizemoneyonofferismassivetolordswoodsaysbossjasonlillis 3 11176 0 0 /news/hopefullywecanbeinfavershamspositionnextyearsaysbeckenhamchairman 1 3840 0 0 /news/itsachancetoprovewerethebestsideinkentsaysgillinghambossianvarley 1 3461 0 0 /news/fisher1-1erithtown-welikeleavingitlateadmitslisney 1 5857 0 0 /news/retiredskinnerthinksabouthisnextmove 1 3977 0 1 /news/whitstable190819 3 10239 0 0 /news/551a979a6c067 1 5204 0 0 /news/resultsnovember2018 4 39321 0 0 /news/maidstoneunited1-2favershamtown-werecompetingwithandbeatingthebestsaysrayturner 3 32234 0 0 /news/threesev180919 4 32436 0 0 /news/halseywemustprovetooursupportersthatwereagoodside 2 6630 0 0 /news/ibelievewewillgetoutofthebottomfoursaysthamesmeadtownbosskeithmcmahon 5 22446 1 0 /news/upbeatseagerplottingcupupset 1 4441 0 0 /news/phoenixsports200320 2 7334 0 0 /news/ineedtwostrikerstostandanddeliversaysbeckenhamtownbossjasonhuntley 2 9881 0 0 /news/551bc5d96bbb7 2 7808 0 0 /news/aldebrom130819 5 47232 0 0 /news/thamdart160716 4 57262 1 1 /news/beckerithtown071015 4 38026 0 0 /news/billtonb120417 3 31275 0 0 /news/ramscrys130719 6 54438 1 2 /news/dealtown170120 2 8360 0 0 /news/southernyouth/12thjuly03.html 2 0 0 0 /news/folkestoneheadtoleytonatfullstrength 2 12036 0 0 /news/sittingbourne2-0whitehawk-nooneexpectedustowinadmitsjoedowley 2 14222 0 0 /news/someonesgoingtogetagoodhidingwarnswarrilow 1 4234 0 0 /news/kentleague/whitstable/whitstablevdeal250803.html 1 0 0 0 /news/folkestone-saunderssigningisourbestforyearsadmitscugley 5 45727 2 2 /news/worthing0-0beckenhamtown-wereabitguttedwehaventwonadmitsproudmichaelmarks 1 8395 0 0 /news/sloughtown2folkestoneinvicta0 1 4718 0 0 /slade-green-2003-2006/ 1 3028 0 0 /news/wellingunited1-2salisburycity-wellingplayersmissinghomecomforts-exclusiveinterviews 1 6352 0 0 /news/visitingplayersraisetheirgameagainstusatparkviewroadsaysderesassistantjulianleigh 1 4147 0 0 /news/foresthillpark060718 3 13272 0 0 /news/itsagreathonourtobeinchargeofthisfantasticclubsaysnewfisherbossbillywalton 2 8548 0 0 /news/551bc5e10e365 1 5719 0 0 /news/sctelms40817 4 35290 0 0 /news/othernews/SECWFL150204.html 1 0 0 0 /archive-2006-2014/13 2 10095 0 0 /news/551a95b3b7135 1 4138 0 0 /news/551bc99d75f81 1 7660 0 0 /news/greentonb081215 4 40844 0 0 /news/farnobg210616 3 15242 0 0 /news/webelievewecangetthroughtothenextroundsaysbromleybossmarkgoldberg 1 3965 0 0 /news/thanetshowdownwillmakeorbreakourseason-yorath 2 6897 0 0 /news/tonbridge111019 12 95362 9 8 /news/hampdart051119 2 20662 0 0 /news/551a99e3d4bbf 1 3428 0 0 /news/facupspecialgiantslookforwardtofacupshowdown 1 5799 0 0 /news/beckenhamtown2-1mauritiussports-weturnedupwiththewrongattitudesayshuntley 1 7128 0 0 /news/wellingunited311219 3 12045 0 1 /news/ifancyusagainstgreenwichboroughsayskeithlevett 3 46254 3 2 /news/angelsgolive 4 12520 0 0 /news/phoenix021015 4 14133 0 0 /news/burmanvowstoenddartfordswildernessyears-exclusive 2 9166 0 0 /news/551bc99d1c621 1 6959 0 0 /news/19thsept05.html 1 0 0 0 /news/redwell170518 2 20126 0 0 /news/holmgleb140317 4 41630 0 0 /news/tunbridgewells2-0erithtown-fullersdoublekeepswellsinline 3 13105 0 0 /news/551a9c92784d1 3 19829 0 0 /news/lordswood110817 1 3240 0 0 /news/drmartens/eastern/chatham/17thoct03.html 1 0 0 0 /news/cugleyreleasescontractedstrikerasthingsareabittightatfolkestone 3 12163 0 0 /news/551a9798be265 2 10854 1 0 /news/rymanleagueinitiativewillraiseafeweyebrowsadmitsturvey 1 3470 0 0 /news/liftingkentseniorcupwilltopoffagoodseasonsaysabbott 1 4435 0 0 /news/hamilton-omolethankfulforhistimeonloanatfolkestone 2 9458 1 1 /news/itswhathappensonthepitchthatcountssayslovell 1 4366 0 0 /news/ashbyfuriousoverpenaltydecisionthatendedtrophycampaign 2 9471 0 0 /news/kentleague/sladegreen/sladevhyth130304.html 1 0 0 0 /news/551a97b06ee91 1 3146 0 0 /news/johnwilfort030317 1 3856 0 0 /news/metcalfpredictsopenkentleaguetitlerace 1 3602 0 0 /news/fordgetbehindourboysandcutoutwokingabuse 1 3926 0 0 /news/551bc5dc1bf02 1 3799 0 0 /news/seagersnapsupkentleaguestars 1 3831 0 0 /news/551bc5e629c30 1 4762 0 0 /news/kfu080416 3 11712 0 0 /news/staines230405.html 2 0 0 0 /news/sittingbourne1-2eastbournetown-wedeservedsomethingoutofthegameadmitsmarcseager 1 6935 0 0 /news/imayhavetocutthebudgetwarnscraychairman 1 4117 0 0 /news/itwasadifficultdecisiontoleavesittingbourneforleatherheadsaysrichardbrady 1 3954 0 0 /news/refereehasprobablymadetherightdecisionsaysjamieday 1 4571 0 0 /news/sittingbourne0-0bathcitylovellpleasedwithdrawasbathrunsdry-exclusiveinterview 1 5254 0 0 /news/551bc5e151028 1 5020 0 0 /news/drmartens/eastern/erith&belvedere/29thsept04.html 1 0 0 0 /news/serverproblems 1 2628 0 0 /news/snodlandtown130219 2 6532 0 0 /news/tunwells060917 1 4015 0 0 /news/milestargetstenpointsforsafety-exclusiveinterview 2 12340 0 1 /news/soccershorts030720 3 13799 0 0 /news/551bc99b23049 1 4314 0 0 /news/wellshavelinkswiththefamous 4 17904 0 0 /news/isthmianleague170820 3 11925 1 1 /news/ryman/bromley/thurrockvbfcfac141003.html 1 0 0 0 /news/beckbrom270715 4 36276 0 0 /news/bromvwhyt280204.html 1 0 0 0 /news/10thaug04.html 1 0 0 0 /news/yorathquitsmargateicouldntgetenoughoutofmyplayers 2 8895 0 0 /news/551a9c0f3ed04 1 4220 0 0 /news/551a931e665ce 1 3328 0 0 /news/lydd290517 3 11016 0 0 /news/icantcommittorymanleaguefootballadmitsherobutton 1 3393 0 0 /news/holmesdalemaintaintheirkentleaguestatuswithfloodlightinggrant 1 3974 0 0 /news/ifeelmyteamarestillfindingtheirfeetsaysramsgatebosstimdixon 3 12794 0 0 /news/punjab291217 3 11034 0 0 /news/hampdulw201015 4 33879 0 0 /news/hopefullywellbeabitmoresuccessfulwiththeresultssayschathamtownbosskevinwatson 1 4290 0 0 /news/tottenhamhotspur200421 63 241752 4 35 /news/6thmar05.html 1 0 0 0 /news/551a931e756f7 7 86355 2 3 /news/ineedafewbobtobringincharacters-butler 1 5128 0 0 /news/ryman/bromley/T&Mvbrom060304.html 1 0 0 0 /news/folkestone100716 1 4420 0 0 /news/drmartens/eastern/dartford/23rdsept03.html 1 0 0 0 /news/avelcars161219 2 12152 0 0 /news/youdontwanttolosetoyourtenantssaysholmesdalecoachrossmitchell 1 4064 0 0 /news/15thaug03.html 2 0 0 0 /news/sampsonappreciatesmessagesofsupport 1 3245 1 0 /news/parkinsonbidsfortescocupglory 1 4986 1 0 /news/551a979879e81 1 3639 0 0 /assets/select2/ 8 4536 0 0 /news/kentleague/ramsgate/4thnov03.html 1 0 0 0 /news/551bc99c45ee5 2 12972 1 1 /news/551bc5ddc7132 1 4076 0 0 /news/facupspecialdaishisfleetsbest-edwards 1 4847 0 0 /news/bromley301215 4 14534 0 0 /news/theresmoretocomefromusinsiststonbridgeangelsbosstommywarrilow 3 15014 0 0 /news/tonbridgeangels1-0craywanderers-angelsbossdedicatescupfinalwintomaddams-exclusive 1 4934 0 0 /news/metrogas010519 3 11825 0 0 /news/crockenhillbossstevedeveruxstrengthenshismanagementteam 4 14137 0 0 /news/holmesdale101019 3 11489 1 0 /news/notmanyclubswilllookforwardtotravellingtohernebaysaysbosssamdenly 2 7470 0 0 /news/ashford260518 5 19467 0 0 /news/chathamtown0-1whyteleafe 1 3507 0 0 /news/cuprunhelpsmytransferkittyrevealspennock-exclusiveinterview 3 15464 0 0 /news/wearealldesperatetodowellsaysdoverathleticbosschriskinnear 1 4285 0 0 /news/wellbethesurprisepackagethisseasonsayslovell-exclusive 1 4929 0 0 /news/itsveryfrustratingknowingthatteamsfrombelowcanleapfrogoveryou-bexliansfc 1 5614 0 0 /news/ashfordtownsuffertournamentpenaltyheartbreak 6 33405 0 0 /news/fisher0-2erithbelvedere-thiswinisntgoingtodecidetheleaguesaysmickycollins 1 9713 0 0 /news/thefacarlsbergvasefourthrounddraw 1 2797 0 0 /news/551a956b6cc8b 2 6706 0 0 /news/chathamtown2-0leatherhead 1 3554 0 0 /news/rochester111218 3 9639 0 1 /news/starscomeoutforcharitygame 3 10542 1 1 /news/greenwich250118 1 4744 0 0 /news/10thjan05.html 2 0 0 0 /news/maidstoneunited3-0craywanderers-werenotacceptingourfatesayscraybosskeithbird 1 9722 0 0 /news/asadtimeforkentfootball-restinpeaceroyvinter 1 4505 0 0 /news/letsmakeitagoodfridaysayscugley 1 5576 0 1 /news/icametotheclubtogetthisteamtothekentleaguesayshollandsblairbosspaulpiggott 3 11789 0 0 /news/itsgoingtobehardtogetoutofrelegationnow-oconnell 2 7065 0 0 /news/beckenhamtownadmitdefeatinsheringhampublicitystunt 1 5097 0 0 /assets/smartmenus/addons/bootstrap/ 5 2017 0 0 /news/phoenix210918 3 11091 0 0 /news/hollandsblair140116 4 16358 0 0 /news/551bc5e15be78 1 4267 0 0 /news/dartschairmanforgetaboutthepastandenjoytheocassion-exclusiveinterview 5 22010 0 0 /news/countdowntoprincespark12days-burmanexpectsaverytoughtestagainsttanners 1 3856 0 0 /news/vcdathletictakeuphastily-arrangedfriendlywithcharltonathletic 1 3354 0 0 /news/551a97b05bbdb 1 3452 0 0 /archive-2006-2014/216 2 8761 0 0 /news/wenowwanttopushontogettothefinalsayscorinthianbosstonysitford 2 10491 0 0 /news/vineswillsettlehisfuturebymonday-exclusive 1 4106 0 0 /news/ryman/bromley/bromvfolk230304.html 1 0 0 0 /news/lordswood2-2greenwichborough-lordswoodisagreatplacetobearoundatthemomentsayslillis 1 5987 0 0 /news/4thsept05.html 3 0 0 0 /news/sutton050617 3 10170 0 0 /news/bradbrookboostforburman 1 4512 0 0 /news/551a9c9197648 2 8174 0 0 /news/gravesendnorthfleet1-3kidderminsterharriers-daishwereavictimofourownsuccess 5 54779 2 2 /news/croydon100818 2 7328 0 0 /news/upwardsof50khasbeenpaidoutforhistoricaldebtsconfirmdulwichhamletowners 4 19002 0 0 /news/peckhamtown150620 8 29714 1 1 /news/bromley160417 2 11524 0 0 /news/kentleague/tunbridgewells/7thnov04.html 1 0 0 0 /news/maidstone110918 3 12414 0 0 /news/wecandobetteronourownbigpitchsayshernebaybosssimonhalsey 1 4346 0 1 /news/weregoingtostuffsomeonesoonwarnsdartsboss 1 6056 0 0 /news/vitalwineasespressureoffmilesandhisfamily-exclusiveinterview 1 4000 1 0 /news/bowey190804.html 2 0 0 0 /news/itsnotgrimupnorthinsistsmeadsmcmahon 1 4822 0 0 /news/drmartens/eastern/folkestone/10thnov04.html 1 0 0 0 /news/dulwich050317 1 4339 0 0 /news/551bc5d945d85 2 8671 1 0 /news/whitstabletown1-4craywanderers-wevegotarealchancetowintitle-jenkins 2 10807 1 0 /archive-2006-2014/ 1 4828 0 0 /news/play-offsemi-finalspecialimnotcontemplatingfailuresayswarrilow 3 16825 1 2 /news/551bc5e03d01f 2 9902 0 0 /news/11thmar05.html 1 0 0 0 /news/14thoct04.html 1 0 0 0 /news/thamesmead260916 2 7108 0 0 /isthmian-league/2 6 42155 1 2 /news/mcdonaldscoresonhisdreamdebut 1 3817 0 0 /news/wevegotamountaintoclimbbutmountainsdogetclimbedsaysdartfordbosstonyburman 3 14635 0 0 /news/fisher220219 4 15158 0 0 /news/dealtown190819 3 9888 0 0 /news/551a97b09a698 1 3316 0 0 /southern-counties-east-football-league/24 5 26011 0 0 /news/losingjointtopscorerisamassiveblowtoplay-offchasingsittingbourne-exclusiveinterview 3 13733 0 0 /news/11thsept05.html 2 0 0 0 /news/551a9b48253cd 4 12747 0 0 /news/551a99e434fe1 1 3480 0 0 /news/bearsteadu18120904.html 1 0 0 0 /news/551a99e40cd48 1 4988 0 0 /news/imlisteningtoofferssaysbowden-brown 2 6902 0 0 /news/cable-itsdecisiontime-exclusive 1 4212 0 0 /news/26thsept04.html 1 0 0 0 /news/lewiscontroversialmovetomargatehangsinthebalance 2 8485 0 0 /news/favershamaimingtobreakintotopsix 1 5563 0 1 /news/bromley240318 4 18586 0 0 /news/holmesdale2-4beckenhamtown-wewereonadifferentplanettothemsaysmichaelmarks 1 8121 0 0 /news/kentleague/greenwich/2nddec04.html 1 0 0 0 /news/craywandererschairmangaryhillmanbidsfororpingtonsite 3 10984 0 0 /news/551bc5dd3d6ee 3 11710 0 0 /news/itsgoingtobeareallydifficultperiodaheadwarnsbromleybossmarkgoldberg 1 4654 0 0 /news/551bc5e43c3e8 3 11534 0 0 /news/oakwoodpitchcakedinsnow-kentseniorcuplasteightdraw 2 6812 0 0 /news/erithbelv240316 4 16613 0 0 /news/itsnotimpossiblethinkingaboutbeatingthem-butwevegottoplaytoourmaximumsayshayes 1 4050 0 0 /news/551a99e353443 1 4916 0 0 /news/charlherne270116 4 43162 0 0 /news/thorogoodwecameupagainstaqualitystriker-exclusive 2 9374 0 0 /news/greenwich200915 4 24801 0 0 /assets/fonts/academy/academy_engraved-webfont.woff2 1 30276 0 0 /news/6thjan05.html 2 0 0 0 /news/canterburycity201219 4 14428 0 0 /news/mundayfocusesonstartingwellatwhitstable 1 5065 0 0 /news/dealsitt120920 7 121080 1 0 /news/551bc5dc78262 2 8458 0 0 /news/tunbridgewells301105.html 1 0 0 0 /news/tonbridgeangelsbossstevemckimmunwrapsstrikerjoetaylorfromunderneathhischristmastree 2 6886 0 0 /news/tootingmitchamunited1-0chathamtown-binkstellsdovermyplayersgaveabsoutelyeverything 1 5843 0 0 /news/healthsafetyhasgonemad-burman 2 11864 0 0 /news/drmartens/eastern/folkestone/27thaug04.html 1 0 0 0 /news/wellingunitedsplashouttomeetconferencepremiergroundgrading 2 7874 0 0 /news/551a956c18dcc 2 6890 0 0 /news/bromley2-1bishopsstortford-chelmsfordwillbeourbiggesttestsofaradmitshaydenbird 1 7436 0 0 /news/margate3-0afcwimbledon-imsodelightedwithwhatwevegotheresaysmargatebossterrybrown 4 33618 0 0 /news/aveley0-3margate-yorathpleasedwithdefensivequalities 1 4784 0 0 /news/erithshepp210216 6 73047 1 0 /news/2ndoct05.html 2 0 0 0 /news/seageraimingforninepointsoverfestiveperiod-exclusiveinterviews 3 16148 0 0 /news/kentleague/sladegreen/sladevseven090304.html 1 0 0 0 /news/underdogsaimingtobringtrophyhome-exclusiveinterviews 1 4238 0 0 /news/thamrams270115 3 32234 0 0 /news/statement010320 3 12349 1 0 /news/gillingham190620 7 21408 0 1 /news/weregoingtowembleywhatagreatachievementforaclublikeebbsfleetsaysdaish 1 5101 0 0 /news/leatherheadweremyfavouritesbeforetheseasonstartedsaysfolkestoneinvictabossneilcugley 2 10790 0 0 /news/551bc5deb735b 2 7950 0 0 /news/chathamtown2-1craywanderers 1 3587 0 0 /news/fisher030816 5 49630 3 3 /news/kentrivalsconfidentofbookingtriptoharrow 1 4719 0 0 /news/coriasco301119 2 21598 0 0 /news/corinthian-casuals3-1ramsgate-weweresecondbestadmitsramsgatebosstimdixon 1 8067 0 0 /isthmian-league/13 6 29364 0 0 /news/wehavetogiveourselvesachancesayshessenthaler 2 10307 1 0 /news/551bc5e46c9f5 2 8196 0 0 /news/wemustmaintainourhighstandardsinsistsobrien 2 9174 0 1 /news/551a971899cbb 4 16706 0 0 /news/ianjenkinspoundsthestreetsoflondontoraisefundsforcharity 2 6635 0 0 /news/551bc5dd7e602 3 12803 0 0 /news/wevejustbrokenrecordafterrecordthisyearforcertainthingssayslordswoodbossjasonlillis 2 8622 0 0 /news/vickersbossfoleyunveilsnewsonashisnewnumbertwo 1 4798 0 0 /news/bromley020618 10 109064 5 7 /news/imnotgoingtomargateinsistsward 2 11140 0 0 /news/lordswood260118 2 7381 0 0 /news/carshaltonathletic0-1maidstoneunited-itsgoodtohavesaundersonboardsaysnott 1 6345 0 0 /news/folkestoneinvicta1redbridge0 4 17430 0 0 /news/551a9678d364c 1 5641 0 0 /news/wellmakesurethechipsaredownvowsmorgan 2 8792 0 0 /news/theclubisgoingintherightdirectionsayswoodstocksportsbossbentaylor 1 4875 0 0 /news/kentleague/greenwich/7thjuly03.html 2 0 0 0 /news/ashfordunitedfc.com 1 0 0 0 /news/doverathletic1-2woking-fansarenotseeingusdoaswellasiknowwecanadmitshayes 1 7411 0 0 /news/551a97991927f 2 9704 0 0 /news/langtonourmindshavetoberighttoavoidgiantkilling 2 8332 0 0 /news/bromfolk061016 4 41782 0 0 /news/17thaug05.html 2 0 0 0 /news/lovellplaysthewaitinggame-exclusive 2 7506 0 0 /news/wembleywinnersmyproudesteverday-mcphee 2 11198 0 1 /news/drmartens/eastern/folkestone/folkvbanb310104.html 1 0 0 0 /news/itsabiggameincontexttowherewebothareintheleaguesaysdulwichhamletbossgavinrose 2 7390 0 0 /news/onlyhavingoneteamgoupautmaticallyintherymanleagueisharshsaysjaysaunders 5 24395 0 0 /news/hessenthalerdropsbombshellbyreleasingcollin 1 3951 0 0 /news/hythe290116 4 15290 0 0 /news/28thapr05.html 1 0 0 0 /news/goals020915 8 58597 2 0 /news/greenwich110117 1 3992 0 0 /news/cluelesseduseifacesfansbacklashforcupelimination 4 39228 2 1 /news/othernews/Tables.html 1 0 0 0 /news/sevenoakstownfc.co.uk 2 0 0 0 /news/551bc5e3694eb 1 4742 0 0 /news/winningisagoodhabittohavesaysdoverathleticbosschriskinnear 5 21991 0 0 /news/ijusthopegeorgecangetbetterandseejusthowmuchpeopleappreciatehimsaysrichmondkissi 4 29558 0 0 /news/greensitt161217 1 10770 0 0 /news/mygreatestachievementofmymanagerialcareersofarsaysmartinhayes 1 4620 0 0 /news/fordthingscanonlygetbetter 2 8709 0 0 /news/faversham200720 3 9559 0 0 /news/collinslarkin120515 8 75590 3 4 /news/sittingbourne201116 1 4526 0 0 /assets/smartmenus/libs/ 8 3183 0 0 /news/551bc5db27b09 2 10904 0 0 /index/Mobile/fenshi 1 4630 0 0 /news/ashfordzanone240515 6 21415 1 1 /news/551bc5e1347da 1 4507 0 0 /news/becktunb201020 4 32480 0 0 /news/NationalLeagueStatement160421 62 212995 1 38 /news/luchfordfumingasfavershamgoofftherails 1 5989 0 0 /news/20thmar05.html 1 0 0 0 /news/tunwells291216 2 8042 0 0 /news/wearenolongerpushoversinsistswhitstablechairman-exclusiveinterivew 4 20996 0 0 /news/551bc5e540850 2 13784 0 0 /news/gettingsentoffonmydebutwasstupidadmitshagan 2 7819 0 0 /news/othernews/coneyhall160304.html 3 0 0 1 /news/ihavesetatargetofatoptenfinishsayskentfootballunitedbosssammacneil 3 12968 0 0 /news/551a92504c460 2 6852 0 0 /news/corinthian070220 4 17448 0 0 /news/craytunw271116 2 21216 0 0 /news/december2010results 2 11785 0 0 /news/burmanaddsstrengthtohistitle-chasingsquad-exclusive 2 13068 0 0 /news/asalong-timesupportericannotbeleivethatihavebeenvotedinaschairman-jessicamcqueen 1 4238 0 0 /archive-2006-2014/267 2 8674 0 0 /news/551a9cf5a1fc1 1 4268 0 0 /news/ashfordtownunveillangleyasnewreserveteamboss 5 16987 0 0 /assets/datetimepicker/ 9 5998 0 0 /news/chipstead1-4chathamtown 2 7472 0 0 /kent-invicta-league/25 2 9184 0 0 /greenwich-2003-2006 12 34825 0 0 /news/551bc99ce6b68 1 4571 0 0 /news/raynesparkvale0-1croydon-imlookingforcommittedplayerssayscroydonbossdicksongill 6 79624 1 1 /news/551a95b42a5f1 4 20382 0 1 /news/weneedtostepitupifweregoingtomakeaseriouschallengesaysfisherbossstevefirkins 1 4122 1 0 /news/551a99e5203dd 1 7032 0 0 /news/londonlions1-2fisher-ithoughtitwasagoodtestsaysfisherbossstevefirkins 4 71783 3 3 /news/hernebaybreakthebanktore-signking 2 7706 0 0 /news/bracfolk150119 3 29463 0 0 /news/greeniesfridaypreview-1 4 23688 0 0 /news/soccershortscroydoncontinuesearchfornewcoach 1 4636 0 0 /news/rusttunw050716 13 317935 9 8 /news/551a956b676cb 1 2854 0 0 /news/baldacchinowecouldnotreachourtargets-exclusive 1 3499 0 0 /news/bromley170716 3 9867 0 0 /news/afccroydonath050216 4 14990 0 1 /news/trophywinningbossinstilsanovermydeadbodyattitudeintohisplayers-exclusiveinterview 4 19548 0 0 /news/payingoverduetaxbillhastakentheweightofmyplayersshoulderssaysjamieday 1 7306 0 0 /news/premiershiprefofficiatessykochallenge 3 11536 0 0 /news/erithbel301117 3 11682 0 0 /news/tommysampsonbenefitnightletsraisefundsfortommy 1 4103 0 0 /news/551a979ad56c6 2 12449 0 0 /news/rednoseday2011 2 5773 0 0 /news/soccershorts190619 4 17170 0 0 /news/margateunveilnewstriker 3 8119 0 0 /assets/datetimepicker/package.json 1 715 0 0 /news/werenotgettingoverexcitedsaystonbridgeangelsassistantalexobrien 1 4938 0 0 /news/bromley061120 6 20706 0 0 /news/551a97b0c6312 3 13290 0 0 /news/afccroydonathletic121018 4 15215 0 0 /news/dealtown130919 4 13876 0 0 /news/551a97b22cc73 1 4273 0 0 /news/crayvalley010917 1 3514 0 0 /news/thewaitgoesonfordartsfans 5 20633 0 0 /news/551a9718a635b 4 13682 0 0 /news/551a967912b49 1 3100 0 0 /news/thamesmead251215 3 11919 0 0 /news/kentleague/sladegreen/15thsept04.html 1 0 0 0 /assets/select2/tests/data/base.html 1 248 0 0 /news/idontfearanyonebutirespectthemsaysdockersbosstonyrussell 1 5440 1 0 /news/drmartens/eastern/folkestone/folkvhavantfatreplay021203.html 1 0 0 0 //wp-content/ 2 7086 0 2 /news/drmartens/eastern/folkestone/folkvstev100104.html 1 0 0 0 /news/551bc5e7d44e3 2 6936 0 0 /news/551a931d99512 1 3825 0 0 /news/lordvbeng130304.html 1 0 0 0 /news/doyouronlineshoppingwithkentishfootball 1 3222 0 0 /news/whitstable140617 1 4029 0 0 /assets/fonts/glyphicons-halflings-regular.ttf 1 41280 0 0 /news/nickysouthallisagreatsigningforwhitstabletownsaysbossjustinluchford 1 5005 0 1 /news/tunwells140816 2 8981 0 0 /news/rusthollyoak110515 3 13016 0 0 /news/dolbyseeksunbeatenspelltoboostpromotionpush 2 7818 0 0 /news/ithinkitwouldbegoodforkentfootballifweplayeddartfordinplay-offfinalsaysjamieday 1 5273 0 0 /news/wellingunited0-0suttonunited-wecamebackhomeandfinishedthejoboffsaysjamieday 1 7210 0 0 /archive-2006-2014/9 5 25262 0 0 /news/iamobviouslydelightedtobeappointedasmanagerofsuchagreatclubsayssamdenly 3 9604 0 0 /news/wevegottheheartdeterminationandspirittogetusthroughsayskeithmcmahon 5 30321 0 0 /news/wellbrom061015 3 30867 0 0 /news/kentleague/beckenham/30thjune03.html 2 0 0 0 /news/weremorethancapableofgettingaresultatbognorregistownsaysjaysaunders 2 8358 0 0 /news/kfu110817 4 14656 0 0 /assets/ckeditor/plugins/iframe/dialogs/ 1 372 0 0 /news/crayhors090319 3 27882 0 0 /news/folkestone220518 1 3452 0 0 /news/beckenham090920 3 15458 0 0 /news/wehavetogotothurrockthinkingwecanwinitsaysvickersbossrickybennett 1 4142 0 0 /news/margatemaketheirpointathastings 2 7088 1 0 /news/mergerwillstrengthenbothclubssaysmikedrabble 5 19295 1 0 /news/hernebay1-3folkestoneinvicta-weknowwecanbeanotheranotherlevelsaysneilcugley 2 19372 0 0 /news/theladshaveenjoyedtheexperienceanditwillinspirethemtomoveonsayschriskinnear 1 5162 0 0 /news/erithandbelv260715 4 14722 0 0 /news/doverathleticsnapupdavisonone-yeardeal 1 3390 0 0 /news/relegationbattleisgoingdowntothewiresayslovell 1 4531 0 0 /news/margatesignhockton 3 8119 0 0 /news/beckcori060115 2 19012 0 0 /assets/ckeditor/plugins/table/ 5 1808 0 0 /news/othernews/13thsept03.html 1 0 0 0 /archive-2006-2014/71 4 20288 0 0 /news/ramsgatedontfearbrightoninfayouthcupshowdown-exclusiveinterview 1 4524 0 0 /news/foleyspatienceisrewardedasbartonfinallysigns 2 8218 0 0 /news/551bc5e38531b 1 4897 0 0 /news/bromley1-2folkestoneinvicta-invictahumblebig-spenders 2 8184 0 0 /news/hernebaycelebrateshieldsuccessincludessaturdaysheadlines 5 32761 0 0 /news/midweekfixtures-1 2 9720 0 0 /news/551a92505a9d6 2 6822 0 0 /news/othernews/AEI221104.html 1 0 0 0 /news/sportphoe040518 3 27375 0 0 /news/chathamtown090120 2 7460 0 0 /news/551bc5dd46f0f 3 11956 0 0 /news/wehaveathree-yearplanandexpecttoseeitthroughthegoodandbadtimessaysramsgatechair 3 14228 0 0 /news/sittingbourne180119 4 17286 0 0 /news/crayvalley130217 1 3850 0 0 /news/bridgleb010317 4 40692 0 0 /news/2ndjuly05.html 1 0 0 0 /news/cantleic020219 6 62013 0 0 /news/greeniesfridaypreview7thapril2006 1 5685 0 0 /news/thamhyth160817 2 17638 0 0 /news/charltonathletic090421 57 243005 4 23 /assets/smartmenus/css/sm-blue/css-gradients-fallback/ 1 472 0 0 /news/welling270817 2 6882 0 1 /kent-county-league/3 5 39628 2 1 /news/29thmar05.html 1 0 0 0 /news/soccershortsconferenceclubstoldtogettheirfinancesinorder 1 12152 0 0 /news/551bc5e83ba86 2 8152 0 0 /news/havantvbromfayc020903.html 1 0 0 0 /news/elmstead191117 3 11607 0 0 /news/wecertainlycantaffordtolosetophoenixsportsadmitsbearstedbosstonycornwell 2 8318 0 0 /news/arleseywillbedifficulttobreakdownsaysramsbossjimward 2 34042 0 2 /news/burmanreadyforsudburyshowdown 1 3920 0 0 /news/11thdec03.html 1 0 0 0 /news/fisher170417 2 9141 0 0 /news/fisher2-2tunbridgewells-wevedroppedtoomanypointstowintitlesaysmartinlarkin 1 10785 0 0 /news/29thsept05.html 1 0 0 0 /news/wehaveanumberofexcellentyoungstersatthisclubsaysstonesyouthboss-exclusive 1 5331 0 0 /news/551a96dc7d958 1 3421 0 0 /news/eritpeac110819 3 25350 0 0 /news/croydonathleticresignfromrymanfootballleague 1 3736 0 0 /news/newportvsitt261003.html 2 0 0 0 /news/551a99e4ddf27 4 29470 0 0 /news/seagullsofferrookaone-weektrial 1 5281 0 0 /news/soccershortscrayvalleystrikerchrismcgintytrainswithenglandsquad 3 45746 0 0 /news/thamesmead181204.html 1 0 0 0 /news/551a956d08a5b 1 6669 0 0 /news/soccershortsdaishforcedtooffloadallofhisnon-contractedplayers 2 11213 0 0 /news/ashfordtown0-1tilbury-imdisappointedthatwereoutsayslovell 1 4954 0 0 /news/resultsmarch2019 4 38326 0 1 /news/ryman/bromley/bromvkingsfr290803.html 2 0 0 0 /news/551bc5e2ae300 6 85607 1 0 /news/kentcounty/20thnov03.html 1 0 0 0 /news/itsbeenamixedfewweeksadmitsramsgatebossjustinluchford 3 13659 0 0 /news/hythe240217 1 4473 0 0 /news/itstimefortheclubandustoseekanewdirectionsayswalker 2 9568 0 0 /news/craywands281217 1 4022 0 0 /news/chartott140416 4 35735 0 0 /news/oboyletakesupdalersjob 2 6374 0 0 /news/theideaistoalwaysimprovesayschathamtownbosskevinwatson 4 16106 0 0 /news/wecantaffordtoloseanymoregamessayshollandsblairbosspaulpiggott 2 8714 0 0 /news/551bc99e29a64 1 7742 0 0 /news/deal030915 4 16825 0 0 /news/KLvsitt210204.html 2 0 0 0 /news/551a9c9180444 1 3777 0 0 /assets/images/ 8 8015 0 0 /news/soccershortsliamdaishstransferdealingshanginthebalance 2 24952 0 0 /news/clubsshouldgivereserveplayersmoreofachancesaysfree-agentheywood-exclusive 2 11282 0 0 /news/ramsgate200919 3 9235 0 0 /news/goingfull-timecanbedone-butnotattheexpenseofbringingtheclubdownsaystonyburman 1 5244 0 0 /news/theresnoreasonwhychathamcantbetopsixwithasmallbudgetsaysmiles-exclusive 1 4722 0 0 /news/1Jan2004.html 1 0 0 0 /news/homelands300117 4 17828 2 0 /news/charlton241015 3 10593 0 0 /news/drmartens/eastern/folkestone/cray091104.html 1 0 0 0 /news/angelsmakestarkeysstaypermanent 2 6148 0 0 /news/dartsfansarenotbeingkeptinthedark 3 9403 0 0 /news/rusthall030817 2 9084 0 0 /news/favershamtown3-1doverathletic-peoplewillhavetowaitandseewhatsurpriseswehave-joynes 1 7566 0 0 /news/thereareplacestoplayforsaysashfordunitedbosspaulchambers 1 3872 0 0 /news/1stmar05.html 2 0 0 0 /assets/qz-print/js/ 6 2317 0 0 /news/themannerwelosttofolkestonewasnotacceptablesayshernebaybosssimonhalsey 3 11015 1 1 /news/551a99e35d461 1 3163 0 0 /news/cugleywevegottoscoremoregoalsfromadvancedpositions 3 13681 0 0 /news/someofmyplayersarentuptothisleveladmitsmcmahon 1 4168 0 0 /news/551a99e537472 1 4800 0 0 /news/conferencepairgetcampaignsunderway 5 20484 0 0 /news/wewillbouncestraightbackvowsconfidentpettit 1 4394 1 0 /news/wemustgetbacktowinningwaysathomesaysmiles-exclusive 1 4018 0 0 /news/drmartens/eastern/tonbridge/5thsept04.html 1 0 0 0 /news/551a97189c984 1 3125 0 0 /news/551bc5de97fbd 1 3647 0 0 /news/551a97b07b58e 1 4418 0 0 /news/fleetseekfurtherinvestmenttobecomeselfsufficent 3 11699 0 0 /news/551a9799dc9e4 1 4441 0 0 /news/chatham200620 4 12349 1 1 /news/wedesperatelyneedasmallinjectionoffundswarnsbromleyownerjerrydolke 1 4892 0 0 /news/551a97b2473a7 1 4070 0 0 /news/551a979ae3616 1 5350 0 0 /news/iwillcontrolournewfrenchdefendersaggression-daish 5 21578 0 1 /news/conference/margate/29thjan04.html 1 0 0 0 /news/soccershortskeithpiperstandsdownasmargateschiefexecutive 1 7626 0 0 /news/doverathleticchairmantofundnewcentrespot 1 4983 0 0 /news/drmartens/eastern/ashford/ashvsitt240204.html 1 0 0 0 /news/31stoct05.html 2 0 0 0 /news/551a96dbdd458 1 5508 0 0 /news/corinthian0-6holmesdale-itwasmenagainstboysadmitssitford 2 11195 1 0 /archive-2006-2014/146 4 18912 0 0 /news/corby130805.html 1 0 0 0 /news/wellingtown280719 4 17641 0 0 /news/didvcd150915 3 30825 0 0 /news/wevegottostringacoupleofresultstogethersaysmcmahon 1 3844 0 0 /news/iwanttobeatjenkostallysayskempster 2 10024 0 0 /news/sporkent261118 3 36186 0 0 /news/bromwell010316 4 40330 0 0 /news/garydaviesquitsasholmesdaleboss 1 3330 0 0 /news/werejusttryingtomoveittothenextlevelsayssevenacresidcupchiefleehill 3 13412 0 0 /news/drmartens/premier/dover/worthing240804.html 1 0 0 0 /news/warrilowwantsmorefluencyfromhisside 2 9621 0 0 /news/wevegoteverythingtoloseatchessingtonhookwarnshythetownbossscottporter 2 11356 0 0 /news/hessenthalerdeliverypleasesdoverchairman 1 5816 0 0 /news/551bc5e8a7b19 2 6690 0 0 /news/soccershortssladegreenunveilsimpsonastheirnewkeepercoach 2 9971 0 0 /news/wererebuildingandthingsareontheupsaysgraveshamboroughbossgrantduff 3 10000 0 1 /news/wewerentgoodenoughtodayadmitshessenthaler 1 3952 0 0 /news/doversweekofdestinyfinishoffthejobandthenthepartycanbeginsayshare 1 4303 0 0 /news/cassiusistoogoodforthekentleaguesaysoboyle 2 7609 0 0 /news/551a9c0ea4090 3 15225 0 0 /news/december2009fixtures15december2009-2january2010 1 4976 0 0 /news/ontheairwavesnewwingsbossfordpromiseschangesandhasconcernsoverplayersfitness 2 12862 0 0 /ramsgate-2003-2006 12 36806 0 0 /news/sevenoakstown2-1erithtown-myplayerscanthandlethepressureadmitslividtonyrussell 1 8318 0 0 /news/greecray010118 1 8672 0 0 /news/erithbelvedere1-2aveley-ourmainaimistostayupsayschriscosgrove 2 17524 0 0 /news/stansfield080105.html 1 0 0 0 /drmartens/eastern/erith&belvedere/9thjune04A.html 1 2532 1 1 /news/10thoct05G.html 3 0 0 0 /news/fordstepsdownaswingsmanager 2 8399 0 0 /news/551a99e3d7b48 1 3208 0 0 /news/bromley020106.html 2 0 0 0 /news/551a924fe4800 1 4524 0 0 /news/craywanderers3-2margate-wehavenodefenceadmitsbutler 2 14744 0 0 /news/20thdec03.html 1 0 0 0 /news/551a9c916d2b3 1 4582 0 0 /news/sittvchat261203.html 2 0 0 0 /news/551a9250bdea5 1 3604 0 0 /news/ramsgate301020 2 7286 0 0 /news/tonbridgeangels2-3ramsgate-ramsgettherubofthegreentoknockouttheirbogeyside 3 22123 0 0 /news/welcomebackclive 2 7844 0 0 /news/samdenlycallstimeonhiswhitstabletowncareer 2 15116 1 1 /news/weworkedoursocksoffagainsterithtownsayssevenoakstownbossdarrenanslow 1 3659 0 0 /news/sevenoakstownbossdarrenanslowdraftsintwoondual-registrations 2 6931 0 0 /archive-2006-2014/174 3 13081 0 0 /news/burmanhasnointentionofleaving 3 12721 0 0 /news/formereaglenathanielpinneydropsinattonbridgeangels 6 23234 0 0 /news/vcdathletic240719 3 12435 0 0 /news/whitstabletown2-3maidstoneunited-imdisappointedwevegotnothingfromtwogames-luchford 1 7332 0 0 /news/drmartens/eastern/tonbridge/8thoct04.html 1 0 0 0 /news/aveley050205.html 2 0 0 0 /news/ashfordtownfaceanothersummerofdiscontent 1 5330 0 0 /news/greenwich200519 5 21155 0 0 /news/drmartens/eastern/dartford/15thaug04.html 1 0 0 0 /news/wingsmournthelossofstalwart 2 6394 0 0 /news/ashfordsearchforlocaltalent-exclusive 1 4818 0 0 /news/faversham120720 3 10555 0 0 /news/551bc5e3af512 1 3946 0 0 /news/kentcoachcrossestheborder-exclusiveinterview 6 21914 0 0 /news/551bc5e8b8515 2 6864 0 0 /news/551bc5e30223e 3 16172 0 0 /news/tunbridgewells8-0holyport-martinlarkinwetorethemtopieceswewereexceptional 3 25753 1 0 /news/24thfeb05.html 3 0 0 0 /news/heybridge030905.html 2 0 0 0 /news/551bc5dc40f85 2 9788 0 0 /news/drmartens/premier/welling/margate021104.html 1 0 0 0 /news/551bc5e552630 2 12210 0 0 /news/soccershortsteamnewsfortomorrowsfriendlies-exclusive 1 3959 0 0 /news/sittingbourne3-2margate-iwanttobethechampionshipmanagersaysabbott 1 5399 0 0 /news/ithoughtwewerealwaysupagainstittogetthisgameonsaysdulwichhamletbossgavinrose 2 11782 0 0 /archive-2006-2014/67 2 9809 0 1 /news/thebigkickoffwhitstabledepletedfortheirspecialday-exclusive 2 9086 1 1 /news/sevenacre191115 5 19495 1 0 /news/allthegirlsareupforit-charltonathleticandgillinghamlockhornsinderbyshowdown 5 26472 0 0 /news/dealtown250904.html 1 0 0 0 /news/alliwanttodoisbeatramsgateinsiststakaloo 2 7069 0 1 /news/30thaug05.html 2 0 0 0 /news/thekentinvictaleagueisasteptooearlyforusadmitsotfordunitedbossdennisleigh 2 7432 0 0 /news/kentleague/sladegreen/greenwich131104.html 1 0 0 0 /news/greenwichboroughconfirmtwo-matchtourofcyprus 4 13894 0 0 /erith-town-2003-2006/2 4 10705 0 0 /news/quartetfallatthefinalhurdle 2 11792 0 0 /news/kentleague/hernebay/18thaug03.html 1 0 0 0 /news/hernebaybosssimonhalseyadmitswevewonnothingyet 1 4706 0 0 /news/sladegreensignfrenchmanonloanfrombromley 3 8986 0 0 /news/imdelightedtobegiventhechancetocarryonsaysmaidstoneunitedbossjaysaunders 3 12281 0 0 /news/sporwell250719 5 56167 0 0 /news/kentleague/sevenoaks/hernebay161004.html 1 0 0 0 /news/drmartens/eastern/folkestone/worthing231004.html 1 0 0 0 /news/wewillnotbeheldtoransomsaysdartsbossburman 2 7014 0 0 /news/hopefullywecandoourselvesjusticesayswellingunitedbossjamieday 5 24800 0 0 /news/greenwich030317 1 3287 0 0 /news/beckenham010219 4 13306 0 0 /news/weneedsomeluckonfavasetrailadmitsford-exclusiveinterview 3 11618 0 0 /news/doverathletic2-0wellingunited-wehavenothingtofearsaysunbeatenhessenthaler 2 13332 0 0 /news/vickersbossfoleyfeelsthecreditcrunch 1 5289 1 0 /news/vcd050305.html 1 0 0 0 /news/folkvstev100104.html 2 0 0 0 /news/551a97b2058ae 1 6897 0 0 /news/longhurstwieldstheaxe 2 7338 0 1 /news/rivalofferscashforstrikergash 2 6858 0 0 /news/wecanbringthetrophybacktohayeslanesaysbromleybosshaydenbird 1 4385 0 0 /news/mangotsfield111005.html 1 0 0 0 /news/wearelookingtoprogressupthedivisionssaysfavershamstrikeforcebossjohngoodwin 6 34238 0 0 /news/551bc5dd6efe2 3 12059 0 0 /news/weletdownthefansbigtimeadmitsbrowne 2 7133 0 0 /news/deal010718 2 7002 0 0 /news/weneedtocutoutthesillydrawstogetoutofthekentleaguesaysbeckscoachjasonclews 1 4701 0 0 /news/ryman/bromley/9thjuly03.html 2 0 0 0 /news/thefatrophyisagoodcompetitionandwewanttogoasfaraswecansaysjamieday 4 15868 0 0 /news/croydon240518 2 8889 0 0 /news/margate1-1bognorregistown-wewentintothegamewithpoormentalfocusadmitsoconnell 1 6590 0 0 /news/craywands270716 1 5166 0 0 /news/mcmahontakespositivesfromopeningweek 1 3918 0 0 /news/chatfav160117 4 39760 0 0 /news/bromleyontheorientthankyouforyourfantasticsupportsaysdannywaldren 1 5414 0 1 /news/kentleague/sevenoaks/16thaug03.html 1 0 0 0 /news/doverexpectover500fanstoattendtitledecider 1 3549 0 0 /news/551bc5e0f3629 1 4885 0 0 /news/551bc5e90bd30 3 20003 0 0 /news/ididnotswearattherefinsistshume 1 5059 0 0 /news/551bc5e85e01f 3 11554 0 0 /news/tonbridgeangels1-2margate 2 9736 0 0 /news/kentcountyleague300616 3 12556 0 0 /news/magnificentangelswehavenothingtofearinsistswarrilow 1 5689 0 1 /news/13jan04.html 1 0 0 0 /news/9thjan05.html 1 0 0 0 /news/itsimportantwegetbacktothelevelswecanplayatsayserithtownbosstonyrussell 1 4598 0 0 /news/551bc5ddccd3f 1 4485 0 0 /news/551bc99b17774 1 4774 0 0 /news/551a97b0b3c24 1 3212 0 0 /news/551a956bd3565 1 3728 0 0 /news/kentleague/ramsgate/ramsvlords270903.html 1 0 0 0 /news/551bc5de65be2 1 3394 0 0 /news/dartford1-1stalbanscity2-4pens-thebestgoalkeepingdisplayforyears-burman 1 7529 0 0 /news/gillinghampartcompanywithstimson 1 2943 0 0 /news/erithbelvedere3-2crayvalleypapermills-ourclassshowedintheendsaysmickycollins 1 8051 0 0 /news/thamesmead300916 2 9116 0 0 /news/551bc5df14cab 2 9310 0 0 /news/ibelievewearebuildingsomethingspecialatlewishamsayschairmanraysimpson 4 33398 1 0 /news/551a956ca282c 3 13467 0 0 /news/LondonFAStatement090420 2 6468 0 0 /news/theteamsthatgodownwillprobablybeonarecordnumberofpoints-oconnell 2 8486 0 0 /news/1stjan05.html 2 0 0 0 /news/551a9797d48d1 1 3264 0 0 /news/551bc5e84be9e 3 11166 0 0 /news/551a979b1bc3c 2 9612 0 0 /news/lyddtown161218 2 6686 0 0 /kent-county-league/5 5 37955 1 1 /news/bexleyinvictaflytheflagforgay-friendlyfootballinkent 4 18382 0 0 /news/beckcant051218 4 39586 0 0 /news/sceflstatement260321 12 38686 0 0 /news/juniordian120715 3 16866 0 0 /news/sevash150317 1 11360 0 0 /news/19thaug04.html 1 0 0 0 /news/31stoct05A.html 2 0 0 0 /news/werereadytopouncesayshalsey 1 5148 0 0 /news/erithandbelvedere080819 4 16393 0 0 /news/551bc5de9f3cd 1 2958 0 0 /news/551a9718d1c82 1 4186 0 0 /news/cordicereadstheriotact 2 9450 0 0 /news/warrilowspendstonettargetrook-exclusive 1 4048 0 0 /news/itsbeenthehardestseasoniveeverhadinfootballsaysfolkestoneinvictabossneilcugley 2 10214 0 0 /news/chathamtown2-1whyteleafe-jacksdoublesnapssixgamelosingstreak 3 43454 1 2 /news/wehavetocutourclothaccordinglysaysnewwhitstabletownchairmangaryjohnson 1 6045 0 0 /news/sittingbourne241218 3 12816 0 0 /news/doverexpectphysicalbattleathornchurch 1 3942 0 0 /news/iwanttowinthekentseniorcupsayswhitstabletownbosspeternott 1 5189 0 0 /news/favershamsdestinyinhandsofleaguefixturesecretary 1 4309 0 0 /news/weneedtobeveryfocusedandbeveryprofessionalsaysbromleybossmarkgoldberg 2 8658 0 0 /news/16thoct04.html 1 0 0 0 /kent-invicta-league/22 2 9419 0 0 /news/littlehampton310805.html 1 0 0 0 /news/lordswood281016 2 8578 0 1 /news/rustbeck251017 1 10738 0 0 /news/angelsdayofdestinywearereadyforpromotionchairmanstevechurcher 1 4816 0 0 /news/snodlandreeves040515 3 15338 0 0 /news/aaronperrypartscompanywithmiltonfulstonunited 2 6200 0 0 /news/fleetladieswashedout 3 10009 0 0 /news/erithandbel090418 3 13767 0 0 /news/551a97b091170 1 3075 0 0 /news/weredelightedthatwecameawayfromeastbournewithapointsaysjimward 3 15160 0 0 /news/resultsfebruary2013 2 17370 0 0 /news/551bc5df562eb 1 3721 0 0 /news/crockeddrydenfacesfinancialblow 6 25034 0 0 /news/phoenix061017 1 3822 0 0 /news/werebothfedupwiththegameadmitsgibbons-exclusive 2 7575 0 0 /news/seagersaysksgiantkillingishesbestaswhitstablemanager 1 5248 0 0 /news/24thsept04.html 1 0 0 0 /news/beckcor210318 1 9640 0 0 /news/afccroydonathletic020818 1 3433 0 0 /news/ashford090417 2 12042 0 0 /archive-2006-2014/11 7 49637 1 1 /news/westronglybelievethatyouthisthefutureofanyclubsayssevenacrebossleehill 4 15957 0 0 /news/551a92503ddeb 2 7341 0 0 /news/hytheshardgraftpaysoffasgroundpassesinspection 1 4130 0 0 /news/seagerhailstrioforupturninform-exclusive 1 4183 0 0 /news/millwall290620 5 17002 2 2 /news/551bc5de8ee1e 1 3672 0 0 /news/lifeattonbridgewillbeexcitingnextseasonsayschairman 1 4031 0 0 /news/folkestonepreparefortheirlittlecupfinal 1 5615 0 0 /news/tompkinsunveiledascroydonsnewmanager 2 7340 0 0 /archive-2006-2014/42 4 20474 0 0 /news/551a99e3813ef 1 3195 0 0 /news/drmartens/eastern/tonbridge/5thdec03.html 1 0 0 0 /news/wedidntfeardoveradmitsformerstrikersmissen-exclusive 1 4293 0 0 /news/wellingtown310820 2 8870 0 0 /news/beckenham131104.html 1 0 0 0 /news/risberit031120 6 55902 1 0 /news/hopefullywellcontinueourfacupsuccesssaysdartfordchairmandavidskinner 1 4019 0 0 /news/mysquadwillonlygetstrongersaysglebebossrockymcmillan 1 3690 0 0 /news/dulwichhamlet2-2folkestoneinvicta-wevegottodefendbettersayscugley-exclusive 1 6191 0 1 /news/wellingunited2-2cambridgeunited-iwantustobeentertainingsaysjamieday 5 43280 0 0 /news/formerwellingstarappointedfavershamsnewfirstteamcoach 4 15919 0 0 /news/dartsworkinghardtobringbackthecrowds 2 9750 0 0 /news/hopefullynextseasonwellbeplayingbackatidehillsaysmanagerkeithmcginn 1 5181 0 0 /news/26thaug03.html 1 0 0 0 /news/markjennerstandsdownasfolkestoneinvictachairman 3 13873 0 0 /news/5thjune04.html 2 0 0 0 /news/whitstabletown2-2horsham-werenotfinishingteamsoffsayswhitstablebossjustinluchford 2 16970 1 1 /news/bromley180517 2 7572 0 1 /news/bromvtilburyfr050803.html 1 0 0 0 /news/551a925078d94 2 8672 0 0 /news/icouldntperformforangelsadmitsdisappointedgreen 1 6324 0 0 /news/thisdecisionisanotherimportantoneforenglishfootballsaysmaidstoneco-owneroliverash 4 20337 0 0 /news/theroadtowembleywevegottostartwinningathomesayscugley-exclusive 1 3928 0 0 /news/dover160405.html 2 0 0 0 /news/hythetownunveillewisminglesigning 4 13733 0 0 /news/bromley1fisherathletic2 4 22341 1 0 /news/wakelinggreenwaycandowellforhimselfinthefutureexclusiveinterview 1 5030 0 0 /news/othernews/21stsept03.html 1 0 0 0 /news/bromley0-2wellingunited-wedidntgivethefanstheperformancetheydeserved-markgoldberg 3 24983 0 0 /news/551a956c94111 2 9326 0 0 /news/craydart051016 5 51102 0 0 /news/angelschairmansullivanisalegendsaysproudangelsfan-exclusive 1 4537 0 0 /news/parkinsonlooksforwardtovickersclash 1 4085 1 0 /news/imreallydisapointedthatwerenotpushingforpromotionreflectsianjenkins 2 10588 0 0 /news/551bc99a5e1c7 3 13120 0 0 /news/wellbereadytorumblebysundaysayswellingunitedcaptainjackparkinson 1 5134 0 0 /news/therehasntbeenagamethisseasonwherewevebeenabletositbackandrelaxsaysstevebrown 2 7985 0 0 /news/othernews/AEI070904.html 1 0 0 0 /news/herefordunited5-1hythetown-wecanwalkoffthepitchwithourheadsheldhigh-porter 1 8797 0 0 /news/soccershortswellenjoytop-spotbecauseitwontlastadmitslangton 1 10337 0 0 /news/551a9c926781d 2 11614 0 0 /news/warrilowforcedtowieldtheaxeaftertwoearlycupexits 2 7922 0 1 /news/leytonorient081104.html 2 0 0 0 /news/ihaveachievedtheobjectivesiwassetandmoresayssimonaustin 2 9692 0 0 /news/15thsept04.html 2 0 0 0 /news/dennesssignscontractatchathamtown 5 17331 0 0 /news/stoneschairmannextsevendaysareimportantforclub 1 4145 0 0 /news/cugleydelightedtobreakhisramsgatehoodoo 3 17071 0 0 /news/crayashf260818 1 9651 0 0 /news/itscrucialtohaveourownlocationsaysfisherbossgarylisney 1 4788 0 0 /news/tompkinsleavesdockersinlurchwithlateresignation 1 4155 0 0 /news/pecklong090415 7 73418 3 4 /kent-invicta-league/23 2 9298 0 0 /archive-2006-2014/57 2 10194 0 1 /news/ramsgate170716 1 4472 0 0 /news/cugleytoldtomaintainfolkestonesrymanleaguestatus 2 9256 0 1 /news/551bc5df993a1 1 3735 0 0 /news/chathamtownbeginsearchforheadofyouthandjuniorfootball 1 4523 0 0 /news/16thoct.html 2 0 0 0 /news/greenwich290116 4 13782 0 0 /news/551bc5e2478b6 1 4011 0 0 /news/ashfordtown6-1mileoak-colemanhasgivenmeastrikeforcedilemmaadmitslovell 2 13429 0 0 /assets/smartmenus/libs/demo-assets/bootstrap/ 1 390 0 0 /news/sittingbourne250920 2 8348 0 0 /news/551a9c92eba3d 1 3435 0 0 /news/hastingsunited0-2maidstoneunited-stonesgetcampaignofftowinningstart 4 25044 0 0 /news/craywands221018 3 11706 0 0 /news/hernwhit010120 6 72258 1 0 /news/wellheme100418 4 31342 0 0 /news/551a967908594 1 6076 0 0 /news/551a9678a0306 1 5818 0 0 /news/cuptiewillgetourmatchlegsgoingafterwinterbreaksaysmunday 1 4959 0 0 /news/milesdemandsmoreconsistency-exclusiveinterview 1 4106 0 0 /news/551a96dbb2a79 2 6818 0 0 /news/play-offfinallivecraywanderers1-0metropolitanpolice-crayheroesmakehistory 1 9683 0 0 /news/sittingbourne300118 1 3101 0 0 /news/dulfav100117 1 11196 0 0 /news/folkestoneinvicta2-1crawleydowngatwick-wemightsneakbackintoplay-offssaysneilcugley 2 16958 0 0 /news/angelsnotcasualwithpitchpreperation 3 9131 0 0 /news/farniecapturesexperiencedstriker 5 14734 0 0 /news/canterbury291217 3 11126 0 0 /news/dartford030919 4 14260 0 0 /news/drmartens/eastern/sittingbourne/tilbury300804.html 1 0 0 0 /news/wemustapplyourselvesorwelllosegriponcupwarnsward 4 17118 0 0 /archive-2006-2014/141 5 22776 0 0 /news/kentleague/lordswood/lordsvbeckfavase200903.html 1 0 0 0 /deal-2003-2006/ 1 2946 0 0 /national-league/7 5 41745 1 1 /news/drmartens/premier/welling/23jan04.html 1 0 0 0 /news/thanetsundayleagueunveilnewsponsor 6 21417 1 1 /news/lewishamboroughtryingtoprogress 6 22008 0 0 /news/NationalLeagueSouthClubsStatements200221 6 48807 1 1 /news/othernews/KYLFIX020204.html 1 0 0 0 /news/beckenhamtown0hythetown0 3 12701 0 0 /news/551bc5e4e7b69 1 3639 0 0 /news/bromley070318 4 19637 0 0 /news/royguivercomesintoturnhythetownsyoungstersfortunesaround 3 11562 1 0 /news/551bc99a9bf3b 1 4759 0 0 /news/sittingbourne300819 3 15845 0 1 /news/FAStatement250720 3 10948 0 0 /news/551bc5e393a85 1 6685 0 0 /news/borehamwood011005.html 2 0 0 0 /news/drmartens/eastern/dartford/25thjuly04.html 1 0 0 0 /news/551bc5dda2d72 1 4161 0 0 /news/551a967827d39 1 4478 0 0 /news/snodlydd111017 3 29427 0 0 /news/vacancycommercialmanager 3 8058 1 0 /news/strikeradeolorundahassomeunfinishedbusinessheresaystonbridgeangelsbosstommywarrilow 1 4508 0 0 /news/craywanderers0-2leatherhead-imustadmitwehadkeyplayersoutsaysianjenkins 1 7129 0 0 /news/thefacupcomesdowntowhichteamwantstowinthemostsaysbromleycoachhugolangton 3 18731 0 0 /news/corinthian-casuals2-3whitstabletown-iknewhowmuchitmeanttomyclubsaysheroicdenly 2 16893 0 0 /news/551a9c9173983 2 7018 0 0 /news/bromvwalton060903.html 1 0 0 0 /news/whitstabletriocheatdeathinfatalthanetwaycrash 2 8006 0 0 /news/kingmarg290118 2 17878 0 0 /news/vcd090405.html 1 0 0 0 /news/darrenanslowresignsaftereightgamesinchargeofdealtown 3 10319 0 0 /news/dover071116 3 10623 0 0 /news/soccershorts020717 1 4878 0 0 /news/bromley100920 3 13532 0 0 /news/thisseasonhasjustbeenalittlebittoolongformyplayerssaysdartfordbosstonyburman 1 3495 0 0 /news/wewanttokeepthewinningmentalitygoingsayswatts 1 4125 0 0 /news/justinedinburgh080619 3 17192 0 0 /news/crayvalley060119 4 21954 0 0 /news/wevegottobelievethatwecanscorefourgoalsagainstthemsaysbromleybossmarkgoldberg 4 21033 0 0 /archive-2006-2014/122 1 4625 0 0 /news/tunwells020518 2 9094 0 0 /news/551bc99bddc9a 2 9016 0 0 /news/wellgray271015 4 51816 1 1 /news/othernews/30thaug03.html 1 0 0 0 /news/fisher0-2hythetown-imsuretheresmanymoregoalstocomefrombrendoncasswarnsporter 2 15892 0 0 /news/theresabigincentivetobeatwhitstableinfatrophysayshythetownbossscottporter 2 9252 0 1 /news/bromleyretaineightplayersfromlastseason 2 8222 0 0 /news/drmartens/eastern/folkestone/10thsept04.html 1 0 0 0 /news/welling241117 3 11232 0 0 /news/eveshamunited1-2bromley-theygaveusonehellofagameadmitsmarkgoldberg 2 17638 0 0 /news/windsor011005.html 1 0 0 0 /news/551bc5e6ae00d 4 31073 0 2 /news/wewontgiveuptryingtocatchwokinginsisthighflyingkentrivals 1 4556 1 0 /news/craywands091118 4 19006 0 0 /news/ashfordunitedrelaunchplanstobuildanexcitingsportsvillageathomelands 3 11491 1 0 /news/iwanttostayatmargatesaystrott 1 4056 0 0 /news/kentleague/sevenoaks/maidstone301004.html 1 0 0 0 /news/wehavenopressureonusbeingtheunderdogsayscorinthianbossmattlonghurst 2 9802 0 0 /news/kentleague/deal/Sampson16.html 1 0 0 0 /news/wewillbelookingtostaywiththechasingpacksaysramsgatebosstimdixon 1 3179 0 0 /news/dorktonb051217 2 19654 0 0 /news/551bc99bc2e31 1 5030 0 0 /news/eagledeyedmullinputschelmsfordonthespot-fatrophynews 2 15190 0 0 /news/maidstone031205.html 1 0 0 0 /news/kentleague/sladegreen/whitstable210804A.html 1 0 0 0 /news/3rdoct04.html 2 0 0 1 /news/551bc5e407707 1 4462 0 0 /news/551bc5e132192 1 3104 0 0 /news/23rdmay04.html 1 0 0 0 /news/davesmithtakesoveraslyddtownsnewmanager 2 7206 0 0 /news/551a9c92045d3 3 15404 0 0 /news/sct201016 3 10734 0 0 /news/551a979ae9ebf 1 5066 0 0 /news/ashford260616 3 14655 0 0 /news/wellaltr080315 4 31665 0 0 /news/551a956c50da8 2 7050 1 0 /news/welling070804.html 2 0 0 0 /news/551bc99d5a310 1 5451 0 0 /news/551a9c0f10d7c 1 4870 0 0 /news/favouritewarrilowlandstonbridgeangelsjob 1 3227 0 0 /news/morganhasassembledourbesteverteamsayshernebaychairman 1 4528 0 0 /news/wakelingaimingforcupsuccess 3 11482 0 0 /news/dulwichvbromu18210304.html 1 0 0 0 /news/erithandbelvedere091020 4 16302 1 0 /news/winningtreblewasafantasticachievementadmitsmcmahon 1 3097 0 0 /news/othernews/12oct03.html 1 0 0 0 /news/soccershortsdartfordsuffermcclementsblow 1 6941 0 0 /news/bromley250618 3 11790 0 0 /news/ramsgate210319 5 19425 0 0 /news/warrilowhitsbackatrivalsbudgetaryclaims 2 9220 1 0 /chatham-2003-2006/3 4 11285 0 0 /news/bromvcor130304.html 1 0 0 0 /news/invictamidfielderreachesmilestone 2 12547 0 0 /news/ashfordtown0-1bromley-new-lookashfordimpressduringfirstouting 1 4025 0 0 /news/551bc5e0c1f55 1 4586 0 0 /news/wemustbouncebacktonightinsistsseager 1 4166 0 0 /news/dulwichhamlet0-2hythetown-iknowwecancompetewiththebestteamsintheleaguesaysporter 3 23342 0 0 /news/ithinkthepressurewillbeonphoenixtowinratherthanussayssevenacrebosschristuley 3 11978 0 0 /news/glebe010916 3 10260 0 0 /news/551bc5dc104b7 2 11394 0 0 /news/fazakerleyjob220415 4 16502 0 0 /news/dulwichhamlet2-0margate-wehadtoworkreallyhardtogetthepointssaysgavinrose 5 46807 0 0 /news/welling210518 3 9711 0 0 /news/wellingunitedquartetputpentopaper 1 3228 1 0 /news/iamveryclosenowtocompletingthesquadsaysfavershamtownbossrayturner 1 3852 0 0 /news/wellcori120220 4 51260 0 0 /news/aresittingbournepeopleinterestedintheirclubanymore 2 8808 0 0 /news/burmansignstwoex-captainstotoughenuphisteam-exclusive 2 7644 0 0 /news/drmartens/eastern/fisher/6thfeb04.html 1 0 0 0 /news/551bc5df128af 2 8322 0 0 /news/dartford0-1chester-itsgettingveryverydifficultforusadmitsdartfordbosstonyburman 2 16136 0 0 /news/551a9cf58586f 2 8872 0 0 /news/drmartens/eastern/dartford/12thoct03.html 1 0 0 0 /news/farniebeginsrebuildingfornextseason-exclusiveinterview 3 12176 0 0 /news/backingthefleettowembleyglorywewillpullitoutthebaginsistslong 2 10375 0 0 /news/551a956c1e9f1 1 5395 0 0 /news/crowborough031117 3 22091 1 1 /news/thetitleisindulwichshandsnowadmitsmaidstoneunitedbossjaysaunders 3 14384 1 0 /news/beckenhamtown0-2thamesmeadtownaet-wegotwhatwewantedsaysmeadbosskeithmcmahon 1 8075 0 0 /news/favershamtownlaunchchristmasbonanzaforgodalmingvisit 1 3681 0 0 /news/closuretalkhasallbeenblownoutofproportioninsistsmalin-exclusive 1 4784 0 0 /news/hernebay110616 13 112620 6 7 /news/beckenhamtown2-1greenwichborough 2 7280 0 0 /news/englandcall-upsfrustratescotton 1 3563 0 0 /assets/fileman/php/upload.php 1 115 0 0 /news/theleaguetitlewillnotbewonorlostatlyddtomorrowsayshollandsblairbosspaulpiggott 2 8680 0 0 /news/wedobelievethatweshouldbeutilisinglocaltalentadmitsmargatedirector 6 29631 1 0 /news/dockerspraisedforstagingwomensinternational 4 11818 0 0 /news/551bc5e61f3fe 3 15145 0 0 /news/wewillbelookingtokeepthemomentumgoingsaysramsgatebosstimdixon 5 17557 0 0 /news/bromleymillwall140715 3 23091 0 0 /news/itsatwo-yearplanandwereaheadofschedulesayssittingbournejoint-bossjimward 3 10492 0 0 /news/kentleague/hythe/beckenham110904.html 1 0 0 0 /news/551a97b056df2 1 4110 0 0 /news/wevegotnothingtofearsayswellingunitedplayer-managerjamieday 1 4168 0 0 /news/dartswillnotspendovertheoodsinsistsburman 2 8317 1 1 /news/slough201004.html 2 0 0 0 /archive-2006-2014/288 3 12018 0 0 /news/welling111116 3 9681 0 0 /news/12thaug05.html 1 0 0 0 /news/kentcountyleaguestatement220320 2 7018 0 0 /news/beckfish171018 4 44613 0 0 /isthmian-league/31 5 24659 0 0 /news/vcdathletic270715 4 28694 1 1 /news/greenwich121018 3 10923 0 0 /news/hydesigningisabigthingforussaysfisk-exclusive 1 3604 0 0 /news/thamvcd110317 2 21484 0 0 /news/kentleague/erithtown/1stoct04.html 1 0 0 0 /news/craywands270918 3 11718 0 0 /news/margate291115 4 15518 0 0 /news/tonbridgeangels2-1hitchintown-immorethanhappywithwhativedoneheresaystommywarrilow 2 18262 0 0 /news/IsthmianLeague120420 3 13241 0 0 /news/play-offheroesfolkestoneinvicta2-1godalmingtown-jeverittweveprovedthemallwrong 5 49424 0 0 /news/551bc99bc0799 1 4148 0 0 /login 1 2750 0 0 /news/erithbelvedere0-5gillingham-icantthankgillsenoughforprestigiousgamesayscollins 2 15659 1 1 /news/551bc5d9d5efb 2 10940 0 0 /news/bearsted110517 2 7906 0 0 /news/letsendtheseasoninstylesayswhitstablechairman-exclusiveinterviews 1 5632 0 0 /news/551bc5e7e7b65 1 3564 0 0 /news/551a925043978 2 7024 1 0 /news/tonbridgeangels050421 90 316514 31 49 /news/ashford090218 1 3569 0 0 /news/ashfordtown1-3worthing-weneedlucktosurvivethedropsayslovell 2 13509 0 0 /news/551bc5e8212ee 2 13920 0 0 /news/551bc5e16406e 2 8334 0 0 /news/fcelmkfu210417 4 17741 0 0 /news/craydeal210416 28 273941 16 15 /news/thehythegamesareusuallygoodspicygamessaysfolkestoneinvictabossneilcugley 1 4378 0 0 /news/ivelearntalotthisyearandiwillendeavourtogetthingsrightvowsdartsbosstonyburman 2 8389 0 0 /news/nottwantsgoodbackingagainstdarts 2 8833 0 0 /news/croydon0-2erithbelvedere-imtreatingthelondonseniorcupwithrespectsaysmickycollins 2 14040 0 0 /news/551bc5de3d0f8 1 4582 0 0 /news/itsexcitingtimesatmargatesaysskipperandacademycoachjamiestuart 4 21010 0 0 /news/thamesmeadunveilwalkersigning 2 6773 0 1 /news/craywands010719 4 15280 0 1 /news/stonespreparefortheireightcup-finals 2 10154 0 0 /news/adelayofafewweeksisnothingcomparedtofifteenyearsadmitsdisappointeddartschairman 5 19274 0 0 /news/551a9718f03ea 4 19494 0 1 /news/tunbridgewells1-3erithbelvedere-farniesheawillbesnappedupbyaproclub-exclusives 1 6590 0 0 /news/conference/margate/10thdec04.html 1 0 0 0 /news/kingstonian0-4dartford-idlovetostayinthisforaslongaswecansaystonyburman 3 23764 0 0 /tonbridge-2003-2006/3 2 5984 0 0 /assets/fileman/php/createdir.php 1 45 0 0 /news/wewerethebetterteambyfarinsistsyorath 1 3753 0 0 /news/fansflockthroughtheturnstilesforcodymcdonaldsreturntodartford 1 4574 1 0 /news/wellingunited5-2billericaytown-youdontwintrophiesinnovembersaysjamieday 3 21980 0 0 /news/whitstable121115 3 11139 0 0 /archive-2006-2014/24 3 15190 0 1 /news/cugleywemustscorefirstingames 4 16829 0 0 /news/greenwich090205.html 1 0 0 0 /news/dulwich180617 2 6924 0 0 /news/ksporcrow020919 3 33786 0 0 /news/bromsutt290220 4 38084 0 0 /news/exclusivefavasesecondqualifyingroundpreviews 2 19236 0 0 /news/cassitwasabigsurprisewhenfolkestonecameinforme 2 8900 0 0 /news/wedlovetohaveagoodruninthevasesayserithbelvederebossmickycollins 3 12559 0 0 /news/wevedroppedbelowourhighstandardsadmitsfrancis 2 8457 0 1 /news/thethoughtofplayingintheplay-offfinalisbrilliantsaysdovermidfielderchriskinnear 4 19900 0 0 /news/bordenvillage140520 4 13860 0 0 /news/crowbfarn060816 2 18868 0 0 /news/wehaveworkedsohardforthis-thetreblewouldbetheicingonthecakesaysjayblackie 3 14583 0 0 /news/cugleywemustimproveourgoalscoring 3 13079 0 0 /news/othernews/30thjune03.html 2 0 0 1 /news/kentleague/tunbridgewells/11thoct04.html 1 0 0 0 /news/15thjune04A.html 1 0 0 0 /news/wehavetobeontopofourgametosinkswanssaysward-exclusive 2 8034 0 0 /news/dartford3-1tonbridgeangels-thisisthelevelwewanttobeatsaysalexobrien 1 6354 0 0 /news/favasespecialwellpitchintoreachlastsixteensaysford-exclusiveinterview 1 4439 0 0 /news/eastbourne011104.html 2 0 0 0 /news/551bc99b44e05 1 6499 0 0 /news/thisisabiggerthanforusthanthesalisburygamesaysstonesbossjaysaunders 3 14146 0 0 /news/wellingunited190919 3 11825 0 1 /news/551a97b10a642 3 12396 0 0 /news/cugleycondemnspowellschallengeondickson 3 16382 0 0 /news/favstrgoodwin130515 3 17012 0 0 /news/weveshownthatwecancompetesaystonbridgeangelsbosstommywarrilow 3 11267 0 0 /news/551a9250b0b91 2 7943 0 0 /news/tonbridgeangels090220 2 6974 0 0 /news/everyseasonwetryandbetterwhatwevedonesaysdartfordbosstonyburman 6 31237 0 0 /news/longwantstoplayhiscardsright 1 4685 0 0 /news/seagerkeepseveryonesfeetontheground-exclusiveinterview 1 6213 0 0 /news/551a96db589d5 1 5737 0 0 /archive-2006-2014/211 2 8955 0 0 /news/tompkinsaddsfournewdockerstohissquad 1 4367 0 0 /news/551bc5da85df8 3 12131 0 0 /news/bromley0-2eastbourneborough-wewereawfuladmitsbromleybossmarkgoldberg 2 14840 0 0 /news/chathamdelightastheyreturnsouth 1 4079 0 0 /news/burnvsitt200304.html 2 0 0 0 /news/greenwichexpectmooreastheytargettopsix-exclusiveinterview 1 4607 0 0 /news/corinthian1-2lordswood-weveduginandwevecomeawaywiththreepointssaysjasonlillis 3 31667 0 0 /news/beckenham101116 2 6688 0 0 /news/weretryingtogetintothekentleagueassoonaspossiblesaysblyspartansbossmatthume 2 9292 0 0 /news/drmartens/eastern/chatham/26thfeb04.html 1 0 0 0 /news/ryman/bromley/22ndaug04.html 1 0 0 0 /isthmian-league/40 9 44674 0 0 /news/tunwells010715 10 89081 3 4 /assets/ckeditor/plugins/a11yhelp/ 5 1823 0 0 /news/fewellsheroicsbreakwestwickhamshearts-exclusiveinterview 2 13134 0 0 /news/imlookingforwardtohelpingcrayvalleytocontinuetopushintherightdirectionsaysjoeford 2 14028 0 0 /news/favershamtowndoesneedalittlebitofhelptogotothenextlevelsaysrayturner 2 9884 0 0 /news/sittingbourne1-1leatherhead 2 9267 0 0 /news/wejustwanttheshowontheroadsaysward 1 3909 0 0 /news/whitstable170419 4 17790 0 0 /news/dartford240905.html 2 0 0 0 /news/daishcriticiseshissidesworthethicduringstaffordshocker 2 9994 0 0 /news/itcouldnthavegoneanybettersaystwo-goalskipperrichmondkissi 4 25690 0 0 /news/551a956b8fa78 3 14004 0 0 /news/551a99e3c88b5 1 3856 0 0 /news/ourluckisturningsaystarget-manhaworth 1 4328 0 0 /news/bridpunj080120 4 41466 0 0 /news/551a99e38626a 1 4321 0 0 /news/bromleytvdebut121115 3 12633 0 0 /news/kentleague/hythe/22ndoct04.html 1 0 0 0 /news/kingstonian2-4craywanderers-jenkinsiknewwewouldclimbthetable-exclusiveinterviews 1 6581 0 0 /news/ninemorewinstostayup-munday 1 4146 0 0 /news/crayvalley1-4vcdathletic-welookeddevoidofideasadmitsfrustratedtonyrussell 4 42754 0 0 /news/folkevhemelfat011103.html 2 0 0 0 /news/drmartens/eastern/dartford/7thjuly04.html 1 0 0 0 /news/hythe200405.html 1 0 0 0 /news/corinthian100320 3 16307 0 0 /news/551bc99cd20a8 1 5566 0 0 /news/ramsgate260205.html 2 0 0 0 /news/leatherhead2-0sittingbourne 4 17252 0 0 /news/edgwaretown2-1dartford-dartswintitleonemotionaldayandburmansaysimproudaspunch 2 27593 1 1 /news/lewisham180718 3 10851 0 0 /news/sportingclubthamesmead101019 3 13195 0 0 /news/openingdayyoudecide 5 14973 0 0 /news/ryman/bromley/bromvcor130304.html 1 0 0 0 /news/551bc5e4e1ec5 1 3686 0 0 /news/bromleybeginsearchforplayersfornewladiesside 4 14296 0 0 /news/551a956bd81dc 2 11466 0 0 /news/fisher130815 4 18286 1 0 /news/welling030317 2 7175 0 0 /news/551a9cf545466 2 13122 0 0 /news/551bc5e625b48 1 4759 0 0 /news/southwark040617 3 9251 0 0 /news/551bc5df62be0 1 4983 0 0 /news/551a99e4d612f 3 20328 0 0 http://kentishfootball.co.uk/news/daishhandedextrafundsthrough80000joint-transferdeal 1 11570 1 1 /news/twelvekentclubsinrymanleaguenextseason 1 3494 0 0 /news/bromley180919 2 8942 0 0 /news/christchurch1-0tunbridgewells-wedidntperformforoursupporterssaysrobbins 1 6689 0 0 /news/drmartens/eastern/erith&belvedere/harlowfat091004.html 1 0 0 0 /news/KentFAStatement070720 2 7408 0 0 /news/millwall211019 3 12148 0 0 /news/hollandsblair0-2ashfordunited-iwantalitltebitmorefrommyplayerssayspaulchambers 1 7025 0 0 /news/ashford100416 4 18002 0 0 /assets/ckeditor/plugins/youtube/ 5 1988 0 0 /news/humeissuesrallyingcrytomissingfans 2 7573 0 0 /news/dartford1-2kidderminsterharriers-weshouldntbethrowinginthetowelsaystonyburman 4 33504 0 0 /news/hampvbrom210204.html 1 0 0 0 /news/551a99e33da37 1 4035 0 0 /news/wehavetodigintoourpocketstokeeptheclubgoingsaysfirkins 2 9621 0 1 /news/tunvslade130903.html 2 0 0 0 /news/whitstable301004.html 1 0 0 0 /news/margate140518 1 4215 0 0 /news/dartford200718 3 9471 0 0 /news/holldeal140919 5 62210 0 0 /news/551bc5e7f1be6 1 3877 0 0 /news/imexpectingarealbattleatstaineswarnstonbridgeangelsbosstommywarrilow 1 4681 0 0 /news/younevergetaneasygameagainstcraywarnsangelsbosstommywarrilow 2 8528 0 0 /news/ashfordtown2-1godalmingtown-injuryscareforjones 1 4999 0 0 /news/fansassistmargatewithgroundimprovements 1 3514 0 0 /news/Thamfave061217 2 22516 0 1 /news/551bc5dd21f3d 1 3329 0 0 /news/drmartens/eastern/sittingbourne/newportvsitt261003.html 1 0 0 0 /news/sittingbournemanagerabbottinvitedtowingsinterview 1 4528 0 0 /news/craywandererssearchforfriendly 1 3169 0 0 /news/tunsev020117 2 23140 0 0 /news/FAStatement191120 3 10141 0 0 /news/greenhythe210217 1 9372 0 0 /assets/ckeditor/plugins/tabletools/ 5 1828 0 0 /news/551bc5e7de2d6 2 7340 0 0 /news/othernews/augfix2004.html 1 0 0 0 /news/belvedere060420 2 6308 0 0 /news/drmartens/eastern/sittingbourne/sittvtonb221103.html 1 0 0 0 /news/deresstilldreamingoffairytaleclashwithgiantsleedsunited 2 9926 0 0 /news/551a967857970 1 3376 0 0 /news/soccershortsstonesdealtgroundfundingblow 1 6309 0 0 /news/greenwichboroughbringintwofromdartfordsacademy 2 7986 0 0 /news/551a956cbab07 1 4628 0 0 /news/soccershortswewillnotgooutandspendbigmoneyonplayerssayshernebaybosssamdenly 4 18478 0 0 /news/551bc5e45d045 1 3533 0 0 /news/ashfordtown1-0folkestoneinvicta-lyeheadersettlesderby 2 7594 0 0 /news/greenwich120118 2 9548 1 0 /news/burmanwemustcutoutthemistakesandshowconsistency 2 8398 0 0 /news/lastyearsheartbreakwillspurustowardspromotionsaysnolan-exclusiveinterview 1 5383 0 0 /news/erithbelvedere0-2lancing-weveletourselvesdowntodaysaysdisappointedmickycollins 1 7091 0 0 /news/551a95b3a8883 1 4418 0 0 /news/wallisoptstostaywithdoverathletic 1 4018 0 0 /news/bromleyfc.tv 1 0 0 0 /news/charltonathletic0-6sheffield-werepositivethatwecanbeatdurhamsayssheffieldcoach 1 7878 0 0 /news/charitybeginsathomeforbrickies 1 3035 0 0 /news/atthemomentwearefindingwaysofgettingbeatsaysvcdbosstonyrussell 1 4075 0 0 /news/weknowitsgoingtobedifficultforusadmitsthamesmeadtownbosskeithmcmahon 5 26805 0 0 /news/heathaimsforthreeoutofthree-exclusiveinterviews 4 23596 0 0 /news/kentleague/sladegreen/lordswood021004.html 1 0 0 0 /news/551a956c9b052 1 3571 0 0 /news/kentleague/deal/Sampson7.html 2 0 0 0 /news/holmesdalegettogripswithlifeinthekentleague-exclusive 1 3711 0 0 /news/551a96779a886 1 5299 0 0 /news/551bc99c67332 1 4944 0 0 /news/551bc99e0a41f 1 6583 0 0 /news/twellserithb060216 4 42238 0 0 /news/cugleyruesbadluck 3 16952 0 1 /news/thamesmeadtown4-5cheshunt-mcmahonslamsamateurishdefending 3 34405 1 1 /news/wecantcarryonlikethisadmitsworriedcugley 2 10904 0 0 /news/heybridgeswifts2-0folkestoneinvicta 4 18824 0 0 /news/doverathletic240421 86 362887 6 45 /news/551a95b412313 4 23766 0 0 /news/backingthefleettowembleygloryidlovetoseethemwinatwembleysayslovell-exclusive 1 4322 0 0 /news/tonbvfolk131203.html 2 0 0 2 /news/kentleague/sevenoaks/21stoct04.html 1 0 0 0 /news/milessearchesforlowerleaguetalentashetargetsconsolidation-exclusive 3 14464 0 0 /news/sceflstatement271120 8 32176 4 0 /news/conferenceapprovetheuseof3gpitchesfrom2015 3 10185 0 0 /news/551a925012ca6 2 6403 0 0 /news/wardfeelsaprehensiveaheadofkscupclash-exclusive 2 9687 0 0 /news/folkestoneinvictarelaunchwebsite 5 27721 0 0 /news/whitstabletownscoopbarryeasttrophyforflyingtherymanleagueflaginfatrophyrun 4 15134 0 0 /news/16thdec04.html 2 0 0 0 /news/doverathletic0-0afcwimbledon-werodeourlucktodayadmitsbrown 1 6167 0 0 /news/anyonewhounderestimatesconcordrangerswilllosewarnsbromleycoachhugolangton 2 8312 0 0 /news/wecouldbeaforcenextyearsayscorinthiancoachmattlonghurst 1 4315 0 0 /news/tilbury240704.html 1 0 0 0 /news/corinthian030317 1 3805 0 0 /news/wehave90minutestonailourpre-seasonsayshalsey 2 7880 0 0 /news/ramsgateunveildeanhillastheirnewmanager 4 19017 0 0 /news/kentleague/thamesmead/21stjuly04.html 1 0 0 0 /news/sceflstatement190620 3 14299 0 0 /news/croydon210804.html 2 0 0 0 /news/erithandbelvedere190519 3 13200 0 0 /news/welooktoguidewhitstableupthetablesaysbossnickysouthall 2 7468 0 0 /news/wellbepreparedforwarlinghamsaystunbridgewellsbossmartinlarkin 1 4670 0 0 /news/piscinascontributionhasbeenhugeforussaysmoore 2 14767 1 0 /news/551a96787cfee 3 18177 0 0 /news/jenkinsfacescupfinalselectiondilemma 1 4043 0 0 /archive-2006-2014/225 2 8535 0 0 /news/itwasreallyimportantthatwestrengthenedthesideafteradisappointingdecembersaysbrown 4 14472 0 0 /news/bromleiansfc.co.uk 2 0 0 0 /news/facuprunwillbringabitofglorytotheboyssaysvcdassistantandysilk 1 3481 0 0 /news/weregoodenoughtogetintotheplay-offssaysday 1 3993 1 0 /news/kentleague/sevenoaks/3rddec04.html 1 0 0 0 /news/551bc5ddbd980 1 4455 0 0 /news/ksports210417 4 14918 0 0 /news/551a95b39f840 2 6879 1 0 /assets/ckeditor/ 8 4226 1 0 /news/dealtown310820 3 11857 0 0 /news/thamesmeadconfidentofcausingupset-brickieswithouttopscorer-exclusiveinterviews 4 20120 0 0 /news/551a9cf563d0a 2 9764 0 0 /news/551a9bafde43f 3 9324 0 0 /news/kentleagueawaitsladegreenresignationletter 1 15789 0 0 /news/imherebecauseiwanttodowellintheleaguesaysstonesbossjaysaunders 3 17138 0 0 /news/iamsurefraserfrankswillcontinuetodevelopintheconferencepremiersaysjamieday 6 20966 0 0 /news/ryancooperhasjoinedustocompeteforhonourssayshythetownbossscottporter 5 17690 0 0 /news/ryman/bromley/10thdec04.html 1 0 0 0 /news/551a99e38cb83 1 4117 0 0 /news/kentleague/tunbridgewells/31staug04A.html 1 0 0 0 /news/wehavetobementallyrightforhorshamymcasaysjustinluchford 1 3852 0 0 /news/weveearnedtherighttofaceramsgatesayshollandsblairbosspaulpiggott 3 15681 1 0 /news/ourobjectivesaretobeascompetitiveaswecansaysholmesdalecoachrossmitchell 1 4460 0 0 /news/drmartens/premier/welling/26thoct04.html 1 0 0 0 /news/whitstabletown2-0thamesmeadtown 1 5004 0 0 /news/ramsgate041019 3 11593 0 0 /news/weneed80pointstogetaplay-offplacepredictswellingunitedbossjamieday 1 4658 0 0 /news/ebbsfleetunited2-1salisburycity-fleetendsalisburys12matchunbeatenrun 1 5640 0 1 /news/matchoftheseasondartford4-3ashfordtown-martinsaysgoodbyeinseven-goalthriller 1 6739 0 0 /news/savethewingscampaignfridayisideallythelastdayfortransfers-sayssolicitor 1 4163 0 0 /news/dartfordunveildriveforadrivegolfday 1 3035 0 0 /news/ryman/bromley/sutton161004.html 1 0 0 0 /assets/select2/docs/_includes/head.html 1 418 0 0 /news/survivoreganattractsmediaattention-exclusive 2 6252 0 0 /news/551a96db97cac 1 3625 0 0 /news/bromleians140518 2 8496 0 0 /news/greenwichstadium140615 4 30058 0 0 /kent-invicta-league/4 5 37131 1 1 /news/thatwasnotaone-offperformanceconstablewarnsfolkestone 1 5144 0 0 /news/strugglinghythetownsufferfinancialheartache 2 7928 0 0 /news/551a967754ab6 1 4161 0 0 /news/seagerpaystributetohisbestmanatwhitstable 2 7534 0 0 /news/folkhors071219 2 21478 0 0 /news/harwoodshunsmargatetoreturntocarshalton 2 6742 0 0 /news/ashfordtown3-1crowboroughathletic-lovellpleasedwithprogress 2 11169 0 0 /news/faissuehanwelltownonefinalchancetostagefavasetie 2 7390 0 0 /news/whitstabletownpartcompanywithbossjustinluchford 2 6058 0 0 /news/551a96784e723 1 3871 0 0 /news/kentleague/deal/deal.html 1 0 0 0 /news/isetthebarveryhighstandardandwerenotreachingitadmitshernebaybosssimonhalsey 3 13381 0 0 /news/weshouldhavemorepointsadmitsinjuredskipperdenly 2 7110 0 0 /news/ramsgatesackjustinluchfordaftereightgamesincharge 4 14958 0 0 /news/fifth-placeisnotabadreturnsaysashfordunitedbosspaulchambers 1 3990 0 0 /news/cugleypraiseshistroopsfortheirsupport 1 5603 0 0 /hythe-2003-2006/2 3 8172 0 0 /news/arunrams100919 6 57944 0 0 /news/wellhavetoseewhatthebudgetiandwhowebringinsayswellingunitedbossjamieday 1 4600 0 0 /news/wearewherewearebecausethatswherewedeservetobesayschathamtownskeithlevett 3 12227 0 0 /news/sheringhamwilldothebusinesssaysburman 1 4784 0 0 /news/drmartens/eastern/dartford/12thsept03.html 1 0 0 0 /news/favershamtown2-4eastthurrockunited-itwasamissedopportunitytodayadmitsrayturner 1 7680 0 0 /news/othernews/28thoct03.html 1 0 0 0 /news/fishershep151116 2 23502 0 0 /news/551bc5e07c8b2 1 3658 0 0 /news/551a99e5518bf 1 4848 0 0 /news/guildfordcity050121 5 18037 0 1 /news/kentfootballunited010819 3 10546 0 0 /news/beckenhamtown4lordswood0 4 17402 0 0 /news/phoenixsportsclub.co.uk 2 0 0 0 /news/erithbelvedere2-1pagham-cablehascomebackwiththerightattitude-radbourne 1 6122 0 0 /news/fishergivefansfoodforthoughtonnon-leagueday 3 13342 0 0 /news/punjbroa100819 5 45500 0 0 /news/wedontfearanyonesaysdoverathleticassistantjakeleberl 4 19422 1 1 /assets/uploads/content/Woodstock_Sports%20-%20Copy%201.htm 1 8930 0 0 /news/wehaventachievedanythingyetsaysbromleybossmarkgoldberg 1 3946 0 0 /news/wellingunited3-0dartfordpennockourattitudewasspoton 2 10934 0 0 /archive-2006-2014/127 3 13265 0 0 /news/gloubrom201018 3 29799 0 0 /news/fleetladiesreceivelotteryfunding 5 24267 0 0 /news/thecouncilmuststandanddeliversaysfolkestoneinvictachairmanmarkjenner 2 8316 0 0 /news/bromleyontheorientcomeoutinforceonourmemorabledaysaysbromleyownerjerrydolke 1 4274 0 0 /home/GetQrCodeInfo 1 3456 0 0 /news/551bc5ddafd7c 1 3856 0 0 /news/bromley2-4suttonunited-werenotoutoftheraceforpromotionsaysmarkgoldberg 2 17184 0 0 /news/551bc5de2e087 1 3515 0 0 /news/londonfa220416 3 11804 0 0 /news/wejustwantedtofollowupsaturdaysperformanceandwinsaysfrustratedrayturner 4 20578 1 0 /news/551a9bafd655a 3 8571 0 0 /news/tonbridgeangels2-3doverathletic-bothsetsoffansgottheirmoneysworth-nickyforster 1 9436 0 0 /news/sportmeri031218 3 27938 0 0 /news/thebigkickoffsittingbournewithouteightfortriptofanciedsideworthing-exclusive 1 4646 0 0 /news/gateshead3-0dartford-theresnodisgracelosingtogatesheadsaysprouddartsbosstonyburman 1 6205 0 0 /news/nothingswonorlostonsaturdaysaysphoenixsportsjoint-bosstonybeckingham 3 14216 0 0 /news/fisher100818 1 3485 0 0 /news/stonesdefenderpenstwo-yeardealatmiddlesbrough 1 3202 0 0 /news/551bc5e457ff4 1 3315 0 0 /news/larkfield251119 2 8026 0 0 /news/bromley190218 4 21389 0 0 /news/wellingunited7-1folkestoneinvicta-wingsaddtoinvictaswoes 3 16841 1 1 /news/arrangementsareinplacetogetourgrounduptostandardsayscrayvalleybossstevechapman 1 4690 0 0 /news/othernews/selsey17thjuly03.html 2 0 0 0 /news/vcdbill250415 4 41538 0 0 /news/othernews/24thjan04.html 1 0 0 0 /news/werelookingtowinsowedonthavetoworryaboutanyoneelsesaysneilcugley 1 3864 0 0 /news/favaseqfpreviewA.html 1 0 0 0 /assets/ckeditor/plugins/preview/ 5 1833 0 0 /news/sladegreenunveilnewmanagementteam 6 21367 0 0 /news/kentleague/deal/dealvcrayfav181003.html 1 0 0 0 /news/vcdathletic260620 11 77725 6 3 /news/crayvtunw310304.html 2 0 0 0 /news/binksreshufflewasmysuggestion-exclusiveinterview 6 25256 1 0 /news/chatsitt060217 1 11410 0 0 /news/551bc99bcb969 1 3986 0 0 /national-league/27 2 9903 0 0 /news/bromley1-2eastleigh-wedontwanttofinishwithnothingsaysbromleybossmarkgoldberg 4 33894 0 0 /news/wevegotagoodsolidbasetoworkonsayslovell 2 9539 0 0 /news/averyhasntputafootwrongandiwanttokeephimsaysbinks-exclusive 2 8280 1 0 /news/evertoncharlton120415 3 11335 0 0 /southern-counties-east-football-league/7 5 38539 1 1 /news/cugleytellsfansthanksforstickingbyus 2 9333 0 0 /assets/images/icons/ 8 111184 0 0 /news/warrilowsettobringstrikeronloantonight-exclusive 2 5540 0 0 /news/itsbeenatoughseasonadmitschathambosspaulfoley 2 15989 0 0 /news/greenwichboroughgivenanewleaseoflife-exclusive 1 4286 0 0 /news/vcdathleticphernebaypmatchpostponed-waterloggedpitch 3 8225 0 0 /archive-2006-2014/75 1 4991 0 0 /news/margate280218 2 8986 0 0 /news/harrtonb260817 1 8419 0 0 /news/craywandererschairmangaryhillmantoanswerquestionsaboutnewstadiumatbooklaunch 2 15280 1 0 /news/wecantwaitforthefirstwhistlesaysseager 1 3648 0 0 //contact/ 1 3278 1 0 /news/crayvhoddlsc011003.html 1 0 0 0 /news/glebabbe100419 4 34586 0 1 /news/551a931eb13d2 1 4384 0 0 /news/thambill170917 3 30810 0 0 /news/dartford1-1dulwichhamlet-wedroppedtwopointsadmitsburman 2 12113 0 0 /news/horleytown1-3greenwichborough-wewillgetstrongerastheseasongoesonsayspaulblade 4 58953 1 1 /news/kentleague/VCD/28thjan04.html 1 0 0 0 /news/werelookingforwadtoplayingagainstabigclubsayscrayvalleybossstevechapman 4 15294 0 0 /news/drmartens/eastern/sittingbourne/wivenhoe271104.html 1 0 0 0 /news/551bc5e4d4dcf 1 4090 0 0 /news/orpington130815 3 11571 0 0 /news/sonnymilesdecidestoleavetonbridgeangelsafter12years 3 11040 0 0 /news/551bc99c9020f 1 5053 0 0 /news/weveprovedalotofpeoplewrongsayssittingbournejoint-bossjimward 2 11378 0 0 /news/551a9c0e39531 1 4882 0 0 /news/wellingunited1-0tonbridgeangels-theteamhasprogressedsinceivebeenheresaysjamieday 1 5740 0 0 /news/wardrelishesmoroccanfriendly-exclusiveinterview 1 4522 0 0 /news/thebestisyettocomeinsistsinvictabosscugley 2 10190 0 0 /news/551a9c915cecd 2 8671 0 1 /news/fatrophyquarter-finalsletsmakethisweekendsomethingspecialforkentfootball 1 5553 0 0 /news/kfu090218 3 12429 0 0 /news/myjobistoproduceconferencequalityplayerssaysdocker-exclusive 3 33903 1 1 /news/iexpectpromotionsaysburman 1 4190 0 0 /news/folkestone150719 3 9525 0 0 /news/fanspraisecouncilforbuildingbreathtakingnewstadium-exclusiveinterviews 1 5541 0 0 /news/551bc5e5aa931 2 27134 1 0 /news/551bc5dbb5fe8 3 12769 0 0 /news/551a931e0ad7c 3 13023 0 0 /news/551bc5ddd7249 1 4577 0 0 /news/lordswood021004.html 2 0 0 0 /news/551bc5e271525 2 7472 0 0 /news/goalkeepingcrisiscouldforceangelschairmanmakingacomeback-exclusive 1 5456 0 0 /news/551a971910414 4 16626 0 0 /news/snodlandtown300819 3 10687 0 0 /news/NationalLeague310320 6 17690 0 0 /news/rusthall090819 3 10610 0 0 /archive-2006-2014/292 3 11918 0 0 /news/soccershortssladegreenappointlonghurst 1 8814 0 0 /news/dulwwest061118 4 36230 0 0 /news/551a96db4acb8 1 3354 0 0 /news/ryman/bromley/25thmar04.html 1 0 0 0 /news/thomasnotgoinganywhereinsistsmcmahon-exclusiveinterviews 4 17192 0 0 /news/tonbridgefansthreatenboycottoversuttonsegregationmeasures 2 10394 0 1 /news/doveraddpairtotheirpromotionchasingsquad 1 3818 0 0 /news/fleetbeatthegills5-2 6 40249 0 1 /news/551a9c932a09a 2 12211 0 0 /news/ithinkweregettingtherewardsforthehardworkwereputtinginsaysnickyforster 3 11906 0 0 /news/drmartens/premier/dover/billericay170804.html 1 0 0 0 /news/bromley0-0thurrock-werenotsafeyetandthatsmybiggestdisappointmentsaysmarkgoldberg 1 7364 0 0 /news/Maidstone070318 4 13678 0 0 /news/wevegotagreatchanceofgettingthroughtothesemi-finalssayshernebaybosssimonhalsey 1 5211 0 0 /news/phoenix010917 1 3340 0 0 /news/wardlooksforimprovement 1 3958 0 0 /news/harlcray270416 4 38154 0 0 /news/FAStatement100920 3 10606 0 0 /news/551bc99b57907 1 4273 0 0 /news/carsgreen231017 1 9148 0 0 /news/facupdrawfleetlookforwardtointerestingkentderbyatbromley 2 8089 0 0 /news/dorking280805.html 1 0 0 0 /news/milestellshissidetostandupandbecounted-exclusiveinterview 1 4052 0 0 /news/.pitchero.com/clubs/metrogasfc 2 0 0 0 /cgi-sys/defaultwebpage.cgi 1 6959 1 1 /news/facupfirstrounddrawebbsfleetonroadagainiftheyseeoffwoking 2 7838 0 0 /news/rymanleaguelineupvcdathleticthrownoutofrymanleague 1 6034 1 0 /news/maldontown1folkestoneinvicta0 3 12593 0 0 /news/margateinvitesupporterstopublicmeetingtodiscusshartsdownparkredevelopment 1 3437 0 0 /news/drmartens/eastern/sittingbourne/histvsitt151103.html 1 0 0 0 /news/soccershortsimstayingattootingsaysvines-exclusives 1 5723 0 0 /news/wealdstone110904.html 2 0 0 0 /news/twelvegamestogowevegottomakeitcountsaysfrancis 1 3867 0 0 /news/crayvalley281217 2 8282 1 0 /news/551a99e45c92b 1 4291 0 0 /news/bansvbrom170104.html 1 0 0 0 /news/tunbridgewells1-2corinthian-wayneburnetthasbeenabitofamentortomesaysmattlonghurst 3 29741 0 0 /news/551a99e475e8e 3 14343 0 0 /news/walkersettounveilmorenewsignings 2 8014 0 0 /news/wearelookingtobuildafoundationonwhichtoprogresssayssammacneil 1 3664 0 0 /news/bromley230718 4 13206 0 0 /news/iwanttoprogressandbuildacareerinfootballsaysjohnovard 2 6893 0 0 /news/beckenham210220 2 8272 0 0 /news/gillihadtotakeoverteamaffairsasitwasajollyupunderharmsworth-exclusive 2 11525 0 0 /news/craymet030517 2 23219 0 0 /news/nationalleague090618 3 9729 0 0 /news/hythetownwintheracetore-signmickelborough 1 3397 0 0 /news/othernews/britishenergykentcountyleaguetablesfinal2004.html 1 0 0 0 /news/Hamble250904.html 2 0 0 0 /news/othernews/charvdonc210304.html 1 0 0 0 /news/apmbrowning260415 3 10808 0 0 /news/EFLStatement160320 3 10769 1 0 /news/crayvalley150620 3 15686 0 0 /news/wellingunited3-2tonbridgeangels-ifyougivewhitnellachancehewillscoresaysday 1 7163 0 0 /news/hastingsunited6-1folkestoneinvicta-invictacapitulatelateonatrelegationrivals 2 9892 0 0 /news/drmartens/eastern/dartford/4thnov04.html 1 0 0 0 /news/551a96dc10106 2 9013 0 0 /news/craywands210519 4 16117 0 0 /news/551bc5e6cff99 3 21943 0 0 /news/wevegotrealbeliefthatwecanachievesomethingthisyearsaysgillinghambosshessenthaler 1 4381 0 0 /news/551a979a04703 3 15245 0 1 /news/25thsept04.html 2 0 0 0 /news/hernebay160205.html 1 0 0 0 /news/whereareyougoingthisweek 3 11924 0 0 /news/eightymillionquid-ifonlywehadthatinthenon-leaguegame 1 8714 0 0 /isthmian-league/19 11 55079 0 0 /news/thurrock1-0vcdathletic-wemadeagoodnameforourselvessaysproudrickybennett 2 14254 0 0 /news/croyath210417 2 8517 1 0 /news/sevencor150217 1 10915 0 0 /news/margate060421 82 302491 5 47 /news/wewereluckyadmitsmiles-exclusive 2 7424 0 0 /news/bromstev161117 3 27983 0 1 /news/craywanderers2-0carshaltonathletic-therefereemadetherightdecisionadmitsjoefrancis 1 6399 0 0 /news/551bc99add153 1 4214 0 0 /news/chesterfieldofferwhitstabletownwingerscottheardatrial 2 6636 0 0 /news/551a96dc238c2 4 19290 0 0 /news/dolbymainhascometoabiggerclub 2 7992 0 0 /news/GWR051105.html 1 0 0 0 /news/thamesmeadtown1-2graysathletic-wecouldvegotsomethingoutofitsayskeithmcmahon 3 28655 0 0 /news/dontpanicwerestilloncoursetowintitlewith100pointssayshessenthaler 2 9666 0 0 /news/folkvhavantfatreplay021203.html 2 0 0 0 /news/551a956c0bb85 1 3012 0 0 /news/ashfsitt250918 4 39984 0 0 /news/itwasgoodtogetbacktowinningwayssaysdulwichhamletbossgavinrose 1 3552 0 0 /news/holmesdale311020 3 10762 0 0 /news/16thaug03.html 1 0 0 0 /news/margate1-2tonbridgeangels 1 6274 0 0 /news/ramsgate120618 3 10023 0 0 /news/holldeal030317 1 3921 0 0 /news/tooting260805.html 1 0 0 0 /news/itwasntevenapenaltyfumesmiller 2 7668 0 0 /news/hopefullywecanstayinthepackforalongtimesayshythetownbossscottporter 2 9514 0 0 /news/551bc5dc603be 3 32539 0 0 /news/551bc5db9dbe1 3 12627 0 0 /news/theeasterprogramme 1 4826 0 0 /news/biggunsreturnforvcd-exclusiveinterview 2 10208 0 0 /news/551bc5e888f5c 2 7392 0 1 /news/sporroch041119 7 121369 2 2 /news/horsham070505.html 1 0 0 0 /news/pittawaywewanttotakesevenoakstownuptoabetterlevel 5 20180 0 0 /news/gledhilljoinsthepolice 6 21212 0 0 /assets/select2/tests/selection/placeholder.html 1 294 0 0 /news/lordsvrams310304.html 1 0 0 0 /news/dereskeepfaithwithgormanaftercosgroveresignation 2 8615 0 0 /news/12thmar04.html 1 0 0 0 /news/othernews/gotravelkentleaguetables.html 1 0 0 0 /news/afccroydonathletic280219 4 13694 0 0 /news/551a979915e21 2 9212 0 1 /news/ebbsfleet150218 4 12910 0 0 /news/26thoct04.html 1 0 0 0 /news/glebeelms301015 3 31317 0 0 /news/deal020405.html 2 0 0 0 /news/whitgraham070515 5 20467 0 1 /news/ashford140517 2 7490 0 0 /news/kentleague/deal/Sampson18.html 3 0 0 0 /news/afccroydonathletic170818 1 3406 0 0 /news/drmartens/premier/dover/18thnov04.html 1 0 0 0 /news/iwanttoseehowwecandoagainstareallygoodsidesaysvcdathleticbosstonyrussell 5 24227 0 0 /news/ashford061115 4 10200 1 1 /news/kentleague/cray/crayvrams081103.html 1 0 0 0 /news/551bc5e67744f 3 13396 0 0 /news/sheppey160618 2 7142 0 0 /assets/images/email/Thumbs.db 1 63488 0 0 /news/ourfocusistobuildateamtogetpromotionsaysmargatechairmanboblaslett 4 16393 0 0 /news/4thdec04.html 1 0 0 0 /news/bromley030619 4 16601 0 0 /news/551a95b441618 1 5568 0 0 /news/e&bvfolk010104.html 3 0 0 0 /news/fleetdown140717 2 8856 0 0 /news/fordchallengeshissidetogetintoplay-offs 2 7708 0 0 /news/lyddtown120118 3 13332 0 0 /news/fleetdown280715 4 22670 0 0 /assets/ckeditor/plugins/pastefromword/ 5 1833 0 0 /news/wehavenothingtolosesotheresnopressureonussaysashfordunitedcoachjohnovard 2 9374 0 0 /news/T&Mvbrom060304.html 1 0 0 0 /news/folkestone301104.html 1 0 0 0 /news/551a95b3c0658 4 14222 0 0 /news/hopefullywecantakeituptothenextlevelandprogresssayssevenacresidcupbossleehill 3 13935 0 0 /news/beckenham251218 3 13404 0 0 /news/whyteleafe2-0wellingunited-wingscometotermswithshockingfacupexit 1 6990 0 0 /archive-2006-2014/73 1 4975 0 0 /news/pennockruesmissedchances 3 11696 0 1 /news/idontfearanyoneinthisleaguesaysramsgatebosstimdixon 3 12407 0 0 /news/rothwelltown1sittingbourne0 4 15524 0 1 /news/551bc5e6b166e 3 19787 0 0 /news/afccroydonathleticA170120 2 8018 0 0 /news/maidstoneunited2-0tootingmitchamunited-itwasimportanttobounceback-hume 1 5058 0 1 /news/bromleygointothenewseasonlookingforprogress 2 9908 0 0 /news/551a9c91a321a 1 3386 0 0 /news/forestgreenrovers0gravesendnorthfleet0 2 7416 0 0 /news/fcelmstead080917 4 12449 0 0 /news/twokentclubschasedrydenasstrikerturnsdowndovercontract 2 7638 0 1 /news/werereadyforpromotion-burman 2 8568 0 0 /news/dulwichhamletaimtosecureasustainablefutureatchampionhill 3 12520 0 0 /news/hernebay4-0erithtown-danlawrencehasgothishungerbacksayshernebaybosssimonhalsey 2 15464 0 0 /news/drmartens/eastern/ashford/21stoct03.html 1 0 0 0 /archive-2006-2014/195 4 16930 0 0 /news/kentleague/cray/crayvsandhurstfac130903.html 1 0 0 0 /news/ihonestlybelievewewilloutgrowalotofteamsinacoupleofyearstimesayssteveoboyle 5 24566 0 0 /news/folkestonestagescharitymatchfortwokenthospices 2 6770 0 0 /news/namechangeforgravesendnorthfleet 4 19518 0 0 /news/wehavebeenonapoorrunofformadmitskentfootballunitedbosssammacneil 1 4380 0 0 /news/kentleague/tunbridgewells/18thaug04A.html 1 0 0 0 /news/itsabigjobwithalottobedonesayscraywanderersnewbosskeithbird 6 41839 0 0 /news/hessenthalerplansforexcitingtimes 1 3072 0 0 /news/bearsted090717 2 7674 0 0 /news/hbayvcray270304.html 2 0 0 0 /news/folkestoneinvictabossneilcugleylooksforwardtohis801stgameincharge 2 7940 0 0 /news/bstortfordreplay150305.html 3 0 0 0 /news/3rdaug05.html 2 0 0 0 /news/551a99e425b90 1 3397 0 0 /kentcounty-2003-2006 13 34620 0 0 /news/bromleystrikeitluckywithnewsignings 1 3319 0 0 /archive-2006-2014/278 4 17257 0 0 /news/bogdul010517 3 30359 0 0 /news/551bc99a7be53 1 3667 0 0 /news/NationalLeague230121 3 33036 1 1 /news/greenwich200117 1 3768 0 0 /news/harrowcupreplay051004.html 2 0 0 0 /news/stonessetupdonationfacilitytoassistwithnewstadium 3 11434 0 0 /news/sladegreenconsidertheirimmediatefuture-exclusive 2 7246 0 0 /news/charltonathletic010421 78 315988 5 44 /news/wingatefinchley301004.html 1 0 0 0 /news/wellgivelordswoodrespecttoavoidcupupset-munday 1 4816 0 0 /news/551bc5e6f38ee 3 18943 0 0 /news/iwantmyplacebackintheteam-exclusiveinterviews 1 4096 0 0 /news/ashfordtownp-pwhitstabletown-kentderbyfails4pmpitchinspection 1 2681 0 0 /news/551a979ace0d3 2 8928 1 0 /news/folkestoneinvicta1-0afcwimbledon 2 9979 0 0 /news/16thfeb05.html 2 0 0 0 /news/sevedart060719 4 33544 0 0 /news/phoenix220218 2 8383 0 0 /news/551a9797cca67 1 3374 0 0 /news/DCMSLetter280920 2 9284 0 0 /news/kentleague/beckenham/beckenham.html 2 0 1 1 /news/crawley270704.html 2 0 0 0 /news/resultsinfriendliesdomattersayscraywanderersbossianjenkins 2 9670 0 0 /news/pitchero.com/clubs/corinthianfc 2 0 0 0 /news/551a9797e49fa 2 8836 1 0 /news/dealtown090717 1 3673 0 0 /news/snodlandtown191118 6 18758 0 0 /news/wecouldntworkwithoutanyfundssaysmiles-exclusive 1 4887 0 0 /news/craywandererspartcompanywithkeithbird 6 22976 2 2 /news/551a956b6efbd 1 3632 0 0 /news/doverathleticbringscottishacesteventhomsontocrabble 1 4092 0 0 /news/dockerssparkconfusionoveron-offcuptie 2 7002 0 1 /news/hugolangton250218 4 17218 0 0 /news/551bc99d81fe3 1 4671 0 0 /news/tonbridgeextendgloziersloanspell 3 8882 0 0 /news/dulenf270417 3 30876 0 0 /news/551a97b18626b 1 4284 0 0 /news/dealtown080416 4 12361 1 0 /news/wejusthavetoreactatconcordrangerssayscraywanderersbossianjenkins 1 3737 0 0 /news/551bc5e10526e 1 5717 0 0 /news/lordswood030217 1 3897 0 0 /news/iveenjoyedmytimeatfisherbutimundecidedatthemomentsaysco-managermartinford 3 13559 0 0 /news/soccershortsliamdaishsignstwo-yearcontractextensiontostayatstonebridgeroad 2 16210 0 0 /archive-2006-2014/109 1 5043 0 1 /news/hocktoncollectsrymanleaguegoldenbootaccolade 1 4020 0 0 /news/kentleague/maidstone/whitstable241004.html 1 0 0 0 /news/tonbridgeangels161220 3 9534 0 1 /news/beckenhamtown1-2kingslynntown-myplayerscouldntgiveusanymoresaysguttedmarks 1 9219 0 0 /news/551bc5dc48505 2 10150 0 0 /archive-2006-2014/256 6 25364 0 0 /news/kentmanagersreactiontomouth-wateringfacupthirdqualifyingroundties 2 10330 0 0 /news/confidenceishighgoingintoourlastsixgamessayssawyer 2 7387 0 1 /news/hytheheroesportershockshappeninthefacup-whycantitbeus 1 5247 0 0 /news/cablestakenfromculverdenstadium 1 3494 0 0 /isthmian-league/48 5 22175 0 0 /news/26thdec04.html 2 0 0 0 /news/wewouldntbewherewearewithoutchairmangaryhillmansaysianjenkins 3 18613 0 0 /news/lewiskent080118 5 51010 2 2 /news/bromgills210715 4 34738 0 0 /news/glebe100517 4 14801 0 0 /news/551bc5dd537cc 7 87827 4 3 /news/tonbridgeangels301120 3 9875 0 0 /news/idontthinkanybodycanbelieveititsafairytaleforasmallclublikeourssaysterryhill 3 15751 0 0 /news/551a979a4fb08 2 9498 0 0 /news/greenwich171217 1 3896 0 0 /news/beckenham290718 1 4010 0 0 /news/imexpectingatoughgameagainstwhitstablesaysthamesmeadbosskeithmcmahon 1 5219 0 0 /news/shaunwelfordisgoingtobringalotofgoalsandgoodtimestoourclubsaysscottporter 6 26072 0 1 /news/faversham161020 6 26010 0 0 /news/ChatvSitt010104a.html 1 0 0 0 /news/kentleague/beckenham/erithtown191004.html 1 0 0 0 /news/londkent310116 5 75925 0 1 /news/snodlandtown091019 4 13989 0 0 /news/soccershortswevenotgotabudgetlikemanchestercitysaysbutler 1 8212 0 0 /news/wejusthavetoscoreafewmoregoalssaysramsgatebosstimdixon 3 18190 0 0 /news/budgetcutsforcedmetoleaveramsgaterevealsroyston 1 3456 0 0 /news/551bc5e5c4b04 2 8247 0 0 /news/doverathletic4-2dartford-unstoppabledovergo13pointsclearattop 2 13156 0 0 /news/worthingunited230815 4 16810 0 0 /news/greenwich26062018 4 15062 0 0 /news/FALeaguesStatement080121 5 27189 1 1 /news/supportersbidtogetfolkestoneinvictabackonitsfeet 2 6839 0 0 /news/metrodavies080515 3 15548 0 0 /news/cock-uphandscockfosterstie 2 6028 0 0 /news/shamefulstephensonbootedoutbysevenoaksforspittingatreferee 2 6500 0 0 /news/releasingpairwasadifficultdecisionihadtomakeadmitsburman 1 4570 0 0 /news/hugolangton181015 4 17653 0 0 /news/551a97b0831ae 1 3022 0 0 /news/greeniesgoodfridaypreview 1 6001 0 0 /news/551a9678e4942 1 5965 0 0 /news/dulwichhamlet1-0chathamtown 1 3592 0 0 /news/idontputpressureonmyplayerssayspennock 2 7320 0 0 /news/kentleague/lordswood/lordvramsfav181003.html 1 0 0 0 /news/maidstone311016 3 14037 0 0 /news/dartford2-7tottenhamhotspur 1 5991 0 0 /archive-2006-2014/58 2 10048 0 0 /news/551a97996dab3 1 4608 0 0 /news/551bc5e85057d 2 7549 0 0 /news/resultsaugsept2017A 3 42242 0 0 /news/iwanttoguidethedartsbackintotheconferencesaysburman 1 4424 0 0 /news/whitstabletown0-1dulwichhamlet-rivalbossrosesaidsorrytomerevealedcaretakernolan 1 5772 0 0 /news/551a956b62481 1 3597 0 0 /news/sittingbourne0-1leatherhead-wejustcantstopmakingstupidmistakessaysdannyward 1 6395 0 0 /news/iwillputthingsrightvowsdolby-exclusive 1 4674 0 0 /news/drmartens/eastern/sittingbourne/13thaug03.html 2 0 0 0 /news/wellingtown290419 2 8166 0 0 /news/hollandsblair0-1ashfordunited-wevepushedawellpaidsidefor90minutessayspiggott 2 17690 0 0 /news/maidstoneunited0-0croydonathleticwedidntperformtonightadmitstabletoppinghume 1 6097 0 0 /archive-2006-2014/236 3 12599 0 0 /news/conference/margate/19thnov04.html 1 0 0 0 /news/myhardworkingplayershavethebelieftogetintotheplay-offssaysgaryabbott 1 4182 0 0 /news/wellspitchintostuntitlefavourites 1 4056 0 0 /news/thamesmead230618 4 17874 0 0 /news/mersbird030515 4 22610 0 0 /news/kentleague/lordswood/lordvbeng130304.html 1 0 0 0 /news/bridon291216 4 14680 0 0 /news/othernews/crayvalley031204.html 1 0 0 0 /news/punjab091217 3 10491 0 0 /news/stonevowstoreturnfromhorrendouslegbreak 1 4680 0 0 /news/fcelmstead180219 2 7068 0 0 /news/folkestoneclosetounveilingnewboardmembers 3 21757 0 0 /news/favershamturner270415 4 20658 0 0 /news/triomissingforsittingbourne 2 6924 0 0 /news/hernebay270320 2 8930 0 0 /news/greenwichborough1-2hungerfordtown-sendingoffcontroversymarsborovaseexit 2 13192 0 2 /news/551bc5e4c4a6e 1 6007 0 0 /news/icantwaittogetstartedataqualityclubsaysnewbromleycoachhugolangton 6 19549 0 0 /news/551bc99b37df9 1 3394 0 0 /news/margate-fc.co.uk 2 0 0 0 /news/tompkinsaddsmalintodockersmanagementteam-exclusive 1 4153 0 0 /news/playingfourgamesaweekisdifficultsaysburman 2 8205 0 0 /news/dulwich050218 1 3167 0 0 /news/551a9c0f08893 3 13128 0 0 /news/kentleague/ramsgate/kingstonian180904.html 1 0 0 0 /news/erithbel240517 3 13590 0 0 /news/crockenhill200717 4 12558 1 0 /news/551a9c928e29b 3 12284 0 0 /news/kentcountyleaguestatement050420 2 6668 0 0 /news/beckenham280219 4 17789 0 0 /news/bromley090519 3 11694 0 0 /news/kentleague/maidstone/14thjan04.html 1 0 0 0 /news/sevenoaks290418 1 4875 0 0 /news/erithbelvedere2-0favershamtown 3 13573 0 0 /news/wellsct160218 2 19032 0 0 /news/551bc5df09685 2 12952 0 0 /news/8thdec05G.html 3 0 0 0 /news/werefightingtokeepourheadsabovewateradmitsward 2 7842 0 0 /news/kentleague/sevenoaks/sevenoaks.html 1 0 0 0 /news/hythe010116 3 12741 0 0 /news/weregettingonwithadversitysaysinjury-hitramsgatebossjimward 1 4336 0 0 /news/kentleague/ramsgate/ramsgatevhythe120803.html 2 0 0 0 /news/cordiceiamnotsureiftheyknowwhatittakestowintheleague 1 4788 0 0 /news/stonesareraringtogo 1 2989 0 0 /news/wellgoouthellforleathertowinourfinalthreegamessaysfolkestoneinvictabossneilcugley 2 9438 0 0 /news/wejusthavetosortourhomerecordoutsayscraywanderersbossianjenkins 3 13613 0 0 /news/corby121105.html 2 0 0 0 /news/fleettown1-1chathamtown-milesitsabotuttimefortuneturnedinourfavour 2 7693 0 0 /news/weveblownourtitlechancesadmitsfoley-exclusiveinterview 1 4273 0 0 /news/farnieweneedmoreleaguepointsbeforetrophyfinalexclusive 3 16019 0 0 /news/theroadtowembley 1 9526 0 0 /news/Gillsladies180715 7 67385 3 3 /news/stonesgivenclearancetocontinueathomelandsstadium 1 4321 0 0 /news/dulhar181016 1 8439 0 0 /news/itsallquietonthekentishtransferfront 4 25445 0 0 /news/hopefullystuartkingwilldothebusinessontheparkforussaysneilcugley 5 29220 0 0 /news/lovellscoopsmanagerialaward 2 6956 0 1 /news/favershamapplyforpromotionintorymanleague 2 7660 0 0 /news/551bc5dd4a45f 3 11534 0 0 /news/crayvalley290718 1 3408 0 0 /news/551a97b1dc6b2 1 4414 0 0 /news/itsridiculousthatwehavetoplaytwicein72hoursbemoanscrayassistantjoefrancis 1 5608 1 0 /news/fcelmstead300819 3 12497 1 0 /news/CONIFAWorldCup270518 3 11041 0 0 /news/whitstabletown2-2ashfordtown-lane47rollsbacktheyears 2 10154 1 0 /news/551bc5e27d721 2 9606 0 0 /news/soccershortstommyosbornestaysformaidstoneunitedshomecoming 6 45816 3 4 /archive-2006-2014/8 4 19826 0 0 /news/margdulwposf1201515 4 27937 1 0 /news/GovernmentStatement070920 4 21977 1 1 /news/ksporglebe040417 4 43642 0 0 /news/charltonathletic3-0miltonkeynesdons-wewerentplayingatourbestadmitsstuartweston 2 14938 0 0 /news/wemustbefocusedandprofessionaltoavoidcupupsetsayscugley 1 3700 0 0 /news/whitstabletown1-0ramsgate-wewanteditmoresayslane 1 5156 0 0 /news/trainingonmaidstoneuniteds3gpitchisfantasticforouracademyboyssayscoachjackparkinson 2 11152 0 0 /news/smellsliketeenspirit-beckssignlionspaironloan 1 3765 0 0 /news/kentyouth/02-03honours.html 2 0 0 0 /news/rymanleaguecupdrawholdersramsgatehandedsecondderbydraw 3 10751 0 0 /news/pastadversariesburythehatchet 3 13360 0 0 /news/maidstone010820 3 11427 0 0 /assets/fileman/Uploads/Documents/ 5 1622 0 0 /news/craywands021015 4 19894 0 0 /news/551a96dbf02e8 2 8164 0 0 /news/corinthian040816 2 7974 0 0 /news/dartford2-1stainestown-theresagoodfeelingabouttheteamsaysdartfordbosstonyburman 1 5788 0 0 /news/sittingbourne1-1waltoncasuals-iknewtheplayerswouldntletmedowntonightsaysbrady 1 6539 0 0 /news/othernews/favase1stround.html 1 0 0 0 /news/lyddholm110817 4 18626 0 0 /news/francisblamessuicidaldefendingforfirsthalfhorrorshow 2 7939 0 0 /news/playersgavemeeverythingpraiseswakeling-exclusiveinterview 4 18817 0 0 /news/corinthian130120 2 8162 0 0 /news/holdersheroicssavesborough 5 23387 0 0 /news/trottexpectshighpressurisedthanettussle-exclusive 2 8821 0 0 /news/whytvbrom060104A.html 1 0 0 0 /news/wardgivestrialistsachancetoshine 2 7019 0 0 /news/nationalawards021015 7 61798 2 3 /news/dartford020106.html 2 0 1 0 /news/4thaug03.html 1 0 0 0 /news/doubleswoopforfisher 1 3108 0 0 /news/whitstabletownfacefinancialsetbackasthievesstrikethebelmont 1 4747 0 0 /news/phoegree110315 2 18054 0 0 /news/lewishamborough3-0coneyhall-ouravenuesleadtotherymanleaguesaysambitiousqueely 1 7322 0 0 /news/wardhopes2007willbeanothersuccessfulyearforrams-exclusiveinterview 3 12041 0 0 /news/wardpaystributetochairmanashepreparsformoreofthesamenextseason 1 4024 0 0 /news/leatherhead100905.html 1 0 0 0 /news/4thjan06.html 1 0 0 0 /news/ifwerenotmentallypreparedforabattlewellcomeunstuckwarnswellingunitedbossjamieday 3 12835 0 0 /news/30thjuly04.html 1 0 0 0 /news/551bc5e0d6c06 1 4003 0 0 /news/beckroch151117 2 21230 1 1 /news/crayphoe041017 3 29178 1 0 /news/hopefullyitwillbeagreatdayforgreenwichboroughsayspaulblade 2 10810 0 0 /news/bearsted150616 3 9942 0 0 /news/drmartens/eastern/dartford/11thoct04.html 1 0 0 0 /news/vcdathletic3-0tunbridgewellsfordheapspraiseonbattlingrivals-exclusiveinterviews 1 6277 0 0 /news/smithextendshisstayatashfordforanothermonth 1 3811 0 0 /news/favershamtownfootballclub 1 2899 0 0 /news/deal070817 2 7546 0 0 /news/welling081217 4 13881 0 0 /news/beaconsfield181204.html 2 0 0 0 /news/onourdaywerecapableofwinningagainstanyteaminourleaguesaysbromleybossmarkgoldberg 5 22125 0 1 /news/551a9c0e6bbb1 1 5381 0 0 /drmartens 12 37804 1 1 /news/crowborough050816 2 9815 0 0 /news/ramsstrikerwelfordreturnstoformerclub 2 7552 0 0 /news/551bc5e0c6029 1 6445 0 0 /news/chathamstalwartawardedforhisefforts 3 10063 0 0 /news/greenwich010916 2 7569 0 0 /news/28thjuly04.html 1 0 0 0 /news/wevegottheplayerstostayupsayslovell 1 5105 0 0 /news/ksports190719 5 19306 0 0 /news/551bc5dace7a9 2 6154 0 0 /news/winchester280804.html 1 0 0 0 /news/551a967770be4 1 4782 0 0 /news/wealdstone3-2ramsgate-theygaveusafootballlessonadmitsramsgatebosstimdixon 7 58761 2 1 /news/3rdaug04.html 2 0 0 0 /news/warddoeshishomeworkontheirrivals-exclusive 2 8656 0 0 /news/wedontwanttoseenotgettingautomaticpromotionasafailuresaysdartfordbosstonyburman 1 4297 0 0 /news/ivealwaysbeenagoodadmirerofstuartvahidadmitsramsbossjimward 1 3999 0 1 /news/drmartens/premier/dover/8thaug04.html 1 0 0 0 /archive-2006-2014/33 1 5033 0 0 /news/fisher1-1crayvalley-wedontwantteamstogettoofaraheadofussaysstevechapman 4 38200 0 0 /southern-counties-east-football-league/21 11 54138 0 0 /news/wfinchley090405.html 1 0 0 0 /news/ifwegettothetop-tenbychristmasweveachievedourgoalsayshythetownbossscottporter 1 4309 0 0 /news/551bc5e570056 2 12628 0 0 /news/hythetownsearchforfriendlyawaydate 6 20695 0 0 /news/551bc5e782cb5 1 3068 0 0 /news/resultsdecember2013 2 19782 0 0 /news/resultsjanuary2012 2 16894 0 0 /news/iwanttohavearuninthefacupsaysianjenkins 1 4417 0 0 /news/hollandsblair180915 4 14194 0 0 /news/phoenix010620 3 10084 0 0 /archive-2006-2014/260 6 25249 0 0 /news/551a95b46dbe7 1 4188 0 0 /news/billericaytown1-1maidstoneunited-humepraiseshisyoungstars 5 55345 4 4 /news/whitehousepraisesclokeasdoverathleteickillofftootingstitlehopes 1 4342 0 0 /news/tunbridgewells211218 3 11241 0 0 /news/drmartens/premier/dover/29thoct03.html 1 0 0 0 /news/551bc99dd3b53 1 5761 0 0 /news/ryansdeparturefreesupsomecashforlovell 2 5996 0 0 /news/mypriorityistoimprovewithlocalplayerssaysrusthallbossronaldson 1 3542 0 0 /news/tonbridge270716 1 3909 0 0 /news/bromnott210919 5 46897 0 0 /news/hythetown4-1hernebay-smissenhat-trickisperfectresponseforfisk 2 8632 0 0 /news/551a96dc17346 4 30605 0 0 /news/tonbridge021217 2 8016 0 1 /news/bromley020817 1 3402 0 0 /news/551a9c0e8d486 1 2942 0 0 /news/wellingtown121020 2 10262 0 0 /news/551a9cf5a8ce7 1 4681 0 0 /news/sheppey040717 3 11316 1 0 /news/greenwichvcray060903.html 2 0 0 0 /archive-2006-2014/199 4 16494 0 0 /news/massiverespecttojpcollierforallthathehasdoneforholmesdalesayscoachrossmitchell 3 10939 0 0 /news/3rdmay04.html 1 0 0 0 /news/theeagleshavelandedexclusiveinterview 3 9695 0 0 /news/weowethepoliceoneafterawaydefeatsaysabbott 2 8015 0 0 /news/folkvburn170404.html 2 0 0 0 /news/wevegottokeepgrindingoutresultssaysmaidstoneunitedbossjaysaunders 3 12841 0 0 /news/wedontfearanyonesaysdoverathleticbossnickyforster 2 7698 0 0 /chatham-2003-2006 12 36085 0 0 /news/whitstable190419 4 14165 0 0 /news/ambitiousashfordsettounveilstadiumplans 1 4458 0 0 /isthmian-league/21 2 9634 0 0 /news/greenwich230218 1 4217 0 0 /news/phoenixsports310119 3 12516 0 0 /news/ksporlord300919 3 31704 0 0 /news/551a967803ab9 1 5534 0 0 /news/crayvalleymoveintofourthplace 1 3557 0 0 /news/hollbeck110817 1 4179 0 0 /news/otfordunited0-3fleetdownunited-werecapableofupsettingafewteamssaysfleetdownboss 1 7407 0 0 /assets/ckeditor/plugins/forms/ 5 1874 0 0 /news/551bc5e274c54 1 3454 0 0 /news/551bc5e2edf38 3 13301 0 0 /news/hythetownunveilnewsponsorshipdeal 1 3599 0 0 /news/551bc5e4b2525 1 2869 0 0 /news/resultsforoctober2007 2 12278 0 0 /news/aclubofdoverssizeshouldbeaimingtogetoutofthisleaguesaysdarylmcmahon 3 11735 0 0 /news/551a97b167754 1 4759 0 0 /news/greeniesfridaypreview-canwhitstablecauseashockovermargate 3 19280 0 0 /news/gbfccafc080416 4 17086 1 0 /news/bromley230819 3 9971 0 0 /news/tonbridgeangels1-1bromley-hopefullyitsnottoolittletoolatesaystommywarrilow 3 27147 0 0 /news/dartford4-2ashfordtownmiddlesex-disasterousmarchcostusaplay-offplaceadmitsburman 2 14068 0 0 /news/langtonhailsashfordsrecentarrivals 2 8333 0 0 /news/othernews/SECWFL010204.html 1 0 0 0 /news/matchreportshaltingourtrophytiewasridiculousfumesdoverchairman 1 8795 0 0 /news/welling221015 3 11358 0 0 /news/seagerfearsthedropasmistakesprovecostly-exclusive 1 5390 0 0 /news/551bc5e093b3d 1 6579 0 0 /news/551bc99b7f9fd 1 4015 0 0 /news/drmartens/eastern/folkestone/folkvtonb160304.html 1 0 0 0 /news/hollandsblair1-0ashfordunited-therewasabitofpressueonustodaysaysblairbosspiggott 1 6862 1 0 /news/farnboroughsnapuptwoformerfleetdefenders 1 6772 0 0 /news/erithbelvedere5-1frimleygreen-wewanttostayinthevaseforaslongaswecan-collins 3 26451 1 0 /news/551a931de5186 1 4225 0 0 /news/frenchstrikerwantedtoomuchmoneyrevealshessenthaler 1 3818 0 0 /news/everythingatconeyhallneedstobeaddressedsaysnewdirectoroffootballchristucker 1 5387 0 0 /news/othernews/charltonladies7thsept03.html 1 0 0 0 /news/dartford180105.html 2 0 0 0 /news/wedofeelpeoplearenotgivingusachancesaysdartfordbosstonyburman 3 13256 0 0 /news/soccershorts210618 4 19293 0 0 /news/chipnewr140519 4 34136 0 0 /news/sittingbourne0-3chipstead-myplayersshouldgohomeembarrassedafterthatfumesgaryabbott 1 6110 0 0 /news/vcdathletic3-2hythetown-youcantjudgeaseasonontheopening90minutessaysporter 3 18457 1 1 /news/crayleyt260716 1 8379 0 0 /news/rymanpreviewsburmandoesnotwantcasualattitude 3 16193 0 0 /news/soccershortsfleetgoalkeepercroninrecalledbyengland 2 14572 0 0 /news/ryman/bromley/croyathvbrom020304A.html 1 0 0 0 /news/thamvcd271217 1 3008 0 0 /news/ramsvtham060404.html 2 0 0 0 /news/kentleague/cray/1stsept03.html 1 0 0 0 /news/soccershortsmanagersmakesigningsintimeforbigkick-off 1 11133 0 0 /news/551bc5e57a833 2 10242 0 0 /news/ashfordtownfaceuncertainfuture 2 10506 0 0 /news/phoehyth171118 4 48588 0 0 /news/conference/margate/wforest021004.html 1 0 0 0 /assets/ckeditor/plugins/wsc/dialogs/ 1 441 0 0 /news/tolfreystepsdownasholmesdaleschairman 2 7710 0 0 /news/kentleague/hythe/22ndaug04.html 1 0 0 0 /news/bromyeov081220 10 71114 1 2 /news/phoenix310719 3 14439 0 0 /news/soccershortssittingbournebossgaryabbotthappytothrowin16-year-oldagainstleatherhead 1 14613 0 0 /news/moorelookingforwardtobigstonesshowdown 2 7444 1 0 /news/551bc5e08a7dd 2 24758 1 0 /archive-2006-2014/118 2 10074 0 0 /news/kentleague/tunbridgewells/18thnov04.html 1 0 0 0 /drmartens/premier/welling/8thsept04.html 1 2532 1 1 /news/favasesecondroundspecialfarnieblastsschooloversheaselection-exclusive 2 10164 0 0 /news/crowseve300418 1 3091 0 0 /news/facupspecialmccarthytheyoungsterswantsuccess-exclusiveinterview 1 4964 0 0 /news/whitstable140804A.html 1 0 0 0 /news/notmanypeopleexpectedustobewherewearesaysmcmahon 2 8908 0 0 /news/istillbeleiveweshouldhavemorepointsthanwecurrentlyhavesaysnickysouthall 5 20775 0 1 /archive-2006-2014/105 2 9768 0 0 /news/folkestoneinvicta4-3waltonhersham 1 4889 0 0 /news/soccershortstonbridgeangelsbidforhornetsleadingscorer 1 5994 0 0 /news/othernews/fat3rdround.html 1 0 0 0 /news/iwillbebuildingtheclubfromtoptobottomsaysnewderesbossmattlonghurst 4 16569 0 0 /news/ourclose-knitsquadareallhappyinsistsramschairman 2 6782 0 0 /news/theplayerswillwanttoputthingsrightsaysfolkestoneinvictabossneilcugley 2 9242 0 0 /news/dealtownbossderekharesexpectstightfacupclashagainstrivalshythe 2 10286 0 0 /news/fcelmstead201016 3 10599 0 0 /news/fisher1-3bethnalgreenunited-wedidntperformonthenightadmitsstevefirkins 1 7441 0 0 /news/551bc5e1d8b5e 2 9794 0 0 /assets/fileman/lang/it.json 1 3672 0 0 /news/sittingbourne291120 2 6770 0 0 /news/100000debtalmostwipedoutdulwichhamlet 2 7721 0 0 /news/bromleyaddreevestotheircoachingstaff 1 3500 0 0 /news/justgiving.com/fundraising/Ricky-Bennett3 2 0 0 0 /news/thamesmeadtown5maidstoneunited2-barnesinhotdemand-exclusiveinterview 5 31168 0 0 /news/551bc5e78531e 2 8306 0 0 /news/551a99e3c4e7f 1 3305 0 0 /news/sctmer120916 7 143009 2 1 /news/roberts-bond290418 4 13966 0 0 /news/551bc5da52656 7 87827 2 3 /news/icantgoonforeversayslong-servingvickersbossford-exclusiveinterview 2 9491 1 0 /news/grazioliappointedlondonscoutforbristolrovers 2 6293 1 0 /news/hernebay3-1hanworthvilla-ourfavaseruniskeepingmyplayersattheclubsayssimonhalsey 3 23084 0 1 /news/icouldntstandinmikelsuarezswaysaystonbridgeangelsbosstommywarrilow 2 7522 0 0 /archive-2006-2014/28 3 14803 0 0 /news/cafc.co.uk/news/view/5edf3aa26a41c/consortium-led-by-businessman-paul-elliott-purchases-east-street-investments 2 0 0 0 /news/othernews/britishenergykentcountyleaguetables140304.html 1 0 0 0 /news/iknowmyteamwillonlygetstrongersayshollandsblairbosspaulpiggott 2 7816 0 0 /news/wingsbossfordwaitspatientlyforademola 1 4097 0 0 /news/isthmianleaguestatement181120 2 6154 0 0 /news/551bc5e502ba8 1 3927 0 0 /news/19thnov03.html 2 0 0 0 /news/longhurstcontinuestorebuildhissladegreensquad 1 3735 0 0 /news/dartford200918 3 14676 0 0 /news/finalshouldbeplayedatprincesparkbemoansgorman 2 8285 0 0 /news/551bc5e09bcba 1 6677 0 0 /news/551bc5e01cfcc 1 5371 0 0 /news/551a99e449c8f 1 4488 0 0 /news/doverathletic2-1wycombewanderers-weregettingthere-sayshess 2 12408 0 1 /news/glebe260120 3 12720 0 0 /news/551a96dc5a426 4 25306 0 0 /news/bromley010420 4 14920 0 0 /beckenham-2003-2006/2 4 12058 0 0 /news/551bc99e42073 1 5244 0 0 /news/everythingwedowealwaysexceedinsaysglebechairmanrockymcmillan 6 35918 0 0 /news/cugleyunveilsedgeashisnewplayer-coach 2 10367 0 0 /news/idgivesittingbourneoddsof10-1ofprogressinginthefacupsaysbossjimward 1 4855 0 0 /news/nomadswell170516 3 28883 0 0 /news/otford081217 2 6690 0 0 /news/wecouldhopefullyhaveagoodseasonwithalltheproblemswevehadsaysneilcugley 2 7808 0 0 /news/tunwcroy290815 4 41638 0 0 /news/wevegottopickupleaguewinsdemandsgibbons 1 4121 0 0 /news/bromley090815 4 21073 0 0 /news/bromley270720 3 10240 0 0 /news/holmesdale290418 4 14406 0 0 /news/wellingunited1-2lutontown-improudoftheboyssayswingsbossjamieday 1 6358 0 0 /news/19thjune05.html 1 0 0 0 /news/soccershorts030916 2 13117 1 0 /news/imdelightedtobebackasmanageratsittingbournesaysnickdavis 3 13396 0 0 /news/croydon3-0sladegreen 2 7246 0 0 /news/idontthinkiwasgivenafairchancesaysformererithtownbossjamescollins 3 18479 0 0 /news/kentleague/sladegreen/sladevrams200304.html 1 0 0 0 /news/kentleague/cray/21stoct04.html 1 0 0 0 /news/beatingdereswasourbestperformanceoftheseasonhailscorinthianbossjamescollins 3 10264 0 0 /news/551bc99b8de72 1 4840 0 0 /news/551bc5db38e92 3 18872 0 0 /news/551bc99c858da 1 4717 0 0 /news/551bc5db15f0c 2 8092 0 0 /news/551a9250b2b2e 1 3648 0 0 /news/hawkinsfacesuptolifebeingasemi-pro 2 7028 0 0 /news/fordpraiseshisshininglights 2 8624 0 0 /news/551a9718ae02d 1 3522 0 0 /news/punjab110119 4 14362 0 0 /news/551bc5dceb1e2 1 3106 0 0 /news/ourplanistogetasmanylocalplayersplayingforsittingbournesaysjimward 3 14806 0 0 /news/craywanderersmanagementteamworktobringinfundsfortheirplayingbudget 2 11872 0 0 /assets/select2/tests/selection/multiple.html 1 287 0 0 /assets/select2/src/scss/_multiple.scss 1 444 0 0 /news/meadsearchfornewplayers 6 17072 0 0 /news/itsnotabouttheperformancebuttheresultsayssittingbournebossmattwyatt 4 13910 0 0 /news/craywanderers1-5lewes-someplayersmustlookatthemselvesinmirrorandshowsomeheart-bird 1 8489 0 0 /news/conference/margate/12thsept03.html 1 0 0 0 /news/othernews/26thaug03.html 1 0 0 0 /news/bourneterminateshiscontractatcheritonroad 1 4939 0 1 /news/ramsvsidleyfavase230903.html 2 0 0 0 /news/wingatefinchley1-2sittingbourne-itmeanssomuchtoplaylucrativedartfordtie-abbott 1 7201 0 0 /news/goodfridayfamilyfunatfolkestone 2 7084 1 1 /news/sittingbourneseethelight 3 9758 0 0 /news/sittingbournefc.co.uk 1 0 0 0 /news/idlovetoputthesilverwareonthetablesayscorinthianbossmattlonghurst 2 8838 0 0 /news/551bc5dd02f1c 1 3605 0 0 /news/harrybeautymanturnsposh 4 24170 0 1 /news/folkestone240417 2 8726 0 0 /news/551a956b86fc7 3 16899 0 0 /news/hydefacesaraceagainsttime-exclusive 1 3053 0 0 /news/whitstable060418 1 3650 0 0 /assets/reports/ 5 1558 0 0 /news/ishouldgetanawardforbeingthemosthatedplayerinthekentleaguesaysnortonsbentaylor 1 5204 0 0 /news/wellingunited3-1folkestoneinvicta 1 4695 0 0 /news/551a956c73a29 2 6514 0 0 /news/othernews/16thnov04.html 1 0 0 0 /news/dartford5-0kingstonian-itsburnsnightforscintilatingdarts 1 7516 1 0 /news/ambitiousclubbegintheirclimbupthepyramid-exclusive 1 3470 0 0 /hythe-2003-2006/ 1 3039 0 0 /news/greenwichboroughfc.co.uk 2 0 0 0 /archive-2006-2014/35 2 10092 1 0 /news/chelmdart120819 4 38244 0 0 /news/maidstoneunitedp-phiston-anotheronebitesthedust 1 2866 0 0 /beckenham-2003-2006 13 50634 0 0 /news/551a99e5551da 1 6247 0 0 /news/kentleague/whitstable/7thjuly03.html 2 0 0 0 /news/kentleague/tunbridgewells/ramsgate301004.html 1 0 0 0 /news/ramsgate1-2whitstabletown-itwasadayforheroeshailswhitstablebossjustinluchford 1 7070 0 0 /news/sittingbourne090119 3 9954 0 0 /news/wevegotmorefireinourbelliestogoonandbesuccessfulagainsaysblairbosspaulpiggott 4 16829 0 0 /news/strikerboostforfolkestoneinvictabossneilcugley 1 4738 0 0 /news/551a9cf4eb620 1 3722 0 0 /news/greenwich011216 1 4210 0 0 /news/ryman/bromley/erithandbelvedere070804.html 1 0 0 0 /news/floodlights210819 3 15278 0 0 /news/ourmindsareonthejobinsistswatson 2 7874 0 0 /news/ashfordshowingthegreenshootsofrecovery 2 8554 0 0 /news/dartford4-5aveley-burmanourdefendingwasappalling 2 11081 0 0 /news/soccershorts260516 9 152523 5 5 /news/williamsontheendofbitter-sweetderbydaydefeat 2 7908 0 0 /news/wellingtown091020 3 12369 0 0 /news/kentleague/sladegreen/sladevcray100204.html 1 0 0 0 /news/dalersunveilhughesastheirnewcoach 2 9628 0 0 /news/hythe241116 2 7354 0 0 /news/gillingham3-1charltonathletic-weredefinitelyintherewithatitleshoutsaysjackwheeler 4 44074 0 0 /news/angelsinheavenwewonpromotionforourfanssayscaptainscottkinch 1 5495 0 0 /news/wehavenotbrokenanyrules 1 4258 0 0 /news/allchangeatsladegreen 5 16615 0 0 /kent-invicta-league/16 3 14202 0 0 /news/keepersinvitedtofourthkeeperwarsevent 2 10131 0 0 /news/humechallengesstonestostayatthesummit-exclusiveinterview 2 9214 0 0 /news/resultsdecember2020 5 29330 1 1 /news/tonbridgeangels3-2harrowborough-whatthefanssawwasafantasticnightfortonbridge-obrien 2 19054 0 0 /news/maidstoneunited1-4tonbridgeangels-mainsmashesclubrecord 1 7321 0 0 /news/ontheairwavesdaishslamsleagueforforcingthemtoplaytwicein43hours 2 13982 0 0 /news/10thjuly03.html 2 0 1 0 /news/starjacksonsignsone-yeardealtojoinfolkestoneinvicta 2 9516 0 0 /news/iwouldforeverregretnottakingtheopportunityihavenowadmitsianpulman 1 4071 0 0 /news/551a956ca8ac9 4 28058 0 1 /news/sporkent051020 3 33443 0 0 /news/werepunchingaboveourweightadmitsfleetskimble-exclusiveinterview 2 7948 0 0 /news/hernebaygearing250519 4 17750 0 1 /news/rymanleagueopeningdaypreview 5 55705 0 0 /news/strikerlovellsettomakehiscomebackfrominjury 1 4900 0 0 /news/sittguer090118 1 8353 0 0 /news/theweekahead-8 2 7056 0 1 /news/drmartens/eastern/ashford/2ndsept04.html 1 0 0 0 /news/wevegotagoodchancetocausestalbansproblemssayschathamtownbosskevinwatson 5 25187 0 0 /news/3gpitchesarethewayforwardsaysvcdathleticbosstonyrussell 2 8298 0 0 /news/551bc5df00896 3 13294 0 0 /news/sloughtown0-2folkestoneinvicta 2 8918 0 0 /news/dockerssearchforfriendlymatches 1 2792 1 0 /news/551bc5ddee900 1 3148 0 0 /news/matataturnsdownreturntodover 3 9040 0 0 /news/551bc5dcb8b57 2 8928 0 0 /news/boroughsettounveilnewsignings 6 15997 0 0 /news/thefavasefinal2013themorepeoplewecangettowembleythebettersaysmartinlarkin 3 13066 1 0 /news/bowersandpitsea191020 2 6826 0 0 /news/dartford190819 2 6962 0 0 /news/theboysaredreamingofwembleysayslordswoodbossjasonlillis 2 10770 0 0 /news/beckenhamtown0-3erithtown-westoodupandwerecountedtonightsaysmarktompkins 5 49362 1 0 /news/551a967739234 1 2767 0 0 /news/wellingtown090520 4 12808 0 0 /news/facupspecialgreeniesfridaypreview 1 9915 0 0 /news/craywands291018 3 19269 0 0 /news/atrophywillcapagreatseasonsaysfleetleisurebossleerichmond 4 20501 0 0 /news/fleetactivewithsuportersfortomorrowscheme 3 10105 0 0 /archive-2006-2014/234 3 12806 0 1 /news/countdowntokick-offyourguidetosaturdayspitchinspections 1 4389 0 0 /news/fordthinkingaboutquarter-finals-exclusiveinterview 2 7578 0 1 /news/faversham091119 3 12194 1 0 /news/orpelm060516 5 49907 1 1 /news/weareofferingafreealternativetochristmasshoppingsayswoodstockchairmanmauricedunk 3 10330 0 0 /news/seageracceptsunderdogtagforsemi-finalcuptie 1 4149 0 0 /news/dealtown261015 3 9921 0 0 /archive-2006-2014/92 1 4928 0 0 /news/folkestoneinvictatakedrydenofftransferlist 1 3523 0 0 /news/drmartens/eastern/sittingbourne/sittvcorb070204.html 1 0 0 0 /news/551a96786c071 1 3397 0 0 /news/551bc99d09e19 1 4566 0 0 /news/whitstablekeeptheirfacupcampaignontrack 4 15256 0 0 /news/thereisdefinitelynodivisioninthesquadsaysdoverassistantpauljoynes 1 4500 0 0 /news/kentclubsleftoutinthecold 1 4205 0 0 /news/sloughdart011016 3 29883 0 0 /news/wellingunited020719 3 11193 0 0 /news/ashfordunitedbosstonyreynoldsnamessquadtofacecharltonathletic 1 3690 0 0 /news/itsimportantthatno-onestartspressingthepanicbuttonsaystommywarrilow 1 3975 1 0 /news/sevencray291218 5 52877 0 0 /news/othernews/18thfeb04.html 1 0 0 0 /news/sporkent270317 4 41890 0 0 /news/dartford2-3leytonorient-itsamassivebigtestforussaysdartfordbosstonyburman 4 32554 0 0 /isthmian-league/43 7 32544 1 0 /news/doverathletic0-0woking-itgetstougherandtoughereachyearadmitsretiringhessenthaler 1 6439 0 0 /news/551bc5e65b49b 1 4041 0 0 /news/whitstablecountthecostoftheft 1 3768 0 0 /news/thamesmead050815 3 11331 0 0 /news/wearenowlookingtoemulatelastseasonsrunsaysramsgatebosstimdixon 1 3678 0 0 /news/2ndjune05A.html 1 0 0 0 /news/ramsgate101205.html 1 0 0 0 /news/551a95b37e11a 3 15204 0 0 /news/erithtownbosstonyrussellunveilsthecaptureofelstomdie 2 11000 0 0 /news/youcantalwaysplayprettyfootballinthekentinvictaleagueadmitsashfordbosspaulchambers 2 9008 0 0 /news/551bc5e21345e 1 4312 0 0 /news/551bc5e7171f1 2 10673 0 0 /news/ashfordtown1-1walthamforestaet-ashfordpaythepenalty 3 11288 0 0 /news/dartsadvisedtokeeprivalfansapart-exclusiveinterviews 3 14290 1 0 /news/whyteleafe151005.html 2 0 0 0 /news/folkestoneinvicta2-1favershamtown-itsablowtoourplay-offhopesadmitsrayturner 2 20607 0 0 /archive-2006-2014/202 2 8574 0 0 /news/ifwecandenthastingsandguernseysaspirationsthatwouldbegreatforussaysjimward 3 14936 0 0 /news/warrilowhopestohavethefundstokeepstarstrikerrook 1 5605 0 0 /news/24thnov04.html 2 0 0 0 /news/kentcounty/21stoct03.html 1 0 0 0 /sittingbourne-2003-2006/4 2 6220 0 0 /news/rustdeal180418 2 20262 0 0 /news/551a967890bca 3 17421 0 0 /news/itsgettinghardertosurviveinthekentleaguesaysgreenwichboroughbossstevefirkins 1 4482 0 0 /news/ifwecangetintotheplay-offsidbehappysayswellingunitedbossjamieday 1 4397 0 0 /news/burmantellshisteamtoshowtheirquality 1 3812 0 0 /news/drmartens/eastern/sittingbourne/Harlow210804.html 1 0 0 0 /news/craywands311218 4 22170 1 0 /news/maidstoneunited5-3abingdonunited 1 4435 0 0 /news/551a9c92b0d4a 1 3653 0 0 /news/gwr300405.html 1 0 0 0 /news/551a956bb49a8 1 4128 0 0 /news/werenotgoingtositbackathome-weregoingouttowinitvowswingsbossjamieday 1 5183 0 0 /news/www.dgsmarine.com 2 0 0 0 /news/erithashf050217 2 23592 0 0 /news/sevenseven190815 4 44402 0 0 /news/23rdmar05.html 2 0 0 0 /news/smithtookarisktojoinusadmitscugley 2 11104 0 0 /archive-2006-2014/248 3 13165 0 0 /news/551a9c0f1c220 1 4831 0 0 /news/canterbury081018 4 16530 0 0 /news/myambitionistopushoneveryyearsaystonbridgeangelsbosstommywarrilow 2 7710 0 0 /news/snodlandtown040619 2 6496 0 0 /news/551a97985f8aa 4 17474 0 0 /news/princesparkwinsprestigiousaward 1 3643 0 0 /news/someoftheladsarenotuptostandardadmitsfisherjoint-bossmartinford 2 7746 0 0 /news/althoughitwillbedifficultwearegoingtodoeverythingwecantomaketheplayoffs-bird 1 3690 0 0 /news/wingmarg210120 2 20576 0 0 /news/chatham140719 3 13317 0 0 /news/justtohaveagoodfacuprunwillgiveusaliftsaysthamesmeadtownbosskeithmcmahon 5 22397 0 1 /news/greenwich270418 1 4356 0 0 /news/ourleaguewilloffermore18-21yearoldstheopportunitytoremaininthegamesaysjohndarcy 2 8671 0 0 /news/conference/margate/2ndjuly03.html 2 0 0 0 /news/corinthian111118 3 15402 0 0 /news/wewouldlovetogetintothekentinvictaleaguesaysapmcontrastbosskrisbrowning 3 13020 0 0 /news/drmartens/eastern/tonbridge/3rdfeb04.html 1 0 0 0 /news/dartford0-0stainestown-wellsinkswansinplay-offswarnsburman 1 5699 0 0 /news/tonbmers060519 4 25162 0 1 /news/wembleywinnersclubreflectonajobwelldone 2 8164 0 0 /news/551a956b95435 1 5181 0 0 /news/theresstillalotmoreworktodo-lovell 2 8833 1 0 /news/551a956b933bd 1 3601 0 0 /news/favershamtown6-1erithbelvedere-imnotthinkingaboutthetitleyetsaysluchford 2 8800 0 0 /news/rothwell130805.html 2 0 0 0 /news/23rdsept05.html 1 0 0 0 /assets/images/money/Thumbs.db 1 10752 0 0 /news/conference/gravesend/4thaug04.html 1 0 0 0 /news/theroadtowembleykentmanagersfocusonsecondchances-exclusives 1 5488 0 0 /news/dontgetbulliedbyborgsboys 2 10066 0 0 /news/crowborough010616 12 113742 7 7 /news/phoesitt140120 3 8828 0 0 /news/10thjune05.html 2 0 0 0 /archive-2006-2014/263 6 26521 0 0 /news/beckenhamlaunchsponsorshippackagetoraisefundsfornewstand 1 3655 0 0 /news/551bc5db6238b 2 5994 0 0 /news/fleetwoodtown3-0bromley-ithinkwevecomeoffthepitchwithregretadmitsneilsmith 2 17004 0 0 /news/livetextdartford1-0maidstoneunited 1 7098 0 0 /news/vcdcantaffordtoslipupsayserithbelvederebossmickycollins 2 9952 0 0 /bromley-2003-2006/8 3 8709 0 0 /news/551bc5e7be510 1 3086 0 0 /news/551a97b210c3f 1 4209 0 0 /news/oxfordunited0-0tonbridgeangels-tonbridgechairmanhailshismagnificentangels 1 6323 1 0 /news/drmartens/eastern/dartford/29thaug04.html 1 0 0 0 /news/matchreportsvickersmakeitthroughtolast32 1 8772 0 0 /news/stevenageborough3-2ebbsfleetunited-fleetcomebackfromthedeadtokeepdreamalive 2 15330 0 0 /news/crayvchesfav221103.html 1 0 0 0 /news/rymankingsclinchtitleivelearntalotintwoyearssaysburman 2 10092 0 0 /news/crayvalley210820 2 6894 0 0 /news/plaayacupfinal04.html 2 0 0 0 /news/sctglebe121216 4 42921 0 0 /news/abbotthasthedefencetocausestainesashock 1 4341 0 0 /news/erithbelvedere4-1selsey-wemadehardworkofitadmitsmickycollins 2 14697 0 0 /news/551bc5e6e80bd 3 20057 0 0 /news/drmartens/eastern/folkestone/salisbury140804.html 1 0 0 0 /news/thamesmead080615 3 12435 0 0 /news/dovercalltheshotsiwouldlovetofacearsenalinthirdroundsaystwo-goalheroadambirchall 1 5125 0 0 /news/drmartens/eastern/tonbridge/1stoct04.html 1 0 0 0 /news/dartford1-1ebbsfleetunited-fansmadeitanafternoontoremember-daish 1 6253 0 0 /news/551bc5de88ea3 1 3230 0 0 /news/thambrent220417 2 19602 0 0 /news/10thnov03.html 1 0 0 0 /news/dolbypaystributetoprolificstrikers 2 8986 0 0 /news/todaysresults280106 3 11920 0 0 /news/drmartens/eastern/sittingbourne/rothwellvsittingbourne20903.html 1 0 0 0 /news/in-formmargatecangoallthewayaccordingtochairman 1 3557 0 0 /news/lovellshownthedoorbydolby 2 8328 1 1 /news/imgoingtograbmyopportunitywithbothhandsandgoforitsaysnikitawhinnett 3 10763 0 0 /news/ashfordtown1folkestoneinvicta1 5 20559 0 0 /news/kentleague/whitstable/26thfeb04.html 1 0 0 0 /news/lovelltellshisplayerstotaketheirchances-exclusiveinterview 1 4150 0 0 /news/iwantthefavershamtownjobsayscurrentcoachpiggott-exclusive 2 8498 0 0 /news/maidstoneunited4-5waltonhersham-wevethrownitawaywithshoolboydefendingsayssaunders 1 8228 0 0 /news/551a9250c6279 1 3845 0 0 /news/bromleyneilsmith190518 4 27741 0 0 /news/othernews/ConeyHall151104.html 1 0 0 0 /news/itwontbeeasywarnsbinks-exclusiveinterview 4 16745 0 0 /news/margate190705.html 2 0 0 0 /national-league/9 5 39432 1 1 /news/forthcomingfixtureswc160106 4 14878 0 0 /news/7thmar05.html 2 0 0 0 /news/551a931e17f68 1 4607 0 0 /news/lewsct250917 3 29883 0 0 /news/martinweneedtomarchintothoseplay-offs-exclusiveinterviews 1 4581 0 0 /news/greenwich180817 1 3718 0 0 /news/sittingbourne190216 4 15150 0 0 /news/letsruinplay-offchasinggodalmingsnight-obrienaschatsoffermumandmeforafiver 1 4739 0 1 /news/wewontbefazedbytheoccasionsaysfoley 2 9934 0 0 /news/imnottakingburgesshillforgrantedsaysdartfordbosstonyburman 2 8906 0 0 /news/doverlegenddixonreturnstocrabble 1 4092 0 0 /news/soccershorts190816 4 34739 0 0 /news/craywanderers3-1folkestoneinvicta-craybeatnew-lookfolkestone 2 9201 0 0 /news/stadiumplansunveiledforebbsfleetunited 2 30285 0 1 /news/551bc5e0afe98 1 7065 0 0 /news/soccershortsithinkwecansurpriseafewpeoplesaysbeckenhambossjasonhuntley 2 23984 0 1 /news/folkestonesigncolchesterstrikeronloan 1 3580 0 0 /news/chatham151005.html 2 0 0 0 /news/21stnov04.html 1 0 0 0 /news/hythe070716 2 16321 1 0 /news/icannotwaittostepoutatpriestfieldsaysemmatune 3 12728 0 0 /news/551a96dc9cdb2 1 4542 0 0 /news/tunbcroy290920 4 38234 0 0 /news/31stjuly05A.html 2 0 0 0 /news/editorsstatement 3 10871 0 0 /news/sevenoaks190615 9 115175 3 4 /news/ashfordtown2-3ramsgate-notwinningknockedourconfidence-ward 3 28674 1 0 /news/551bc99e2629b 1 4444 0 0 /news/3rdmay04A.html 1 0 0 0 /news/weregoingtomissretiredluckettadmitsfrancis 1 5358 0 0 /news/tootingmitcham2-2tonbridgeangels-mysquadisgoodenoughforbluesquaresouth-warrilow 2 11192 0 1 /news/kentsidesplotfayouthcupshocks-exclusiveinterviews 2 10399 0 0 /news/professionaloutlookpaysdividendsforinvicta 2 7944 0 0 /news/dover301215 4 14781 0 0 /news/ashfordbasedrobbinsleavesryeunitedbymutualconsent 1 3859 0 0 /news/whitstabletownbossmarklanemakesdoubleswoop 1 3908 0 0 /news/holmesdale0-1favershamtown-werepunchingaboveourweightadmitshughes 2 12430 0 0 /news/craywanderersfilmportrayslifeofastrugglingnon-leaguefootballer 1 5753 0 0 /news/551a979a44303 1 4981 0 0 /news/kentleague/deal/Sampson12.html 1 0 0 0 /news/manageresspowelllooksforwardtoherbigmomentinthespotlight 2 11281 0 0 /news/crayhast170819 5 38050 0 0 /news/sittingbournesfinancesarenowstretchedtoalmostbreakingpoint 1 4577 0 0 /news/kentseniorcupfristrounddraw 1 2782 0 0 /news/leightonfat091004.html 2 0 0 0 /news/deallydd280718 4 41174 0 0 /news/erithandbelvedere200220 2 8710 0 0 /news/margatesteponthegasinbidtoavoidthedrop 1 3905 0 0 /news/southall051004.html 1 0 0 0 /news/2ndjune05.html 1 0 0 0 /news/23rdoct03.html 2 0 0 0 /news/oboylelooksforwardtofreshnewchallenges-exclusive 1 4461 0 0 /news/soccershortswembleyboundfleetfreezetheirseasonticketprices 1 8957 0 0 /news/waltonford010420 3 9186 0 0 /news/craywhyt260918 3 30753 0 0 /news/551a99e42a013 3 12783 0 0 /news/kentleague/hythe/30thjuly04.html 1 0 0 0 /news/obrienisournewborn-leadersaysburman 1 3213 0 0 /news/551a9799e06f3 2 9838 0 0 /news/22nddec05.html 2 0 0 0 /news/beckenham020518 2 7208 0 0 /news/farnieallmyplayersaregoodenoughtostart-exclusiveinterview 3 12905 0 0 /news/13thsept04.html 1 0 0 0 /news/551a9718ce5b2 4 11958 0 1 /news/greenwich080116 4 15261 0 0 /news/idontwantanotherseasonlikethisonesayslewishamboroughchairmanraysimpson 6 40688 0 0 /news/551bc5e3b7875 1 5452 0 0 /news/ramsgate070716 1 3654 0 0 /news/551bc5e18f0ad 3 20610 1 1 /news/weletourselvesdownbigtimeagainstbearstedsaysashfordunitedbosspaulchambers 2 7602 0 0 /news/kickcons130415 3 12169 0 0 /news/551bc5dd560dd 3 12055 0 1 /news/experiencewillgiveustheedgesayscugley-exclusive 1 4643 0 0 /news/551bc99c0c137 2 19180 0 0 /news/551a931e5173e 1 3175 0 0 /news/cash-strappedabbottfacesfighttokeepreevesatbournepark 1 4631 0 0 /news/kentpairbenefitfromafcwimbledonsremoval 2 7902 0 1 /news/rymanleagueplay-offnewskentseniorcupfinalputbacktopre-season 1 3648 0 0 /news/kentleague/hythe/26thjuly04.html 1 0 0 0 /news/thamesmead120205.html 2 0 0 0 /news/551a9cf560742 2 10056 0 0 /news/hollands070716 3 10548 0 0 /news/ebbsfleet140720 2 9668 0 0 /archive-2006-2014/181 10 43722 0 0 /news/lutontown0-0wellingunited-ifitwerentforthefanstheclubwouldntbehere-jamieday 1 7861 0 0 /news/matatanetsoneastthurrockdebut 3 11606 0 0 /news/551bc5e73e0b7 2 8062 0 0 /news/elmstead171116 3 9936 0 0 /news/edgardavidsisamassiveplayerandamassivenameinthegamesayswellingunitedbossjamieday 5 22352 0 0 /news/langtonholmesdalesexpectationlevelsarerisingforeverygame 2 7379 0 0 /news/stonesunveilfirstsummersigning 6 20588 0 0 /news/sevenoaks140804.html 1 0 0 0 /news/weregoingtowembleyfleetheroeswillcherishwembleyexperienceforlifesayskimble 2 10220 0 0 /news/drmartens/premier/dover/6thaug03.html 2 0 0 0 /news/bromvdulw261203.html 1 0 0 0 /news/erithbelvedere1whitstabletown0 1 3572 0 0 /news/facupsecondqualifyingroundreviseddraw 2 6509 0 0 /news/551bc5e8824da 2 9181 0 0 /news/soccershortsweunderstandhoggacceptingashfordsoffer-sittingbourne 2 15310 1 0 /news/551a9c0ee4a2b 4 18062 0 0 /archive-2006-2014/254 6 25118 0 0 /news/551a99e3e41b0 3 13842 0 0 /news/551bc5d99975d 2 8892 0 0 /news/bearsted200117 2 7570 0 0 /news/favershamtown1-4whitstabletown-itsdefinatelyoneofthehighlightsoftheseason-southall 2 21070 0 0 /news/bromley021017 1 4137 0 0 /news/millwallstatement141220 1 3016 0 0 /news/bromley040219 3 11613 0 0 /news/trottunveilsretainedplayerslistfornextseason 1 2829 0 0 /news/551a92505ef16 1 4066 0 0 /news/bearsted010916 2 7047 0 0 /news/DCMSStatement270121 4 14102 0 0 /news/redhillthugstarnishdoverathleticfacupwin 1 7564 0 0 /news/dealtown010219 4 13801 0 0 /news/LetFansIncampaign180820 5 22217 0 0 /news/drmartens/eastern/tonbridge/22ndoct04.html 1 0 0 0 /news/tonbridgeangels281020 2 7176 0 0 /news/CombinedCountiesLeagueStatement200121 4 20320 0 1 /news/kentleague/sladegreen/bowey190804.html 1 0 0 0 /news/16thjune04.html 3 0 0 0 /news/551a931da9ef1 1 3264 0 0 /news/folkestone150416 5 28113 0 1 /news/soccershortstonbridgeangelsunveiljohnmaggsasgeneralmanager 6 48452 1 0 /news/aveley3-1chathamtown-itsgottogetbetteratsomepointsayschathamtownbosskevinwatson 5 37080 0 0 /news/therealdeal-wembleymanuscript-chapters11-20 4 109334 0 2 /news/iamextremelyproudofmyachievementsatlewishamboroughsaysdarrellqueeley 1 3538 0 0 /assets/select2/tests/dropdown/selectOnClose.html 1 246 0 0 /news/kentleague/lordswood/lordsvgreen280204.html 1 0 0 0 /news/whitstabletown1-2tilbury-webeleivewecanstayupsaysseager 1 4824 0 0 /news/maidstoneunited3-2borehamwood-twowinsoutoftwoputsstonesingoodheart 1 4296 0 0 /news/resultsjanuary2015 2 18970 0 0 /news/wellingunited0-1chelmsfordcity-wecancompetewiththebiggerteamsinourleaguesaysday 1 5655 0 0 /news/4thdec05.html 1 0 0 0 /news/3rdsept03.html 2 0 0 0 /news/normanshunsmovetodartford 2 10884 0 0 /news/berkhamsted150105.html 2 0 0 0 /news/beckvslad070204.html 2 0 0 0 /news/551bc99a80bee 2 11064 0 0 /news/greenwichborough0-1craywanderers-wejustkeptknockingonthedoorsaysjoefrancis 1 7230 0 0 /news/erithtownhavetowintostayinthetitleracesayscorinthianbossmattlonghurst 3 15064 0 0 /news/fleetlewis190416 4 53002 0 1 /news/doverathletic2-1heybridgeswifts-collininjurymarsanotherdoverwin 1 4412 0 0 /news/lovellinjuryblowfornutsbolts 1 3315 1 0 /news/craywanderers1-3billericaytown-imnotthrowinginthetowelsaysianjenkins 1 8459 0 0 /news/TheFAStatement141019 5 26457 0 0 /news/551bc5e1ec089 2 8904 0 0 /news/sevenoaks070120 6 26077 0 0 /news/kentcountyleaguestatement181220 7 32905 3 3 /news/soccershorts040616 4 29408 0 0 /news/wp-includes/wlwmanifest.xml 37 0 0 37 /news/551a979a772dc 2 12033 0 0 /news/hytheheroesweregoinguptheretopulloffashockinsistsbossscottporter 1 4186 0 0 /news/551a9797df1fb 2 8618 0 0 /news/kentyouth/22ndjune03.html 2 0 0 0 /news/thorogoodstepsaside 3 9908 0 0 /news/leatvbrom181003.html 1 0 0 0 /news/hythe160717 1 3958 0 0 /news/eastthurrockunited0-3folkestoneinvicta 3 14780 0 0 /news/sittingbourne150320 2 12888 0 0 /news/itsnotgoingtobeawalkintheparkagainstchipsteadwarnsmaidstoneunitedbossjaysaunders 3 11450 0 0 /news/mcmahonunveilscaptureoftiesseandmott 2 16841 1 1 /news/folkestoneinvicta0-0thamesmeadtown-wevegotagreatchanceathomenowsayskeithmcmahon 1 6935 0 0 /news/lordswoodcouldbeseriouscontenderssaysjasonlillis 1 3888 0 0 /news/551bc5daa8fb4 2 8722 0 0 /news/favershamlendahelpinghand 2 6621 0 0 /news/myhandsandlegsaretiedbringinginnewplayersadmitscash-strappedcugley 1 5500 0 0 /news/maidstoneunited1-0walthamforest-wehavelostalittlebeliefinattackadmitshume 2 10680 0 0 /news/thegapbetweentheinvictaleagueandkentleagueisgettingsmallersaysrusthallspaulmcdonagh 1 3878 0 0 /news/3rdjuly05.html 1 0 0 0 /assets/fileman/dev.html 1 2421 0 0 /news/thelongerwereinthevasethebettersaystunbridgewellsbossmartinlarkin 1 5050 0 0 /news/jonesrelievedofhisdutiesasbillericaylosetomargateforfirsttime 2 7892 1 0 /news/hullcitysnapupfolkestoneinvictastrikerjohanterhorst 2 8001 0 0 /news/stainestown1bromley2 3 12699 0 0 /news/ithinktheladsconfidencehasdroppedalittlebitadmitswhitstabletownbossnickysouthall 2 9898 0 0 /news/kentleague/cray/15thaug03.html 1 0 0 0 /news/4thfeb05.html 1 0 0 0 /news/wattsfitnessracetohelpouthisbelovedfisher 2 8648 0 0 /news/thamesmeadtownbosskeithmcmahondedicatescupwintoclubstalwart 2 7160 0 0 /news/20thjuly03.html 2 0 1 0 /news/harewantstokeepupimpressivehomeform 1 4447 0 0 /archive-2006-2014/171 4 18275 0 0 /news/thamesmeadtown3-1threebridges-itsbeenatoughfewweeksforusadmitskeithmcmahon 3 29006 0 0 /news/551bc99c26302 1 5335 0 0 /news/cobbsservessuspensionfortriptoleagueleaders 1 3589 0 0 /news/princesparkstadiumselectedasolympictrainingvenue 1 3646 0 0 /news/wellbefightingfitfortheseasonaheadinsistsjenkins 1 4701 0 0 /news/phoenix010418 1 3685 0 0 /news/playofffinallivekentishfootballwishcraywanderersallthebestoflucktoday 1 2581 0 0 /news/551a97b1552cb 1 6432 0 0 /news/bridon201017 3 11802 0 0 /news/soccershorts110716 5 39677 1 0 /news/551a956ccaf84 2 9724 0 0 /news/551bc5de93496 1 3655 0 0 /news/drmartens/eastern/sittingbourne/wingate280804.html 1 0 0 0 /news/ryman/bromley/thamesmead310704.html 1 0 0 0 /news/551a99e3d9bf2 3 12618 0 0 /news/charlton110620 4 19762 1 1 /news/rochester270518 3 13647 0 0 /news/doverathletic311018 3 10188 0 0 /news/folkestoneinvictafansplaytheirheroestoraisemoneyforinjuredstrikerpauljones 1 3262 0 0 /news/formerbromleymanagementpairbackinfootball 6 21643 0 0 /news/daishworriedasfixturesstarttopileup 2 7366 0 0 /news/aldershottown190320 3 10484 0 0 /news/october2008results 3 16193 0 0 /news/551bc5e606772 3 11434 0 0 /news/gillingham2-3nottinghamforest-theygavemeeverythingsaysgillinghambossjamesmarrs 2 15550 0 0 /news/goalshavegivenusanairofconfidenceadmitsflanagan 1 5979 0 0 /news/holmelms071016 5 96782 1 2 /news/wellingtown030719 4 12914 0 0 /news/beckharr110215 6 117005 3 2 /news/winning23trophiesoverthelastsixyearsisremarkablereallysaysstonescoachjackparkinson 4 24281 0 0 /news/551a925049841 1 3310 0 0 /news/haritmead050416 6 54517 1 1 /news/kentleague/thamesmead/17thjuly03.html 2 0 0 0 /news/starmanwallisreturnstodoverathletic 1 4796 0 0 /news/ihavetakentheclubasfarasipossiblycansaysdealtownchairmandaylemelody 2 8478 0 0 /news/illbeastupidpersontosaywellwinthekentleaguenextyearsayscrayvalleycoachjoeford 2 8366 0 0 /news/fisherfarn300716 3 33623 0 0 /news/thamesmeadbosskeithmcmahonsignsstrikerdannycrouchondualregistrationfromdartford 1 4246 0 0 /news/werenotreadytogoupadmitsward 2 8358 0 0 /archive-2006-2014/54 2 9779 0 0 /news/wehavetogetourheadsrightforcorinthiansaysfisherbossstevefirkins 1 3879 0 0 /news/horshdeal310815 4 38606 0 0 /news/epsovbrom061203.html 1 0 0 0 /news/craywanderers1-3tonbridgeangels-wewereoutclassedadmitsfrancis 2 13237 0 0 /news/551bc99c5638b 1 6244 0 0 /news/mitchellgivescountyleaguequartettheirchancetoshine-exclusive 5 53238 3 3 /news/kentishfootballcoukwelcomesvalsport 3 12368 0 1 /news/conference/margate/19thnov03.html 1 0 0 0 /news/financialconstraintspreventedmyprogresssaysford 2 8078 0 0 /news/bromley-wakelingconcernedwithsevengamewinlessrun 2 10134 0 1 /news/551a97b27e5e2 1 4766 0 0 /news/farngreen090517 3 26290 0 0 /news/punjab180920 5 18091 1 0 /news/erithbel240617 3 16929 0 0 /news/dealsreservesrelishtrainingsessions 2 6026 1 0 /news/wearestartingtoplaysomeattractivefootballsayserithtownbossenniogonnella 3 11480 0 0 /news/kentleaguetitledeciderstandanddeliverexclusiveinterviews 1 7904 0 0 /news/ryman/bromley/ashfvbrom250803.html 1 0 0 0 /news/gravesendnorthfleet0-2mkdons 7 32088 1 1 /news/snodbrid110817 4 15774 0 0 /news/croydon030915 4 16252 0 0 /news/folkestonecapturerowland 3 12455 0 0 /news/chatham030317 1 3729 0 0 /news/maidstoneunited2-1wealdstone-wemaybehittingformattherighttimesayshume 2 13757 0 0 /news/551a97b0b185c 1 3124 0 0 /news/punjab040518 3 12918 0 0 /news/whitstablevlordswood130903.html 1 0 0 0 /news/551bc5e7b9473 1 4739 0 0 /news/551a95b3ac4fc 1 3353 0 0 /news/551a9c91940b2 1 4473 0 0 /news/drmartens/eastern/ashford/18thnov04.html 1 0 0 0 /news/29thjune05.html 2 0 0 0 /news/erithtown1-1corinthian-idlovetoplayfinalonebbsfleetscarpetsaysmattlonghurst 2 16507 0 0 /assets/images/icons/stats/ 5 2062 0 0 /news/piggotttellhislordswoodplayersyoureplayingforyourfutures-exclusiveinterview 1 5398 0 0 /news/cugleyunveilsbriggsashissecondsummersigning 1 3026 0 0 /news/constableoptsformovetokentleaguesidetunbridgewells 1 4445 0 0 /news/551a99e4890e5 1 4425 0 0 /news/9thsept04.html 2 0 0 0 /news/idehill1-4peckhamtown-wevemadeareputationofbeingagoodsidesaysalanjacobs 2 21552 1 0 /news/hythe210316 4 16977 0 0 /news/thame040915 4 15050 0 0 /news/8thjune04.html 3 0 1 1 /news/551bc5e0bde26 1 5583 0 0 /news/rymanreportswalkerthingsarelookinggreatforus 1 14051 0 0 /news/otfordunited4-4gurunanak-promotionsamustforusthisyearsaysgurunanaksandystevens 4 45478 0 0 /news/kentmanagersmindgamestellusyourthoughts 1 3085 0 0 /news/greenwichborough1-2southpark-thugstarnishsouthparksfacupupsetoverboro 1 10053 0 0 /news/foleyreflectsonsuccessfulseason 1 4756 0 0 /news/kentleague/sladegreen/3rdnov03.html 1 0 0 0 /news/551a97b07f399 3 14283 0 0 /news/werenotgoingtochangethewayweplaysayshernebaybosssimonhalsey 3 15035 0 0 /news/kentleague/tunbridgewells/erithtown201104.html 1 0 0 0 /news/hollands101118 3 12393 0 0 /news/hythehast170316 5 59127 0 0 /news/doverreleasefourafterfailingtowinpromotion 1 3033 0 0 /news/conference/margate/15thJan04.html 1 0 0 0 /news/551bc5db5d3c7 3 12176 0 0 /news/551a97b08cf97 1 3762 0 0 /news/hythe090815 3 11328 0 0 /news/ebbsfleetunited1-0altrincham-itwasimportanttowinaheadofourbusymonth-daish 2 12342 1 0 /assets/ckeditor/plugins/find/ 5 1808 0 0 /news/legendarystrikerjonmaincomesbackhome 1 5909 1 0 /news/thefatladyhasnotstartedsingingsaysmunday 1 4375 0 0 /news/erithbelvedere2-1sidleyunited-thingsaregoingtohappenwithfordonboard-gorman 2 14322 0 0 /news/tootingmitchambossisoutoforderforapproachinglaurenthamiciclaimsjoefrancis 2 8880 0 0 /news/elthampalace0-3sevenacresidcup-idontapologiseforthreateningrefinsistspaulmann 3 28868 0 0 /news/551a9c0e92562 1 3580 0 0 /news/fleetmanagerlefttoruedefeat 1 2976 0 0 /news/ryman/bromley/fisher270704.html 1 0 0 0 /news/29thnov03.html 2 0 0 0 /news/theroadtowembleywemustseizethemoment 2 13308 1 0 /news/fanstakeupchairmansearlychristmaspresent 2 8624 0 0 /news/551a9677b8280 3 14895 0 0 /news/551bc5e2c5076 1 3309 0 0 /news/phoenix120118 1 4036 0 0 /news/551a95b4096df 4 17334 0 0 /news/551a9c0e4e51c 3 13746 0 0 /news/551a9718c2fb8 2 7126 0 0 /news/favasewinnerseagerfeelsthepainafterelimination 2 6622 0 0 /news/NationalLeagueStatement021220 4 12960 0 0 /news/folkestone161016 2 9072 0 0 /news/551a9677cd394 1 3385 0 0 /news/fleetmarchingtothewembleyarchfleetfanswillhelpusprogresssaysstrikereribenne 1 5376 0 0 /news/tonbridge150117 2 7174 0 0 /news/551bc5db318a9 2 10152 0 0 /news/ouraimhastobesafetysayshume 1 6098 1 0 /news/chatcamb150918 4 40373 1 0 /news/redcardspurredusonadmitsfleetherolong 1 3896 0 0 /news/sheppey270817 1 3949 0 0 /news/horsham130805.html 2 0 0 0 /news/hernebay1-2whitleybay-wewerethebettersidebutweswitchedofffor10seconds-halsey 5 89869 4 2 /news/grafixtures03-04.html 4 0 0 2 /news/greenhast270916 3 25925 0 0 /news/farnieleftintheshade-exclusive 1 3880 0 0 /news/sevenoaks190918 3 15084 0 0 /news/fisher0-1sevenoakstown-werebynomeansthefinishedarticle-little 2 13074 0 0 /news/551bc5e3be546 1 4520 0 0 /news/leatherhead170804.html 2 0 0 0 /news/wehavetotreatourguernseytripasprofessionallyaswecansaysramsgatebosstimdixon 5 19165 0 0 /news/wecantaffordthebignamessayshythebossfisk 1 4151 0 0 /news/stmarg240905.html 2 0 0 0 /news/chessington240704A.html 1 0 0 0 /news/551a96dc60721 3 13548 0 0 /news/stonessacksinclair-folkestonefinecarruthers-exclusivemanagerinterviews 4 61612 0 0 /news/drmartens/eastern/folkestone/10thjuly03.html 2 0 0 0 /news/lawrenceonstand-bytogethischancetoimpress-exclusive 1 4265 0 0 /news/551a97b277c27 1 4583 0 0 /news/551bc5d937248 3 10346 0 0 /news/ithinkthefixturelistisalittlebitcruelsaysebbsfleetunitedbossstevebrown 1 4605 0 0 /ryman-2003-2006 12 39383 1 1 /news/weregoingtogiveitourbestshot-oconnell 2 7731 0 0 /news/kidscanbeourguestssayslordswoodnumbertwo 1 4651 1 0 /news/matchreportsebbsfleetearntheirspurs 1 24646 0 0 /news/deanhillwillbeagreatmentortoouryoungerplayerssaysramsgatebosstimdixon 1 3472 0 0 /news/551bc5df82d92 3 13799 0 0 /news/littlebeingrockbottomhasntforcedmetoquit 1 4293 0 0 /news/hernebay0-1whitstabletownlillisrueshisluckaswhitstablereclaimtopspot-exclusives 4 22215 1 0 /news/melkcrow060117 2 19088 0 0 /news/imsurewewillturnthingsaroundsayscrayvalleybossstevechapman 4 16212 0 0 /news/drmartens/eastern/folkestone/staines041204.html 1 0 0 0 /news/dartfordsnewstadiumhaslinkwithrealmadrid 1 3321 0 0 /news/dartford030117 4 13346 0 0 /news/sittingbourne210917 2 7353 0 1 /news/terrorsareinafalsepositionwarnsburman 2 7662 0 0 /news/wembleywoesendinyourviews-mcclarenremainsdefiantdespiteembarrassingexit 1 3705 0 0 /news/imdelightedwehavehernebayfirst-itsagreatopenersaysbeckenhamtownbossjasonhuntley 1 4075 0 0 /news/weareintentnottosettleforamid-tablepositionsayshernebaychairmantrevorkennett 3 10949 0 0 /news/wellingunited6-1whitstabletown-weshowedthemrespectandwesmashedthem-ford 2 14606 0 0 /news/soccershortsspackmansuffersfreakinjuryatwork 1 12473 0 0 /news/thamesmeadbeatthebigfreeze 2 5460 0 0 /news/drmartens/premier/dover/5thsept04.html 1 0 0 0 /news/kingvcd240815 3 26151 0 0 /news/yorathtakestemporarycontrolofmargate 2 6174 0 0 /news/theresnopressureonusbecausenobodygivesusachancesaysnickysouthall 3 11324 0 0 /news/wevegottopolishuponourdefending-yorath 1 4225 0 0 /news/11thjuly03.html 2 0 0 0 /news/wevegotamassiveweekendsaysphoenixsportsbossscottsaunders 2 20545 1 1 /news/551a9c9201580 1 4231 0 0 /news/dartford2-4gillingham-burchillcausesdartsastrikerheadache 2 12590 0 0 /news/whibleytitle180415 4 21841 0 0 /news/erithtown200915 4 17034 0 0 /news/croydon220920 3 12041 0 0 /news/underpressuremileswieldstheaxe-exclusiveinterview 1 6039 0 0 /news/itsfrighteningwhatwecanachieve-warrilow 1 4921 0 0 /news/thesekidsarethefutureofourclubsayscugley 3 17171 0 0 /news/lovelladdsallmantohissquad 1 2997 0 0 /news/551a9c91d639d 1 5131 0 0 /news/erithtownunveilmarktompkinsastheirnewboss 3 11843 0 0 /news/wevegotatoughstartbuthopefullywecangetsomegoodresultsalongthewaysaysjamieday 1 4736 0 1 /news/ivemissedbeingaroundtheplaceandbeinginvolvedsaysdealtownstalwartderekhares 2 8755 0 0 /news/kentleague/whitstable/20thJan04.html 1 0 0 0 /news/wevegotthebestkentleaguestrikeforceclaimsgorman 1 4684 0 0 /news/letusentertainyou-exclusiveinterview 4 21966 0 0 /news/ifwewanttobesuccessfulweneedthesupportheresayswellingunitedbossjamieday 2 8638 1 0 /news/wellingtown301117 2 6798 0 0 /news/wedbehappyaslarrytogetintotheplay-offssaysashby 1 3992 1 0 /assets/select2/tests/utils/ 5 1933 0 0 /news/hessenthalerpullsoffsouthallcoup 2 6844 0 0 /news/tonbridgeangels200120 2 8038 0 0 /news/551a9250b45ed 2 7894 0 1 /news/burytown111204.html 1 0 0 0 /news/551bc5e814877 2 9034 0 0 /news/obviouslywedliketofinishhigherthantenththisseasonsaysfisherbossstevefirkins 1 5123 0 0 /news/kirkwattswillbesorelymissedsaystommywarrilow 3 12845 1 1 /news/9thsept04A.html 2 0 0 0 /news/erithbelvedere0-2godalmingtown-cosgrovewewerebossedoutofthegamebyadirectside 1 7424 0 0 /news/soccershortslordswoodpartcompanywithmanagerafterjustthreeleaguegames 2 20258 0 0 /news/551a967725ce8 1 4671 0 0 /news/hammerssnapupyoungramincludessaturdaysmainheadlines 5 31866 0 0 /news/551a9c93045a2 1 6892 0 0 /news/bromley210719 2 8806 0 0 /news/551a979a1b2b5 1 5013 0 0 /news/dartfordawardedpersonalisedpostcodeforprincespark 1 3317 0 0 /news/phoenix130219 3 11667 0 0 /news/rochesterunited3-0lordswood-replacingstuartzanonewillbeverydifficultsaysglennbarlow 2 12680 0 0 /news/ihavebeenworkingover-timetoensurewehaveeverythinginplacesaysjustinluchford 2 9120 0 1 /news/folkestoneinvictabossneilcugleyhasfourplayersmissingforseasonopener 1 4412 0 0 /news/drmartens/eastern/folkestone/folkevsitt230903.html 1 0 0 0 /news/22ndjuly05.html 2 0 0 0 /news/551bc5e49b584 1 5272 0 0 /news/greenfolk010917 1 3650 0 0 /news/sportingbengalpulloutofkentleaguefixture-exclusive 3 9503 0 0 /news/theclubneedstomoveforwardsayscraywanderersassistantjoefrancis 1 4219 0 0 /news/551bc5e8ad81d 3 10130 0 0 /news/thamesmeadtown4-1heybridgeswifts-sometimesyouhavetopinchyourselfsayskeithmcmahon 3 27633 0 0 /news/gillingham4-4aldershottown 2 11033 1 0 /news/welovebeingtheunderdogsayshythetownbossscottporter 1 4554 0 1 /news/folkestoneinvictastatement250221 6 31602 1 1 /news/551bc5e0394bd 2 9624 0 0 /news/whenyouthinkyouvearriveditkicksyouupthebacksidesaysdartfordbosstonyburman 3 12430 0 0 /news/morganwemustgetbacktobusinessafterourfacupexploits 2 7648 0 0 /news/fixtures6-11march2006 3 11374 0 0 /news/localbusinessmencomeintohelpwhitstabletown 2 7936 0 0 /news/welooktogofurtherinthefavasethisyearvowsbeckenhambossjasonhuntley 2 7674 0 0 /news/551bc5d9b6c9a 3 12551 0 0 /news/18thjuly04.html 1 0 0 0 /news/hythetown2-0stainestown-youdreamaboutdayslikethissaysproudscottporter 2 16548 0 0 /news/idehill1-4ightham-thisteamcangoonanddominatethesevenoaksleaguesaysighthamboss 7 111386 2 1 /news/drmartens/eastern/folkestone/yeading210804.html 1 0 0 0 /news/ryman/bromley/bromvhamp251003.html 1 0 0 0 /news/551a9c0e74231 1 6360 0 0 /news/folkestoneinvictaappointfitnessguru 2 11774 0 0 /news/ourmainobjectiveistowintheleaguesaysgreenwichboroughassistantpaulblade 3 11710 0 0 /news/wearemilesoffconcordsbudgetrevealsfoley 2 8705 0 1 /news/551a95b434afe 2 9800 0 0 /news/551a979a97d90 1 4721 0 0 /news/folkestoneinvicta2-2croydonathletic-jacksonscoresbestevergoalbuttworedcardsmarsgame 1 4861 0 0 /news/whitstable020120 3 12275 0 1 /news/bromley3-2bishopsstortford-myconfidencewilltakeapositivestepforwardsaysadambirchall 4 35118 1 0 /archive-2006-2014/229 2 8883 1 0 /news/551a956c91291 3 14919 0 0 /news/phoenix130816 2 6966 0 0 /news/itsalwaysatoughgameattunbridgewellswarnsvickersbossrickybennett 1 4324 0 0 /news/weretakingtonbridgeangelstoanotherlevelsaysambitiouschairman-exclusive 2 10492 0 0 /news/551a979aee494 2 10208 0 0 /news/warrilowwemustkeepgoodhabits-exclusive 1 4640 0 0 /news/wellingtown270919 3 12054 0 0 /news/guiversigningwillgivefavershamaliftsaysluchford-exclusive 2 10418 0 0 /assets/fileman/images/filetypes/big/ 1 1276 0 0 /news/fleetsearchforfreshtalent 6 18241 0 0 /news/551a9c92a2889 2 24450 0 1 /news/eastbourne040517 2 7858 0 0 /news/itsourmostimportantgameforawhilesaysfolkestoneinvictabossneilcugley 1 4700 0 0 /news/soccershortsifwecanstayupthenwewillbedoingreallywellsaysdoversbarrycogan 4 32290 0 0 /news/lewibrid151018 5 102230 0 1 /lordswood-2003-2006/ 1 3070 0 0 /news/beckenham240818 1 3743 0 0 /news/kentleaguecupfinalwefrozeonthebigstageadmitsporter-exclusive 1 5549 0 0 /news/croywhit040418 1 9354 0 0 /news/551bc5e911e9e 3 12661 0 0 /news/wedliketowinsomesilverwaresayscrayvalleybossstevechapman 2 9452 0 0 /news/drmartens/eastern/tonbridge/2ndsept04.html 1 0 0 0 /news/dartford2borehamwood2-burmanwhodareswillwinthatplay-offplaceexclusiveinterview 1 5979 0 0 /news/atitlechallengebringsthebestoutofourplayerssayshollandsblairbosspaulpiggott 2 8076 0 0 /news/seagerwillbeatopmanagersaysfatherfiguresampson-exclusive 1 5372 0 0 /whitstable-2003-2006/2 3 8911 0 0 /news/wehadtowinforourwalkingfanssayshume-exclusiveinterviews 2 11714 0 0 /news/elmsorp070815 3 34614 0 0 /news/551a99e3dea22 1 4002 0 0 /news/11thjune05.html 2 0 0 0 /news/daishextendswatkinsandgloziersloanspells 4 11834 0 0 /news/dulwichhamlet050320 2 6888 0 0 /news/drmartens/eastern/erith&belvedere/2ndsept04.html 1 0 0 0 /news/someofmyplayershavebrightfuturesinthegamesaysvickersbossrickybennett 1 4034 0 0 /news/18thsept03a.html 2 0 0 0 /news/551a956c1b103 2 8422 0 0 /news/kentleague/thamesmead/1stnov03.html 1 0 0 0 /news/ramsgate020618 4 14409 0 1 /news/551bc99ae6c4b 2 8328 0 0 /news/rustchat110719 3 24752 0 0 /news/ashfordunveilformerjamaicaninternationalstriker 1 3677 0 0 /news/Ebelphoe150415 5 82386 1 1 /news/dolbyhasmadehastingshardtobeatathomewarnscugley-exclusive 2 9482 0 0 /news/lovelladmitstobeingleftinthedark 1 3807 0 0 /news/551bc5e6cce32 3 14317 0 0 /news/12thmay05.html 1 0 0 0 /news/nationalleague051018 4 15966 1 0 /news/erithtown0erithbelvedere4 2 7220 0 1 /news/fleetstagefansforum 1 3265 0 0 /news/lingfielddean200415 4 14714 0 0 /news/kingstonian071105.html 2 0 0 0 /news/11thnov03.html 1 0 0 0 /news/long-servingfordleavesvickers-exclusive 1 3433 0 0 /news/bromley060318 4 28513 0 0 /assets/fileman/lang/bg.json 1 5095 0 0 /news/thamhari011116 1 8438 0 0 /news/hythe020405.html 1 0 0 0 /news/ebelcars300815 4 36895 0 0 /news/soccershortslovellrepresentsenglandatworldcup 1 3644 0 0 /news/beckenhamsuccessfulwithfaappeal 4 10705 0 0 /news/valleybouncebackafterabbohreadsriotact-mctaggartscoresthegoalsforminnowstudorsports 1 4506 0 0 /news/kentleague/whitstable/whitvtham251003.html 1 0 0 0 /news/551bc5db8d330 4 30422 0 0 /news/hythe060905.html 1 0 0 0 /news/sevenoakstown5-0canterburycity-weretryingtobuildasuccessfulclubsaysmickyhazard 4 50408 0 0 /news/crayvalley240420 4 15680 0 0 /news/darttorq041218 4 38598 0 0 /news/imconvincedwewillbechallengingforhonoursnestseasoninsistsnewmeadboss 1 3590 0 0 /news/551bc5e633d5d 1 3451 0 0 /news/theweekahead-11 3 10369 0 1 /assets/uploads/products/ 4 1277 0 0 /news/maidstone010116 4 13114 0 0 /news/551a925033c66 2 8824 0 0 /news/burmanfancieshischancestoenddovers100homerecord 2 9808 0 1 /news/ramsgateshockatlosingfour-pointdeductionappeal 1 3375 0 0 /news/margate160317 2 6646 0 0 /archive-2006-2014/27 3 14717 0 1 /news/ashfordtown0-0whyteleafe-ashfordeasetheirrelegationfears 1 4009 0 0 /news/slough281105.html 2 0 0 0 /whitstable-2003-2006/3 3 8084 0 1 /news/sambewickisthethirdoffoursigningsiwantedtomakethissummersaysscottporter 7 25670 0 1 /news/maidstoneunited.co.uk/2020/12/match-postponed-due-to-positive-covid-19-tests/ 2 0 0 0 /news/ramsgate241120 3 10066 0 1 /news/englandbidfor2018worldcup 2 7080 0 0 /news/wellcomethroughourbadpatchvowsburman 1 3997 0 0 /news/craywands110119 4 18661 0 0 /news/woking2-1wellingunited-weveswitchedoffattwovitaltimessaysjamieday 1 6115 0 0 /news/therewontbeasideinthekentleaguethatwilltouchusinsistsmcmahon-exclusiveinterview 5 28119 0 0 /news/551bc5dd40324 3 13076 0 0 /news/fisher070819 4 16458 0 1 /news/resultsjanuary2014 1 10975 0 0 /news/sheringhamintalkswithwingsrivals 1 3162 0 0 /news/wortcray011118 3 29175 0 0 /news/burmanaddsleaderburgesstohissquad 3 12267 1 1 /news/favgill070717 1 8418 0 0 /news/drmartens/premier/dover/staines140904.html 1 0 0 0 /news/551bc5e58e0c7 2 10812 0 0 /news/soccershortsramsgatestargregorygetsonhisbikeforthanetschoolkids 1 6875 0 0 /news/551a931da5f08 1 3314 0 0 /news/resultsaprilmay2012 1 9062 0 0 /news/nomads180516 2 6796 0 0 /news/jasonbartonraisesfundsforbritishlungfoundationashepoundsthestreetsoflondon 3 10810 0 0 /news/craywands250616 1 5621 0 0 /news/burmanthebuckstopswithme 3 12940 0 0 /news/551bc99c7aa6e 1 5818 0 0 /news/551a99e406e90 1 4179 0 0 /news/drmartens/eastern/tonbridge/leytonorient081104.html 1 0 0 0 /news/holmesdale081217 3 11997 0 0 /news/tonbridgeangels2-4dartford-teamscantlivewithussaysdartsbosstonyburman 1 8318 0 0 /news/551a96783b762 1 4114 0 0 /news/ryman070216 4 15010 0 0 /dartford-2003-2006 12 35786 0 0 /news/folkestoneinvicta1-0chelmsfordcity 1 4957 0 0 /kent-invicta-league/6 5 38789 1 1 /news/drmartens/eastern/tonbridge/15thjuly03.html 2 0 0 0 /news/sittingbourne2-1corinthian-casuals-werereallyintherewithachancenowsaysabbott 2 9993 0 0 /news/551bc5e6d9b3a 4 40661 1 1 /news/drmartens/eastern/tonbridge/3rdnov04.html 1 0 0 0 /news/maidvwhit170204.html 1 0 0 0 /assets/uploads/content/ 7 159234 0 0 /news/fisher010819 4 14934 0 0 /news/doverbossmartinhayesexperiencesmixedfeelingsoverhissidesstart 2 8856 0 0 /news/551a931dd5817 1 3344 0 0 /news/551a979828cfb 2 8530 0 0 /news/23rdaug04.html 1 0 0 0 /news/torquayunited101220 2 6444 0 0 /news/folktoot160917 1 9847 0 0 /news/frustratedmilescallsformoreconsistency-exclusiveinterview 3 14885 0 0 /news/vcdathletic230918 3 11397 0 0 /news/551a925089ec3 2 7055 0 0 /news/chathamtown0-1worthing-wehaventdoneenoughtonightadmitschathamassistantpeterhawkins 3 21242 0 0 /news/holmbridfavaserep090915 4 17838 0 0 /news/rusthall121018 4 13918 0 0 /news/thamesmeadtown2-1greatwakeringrovers-meadfrustrateroverstoearnplaceinnextround 2 7786 0 0 /news/551bc5e3e0b44 2 10245 0 0 /news/doverathleticreleasefouraftersealingpromotionbacktotop-flight 4 14518 0 0 /news/maidstone211205.html 1 0 0 0 /news/ithinkoursisalittlebitofafalsepositionadmitsfolkestoneinvictabossneilcugley 3 14917 0 0 /news/dealtown050717 2 8955 0 0 /news/kentleague/erithtown/7thjuly03.html 2 0 0 0 /news/hytheissuerallyingcrytosupportpromotionpush 1 3587 0 0 /news/humehailshawkinsloansigning 1 5441 0 0 /news/kentsidesjusttwowinsawayfrompotentialtriptogiantsleedsunited 1 4580 0 0 /news/harlowtown0-3folkestoneinvicta 2 9734 0 0 /news/titlechallengersmargateandmaidstoneunitedaimtostandanddeliver 4 15841 0 0 /news/551a9cf4d10f1 1 5568 0 0 /news/kentleague/hernebay/ramsgate170804.html 1 0 0 0 /news/mainlefttonbridgeangelsforstifferchallenges 1 3305 0 0 /news/dartfordsquadstartingtotakeshape 1 3496 0 0 /news/imsurejoepigottwillbeagreatassetforusandscoregoalssaysbromleybossmarkgoldberg 2 7390 0 0 /news/dockerhashighhopesfortwo-goalherowest 1 4614 0 0 /news/ashford160518 1 3473 0 0 /news/weshouldbewinningathomeagainsthydesayswellingunitedbossjamieday 2 9074 0 0 /news/dover030517 1 3605 0 0 /news/braveheartbarrettruledoutforrestoftheseason 2 7493 0 0 /news/sheppey140617 2 6092 0 0 /news/dealcs130617 3 10441 0 0 /news/sporting061104.html 1 0 0 0 /news/hythebossfiskhappywiththecontinuitywithinhissquad-exclusive 1 3849 0 1 /news/ireckonfourmorewinswouldbeenoughtogetusintheplay-offssaysfolkestonebossneilcugley 2 8872 0 0 /news/wemustcutoutourmistakessaysdolby 1 3761 0 0 /kent-invicta-league/28 6 35605 1 1 /news/weneedsomepointsontheboardsaysthamesmeadbosskeithmcmahon 2 8235 0 0 /news/itsgoingtobeafree-scoringthrillerpredictsmcmahon-exclusiveinterview 1 5006 0 0 /news/youthfootballinashfordisblossomingsaysshell 2 7579 0 0 /news/exbromleybossreturnstoks 1 3271 0 0 /news/tuesdaynightsresults 2 6339 1 0 /news/551a9c91822cc 2 16237 0 0 /news/sittingbourne2-0whitstabletown 1 5034 0 0 /news/corinthian030920 3 16265 1 0 /news/folkestone061104.html 1 0 0 0 /assets/select2/docs/options.html 1 9687 0 0 /news/kentleague/sladegreen/4thmar04.html 1 0 0 0 /news/beckchat030419 4 43905 0 0 /archive-2006-2014/207 2 9530 0 0 /news/bartonoptsforredhill-exclusive 1 3152 0 0 /news/uxbridge221005.html 2 0 0 0 /news/leaguepositionsinakentderbydontreallymattermuchsaysramsgatebosstimdixon 2 9278 0 0 /news/soccershortsdartssigncableonloanfromthamesmead 2 10534 1 0 /news/tiptreeunited3-2beckenhamtown-beckschiefsruetheirmissedchanceofvaseglory 2 16392 0 0 /news/sittingbourne1harlowtown1 2 8706 0 0 /news/551a96dbd63d1 1 4075 0 0 /news/drmartens/eastern/dartford/29thfeb04.html 1 0 0 0 /news/whitstabletown1-2ebbsfleetunited-wehadtodigdeeptoavoidagiant-killingsaysstevebrown 1 9857 0 0 /news/protheroeappealsagainstgrossmisconduct 1 3142 0 0 /news/wehave19gamestogetateamtogetherthatwillcompeteforthetitlenextseason-margateceo 1 4040 0 0 /news/ryemakeappealtofindstand-ingoalkeeper 2 6354 0 0 /assets/select2/docs/_layouts/ 5 1934 0 0 /news/everitthelpsinvictamaintainimpressiveformontheroad 1 5434 0 0 /news/wewillhelpplayersachievetheirfullpotentialsaysfavershamstrikeforcemanagergaryaxford 3 12184 0 0 /news/vcdmcmahon140515 9 104504 2 5 /news/551a9cf5000bc 2 15210 0 0 /news/551a9c0e32df0 1 3310 0 0 /news/551bc99e48d20 1 4532 0 0 /assets/select2/dist/ 6 2170 0 0 /assets/datetimepicker/datetimepicker.jquery.json 1 1154 0 0 /news/barwell071115 3 27108 0 0 /news/20thjune05.html 1 0 0 0 /news/3rdoct05.html 2 0 0 0 /news/kentleague/VCD/vcdvwhitstable120803.html 2 0 0 0 /news/bromley0-2maidenheadunited-werelivingoffthestartoftheseasonalittlebitadmitsbird 1 7041 0 0 /news/ryman/bromley/bromvwhyt280204.html 1 0 0 0 /news/551a96790232c 1 3312 0 0 /news/sevenoaks190719 3 10656 0 0 /news/kentmanagersinconferencestrengthentheirsquads 1 6463 0 0 /news/551bc5de32dbd 1 3945 0 0 /news/551bc5e126dae 1 3158 0 0 /news/fisher310517 3 13848 0 0 /news/thisisanewchapterforhythetownfootballclubsaysmanagerscottporter 5 25235 0 0 /news/wearthreelionsonyourshirt 5 16284 0 0 /news/551a9677bee1e 3 11640 0 0 /news/thetargetthisyearistofinishinthetopeightsayslarkin 2 7920 0 1 /news/itstimetogoandfindmyselfanotherjobsaysward 3 15432 0 0 /news/551a9797cf1cd 1 4047 0 0 /news/soccershortswerepunchingwellaboveourweightadmitssittingbournebossmattwyatt 3 26783 0 0 /tunbridge-wells-2003-2006/3 3 8876 0 0 /news/resultsdecember2014 3 31883 0 0 /news/greenwichborough1-2horleytown-wereattheendofweekoneandwereoutofthefacup-cox 2 27745 1 1 /news/folkestone240320 4 13136 0 0 /news/october2010results 2 13451 0 0 /news/ashfordtown2-1godalmingtown 2 8588 0 0 /news/ouraimistogetintotheplay-offssayshessenthaler 1 4059 0 0 /news/yeading210804.html 2 0 0 0 /news/barrenrundentswhitstablesconfidence 2 8547 0 0 /southern-counties-east-football-league/30 6 29006 0 0 /news/craywanderersreflectonaproud150yearsoffootballinghistory 1 4223 1 1 /news/14thnov04.html 1 0 0 0 /news/doverathletic170320 2 7184 0 0 /news/fiskjoinsboardathythetown 2 6128 0 0 /news/sevenoaks080916 2 9008 0 0 /news/wereonthelookoutfornewplayersallthetimesaysramsgatebossjimward 1 4311 0 0 /news/starscomeoutinforcetosupportlocalkidscharity 1 5994 0 0 /news/thamesmeadsplashout10000aheadofrymanleaguedeadline-exclusive 2 7941 0 0 /news/551a92506126f 4 15886 0 0 /news/isthmian.co.uk 2 0 0 0 /news/dartford3-3oxfordcity-angryburmanslamsunacceptabledefendingfromset-pieces 1 6447 0 1 /news/551a9799b657d 2 9055 0 0 /news/pottersbartown1-2whitstabletown-theresabitofgoldattheendoftherainbow-southall 5 39641 0 0 /news/wellingtown301020 3 12507 0 1 /news/themessageisclear-wewantpromotionsaysdoverathleticchairman 1 4449 0 0 /news/whitstabletown2-5bognorregistown-welookedlikerabitsinheadlightsadmitsjustinluchford 1 6258 0 0 /news/sevenoaks150718 4 16590 0 0 /news/favershamsshowdownwithsheernessputbacktwodays 1 4033 0 0 /news/kentleague/cray/aveley101004.html 1 0 0 0 /news/551bc5e874989 3 10043 0 1 /news/cottonnipsprogressinthebud-exclusiveinterview 1 8094 0 0 /news/warrilowwantstograb3000fromthepolice 2 8874 1 0 /news/welling110616 4 14465 0 0 /assets/fileman/php/movefile.php 1 45 0 0 /news/SportEngland140520 3 12758 0 0 /news/nowisthetimetoputmyyoungfamilyfirst-seager 2 13966 0 0 /assets/images/site/social/ 5 2143 0 0 /southern-counties-east-football-league/14 3 15797 0 0 /news/kentleague/tunbridgewells/29thjune03.html 2 0 0 0 /news/resultsdecember2017 4 38025 0 0 /news/theclubisheadingintherightdirectionandimhappytostaysayswellingbossjamieday 3 12809 0 1 /news/theresnopressureonsittingbourneaseveryonesexpectingdulwichtowinsaysmarcseager 1 4373 0 0 /news/meridian1-3charltonathleticcommunity-wewillsurpriseyouwarns23submeridianboss 4 58575 1 2 /news/stalbanscity4-0tonbridgeangels-wehaventgotladsthattaketheirchancessayswarrilow 1 7602 0 0 /news/551bc5e55f1d8 2 14130 0 0 /news/bromley5-1tonbridgeangels-werestilllookingtohaveourbestfinishsaysmarkgoldberg 4 38932 0 0 /news/dartford1-2leatherheadsmashandgrableatherheadwinmarscarterscomeback-exclusive 1 6193 0 0 /news/stonesmanagementteambackstadiumpriorities 1 4150 0 0 /news/billericaytown2bromley1billericaywin4-3onaggregate 2 8086 0 0 /news/551a9c0f13fad 1 5406 0 0 /news/itsbeenalongtimemaybetoolongforfacupsuccesssaysbromleycoachhugolangton 3 19334 0 0 /news/hernebay011017 2 8053 0 1 /news/greenwichboroughpulloffmajortransfercoupbysigninggoalkeepercraigholloway 4 14158 0 0 /news/thamhanw200916 2 20870 0 0 /news/imnotinterestedabouthowweperformonthedaysaysburman 2 7898 0 0 /gravesend-2003-2006/ 1 2986 0 0 /news/ebbsfleet080719 4 13825 0 0 /news/maidstoneunited13-0redhill-ithoughtwecouldhavehadafewmoreadmitsjackparkinson 2 14044 1 1 /news/under21leagueexpandsto22teamsnextseason 4 14010 0 0 /news/johnullmankentseniorcupsemi-finaldraw 3 7972 0 0 /news/DorkingWanderers050820 3 11366 0 0 /news/dockershavekeeperconcernsaheadofvaseclash 1 4183 0 0 /news/551bc5de71f16 4 37258 2 2 /news/gillingham160819 3 16000 0 0 /news/thelureofvcdendedupbeingtoomuchformetoturndownsaystonyrussell 3 16421 0 0 /news/romford1-0chathamtown-werenotmeetingourexpectationsadmitskevinwatson 3 16778 0 0 /news/dulwichhamlet241019 3 11468 0 0 /news/margateallen040615 5 19632 1 0 /news/26thjune03.html 2 0 0 0 /news/donsvisitwillattractourrecordcrowdof2000predictsangelschairman-exclusive 2 10376 0 0 /news/glebe080716 4 15610 0 0 /news/551bc5de6ca05 1 3621 0 0 /news/16thdec05.html 1 0 0 0 /news/fleettriocomplainaboutgruellingfixturebacklog 1 5110 0 0 /news/resultsoctober2017 3 31692 0 0 /news/seagerrelishesreturnofinjuredtrio 1 4111 0 0 /news/brommaid160419 3 29958 0 0 /news/551bc5e586c7d 2 9740 0 0 /news/chathamsstarnamesreturnfortilleystestimonial-exclusiveinterview 1 4460 0 0 /news/maidstoneunited0a0sittingbourne-themainproblemwasthebreakerwentsaysbournechairman 2 10490 0 0 /news/glebe290316 3 11103 0 0 /news/enfieldtown031205.html 2 0 0 0 /news/kingstonian180904.html 2 0 0 0 /news/wellhavetobeatourbestsaystunbridgewellsbossmartinlarkin 5 21592 0 0 /news/551a9c91b4b92 1 6628 0 0 /news/returningwesfoderinghamgetsthenodatbromley 1 4714 0 0 /news/ryman/bromley/MPvbrom070204.html 1 0 0 0 /news/fishafcc290216 4 39958 0 0 /news/chessington240704.html 1 0 0 0 /news/glebe130919 3 9765 0 0 /news/551bc5dc69eaf 2 8848 0 0 /news/weveunder-achievedthisseasonadmitsheaslewood 1 3773 0 1 /news/wellingunited210920 2 7902 0 0 /archive-2006-2014/49 5 25022 0 0 /news/othernews/gotravelkentleaguetables140304.html 1 0 0 0 /news/weregoodenoughtostayupinsistsashfordbossthorogoodexclusive 1 3842 0 0 /news/oursupportersaretremendoussayspromotionchasingfolkestoneinvictabossneilcugley 2 9782 0 0 /news/ivegotasquadcapableofdealingwiththepressureofbeingthefavouritessaysjaysaunders 2 10036 0 0 /news/ialwaysknewitwasgoingtobequitehardadmitssevenoakstowncoachanthonyferguson 1 4040 0 0 /news/charlton200320 3 10928 0 0 /news/bromley190216 3 13164 0 0 /news/itsaderbygameanythingcanhappensayshernebaybosssamdenly 5 23650 0 0 /news/thamesmead041215 3 10473 0 0 /news/drmartens/eastern/erith&belvedere/beaconsfield170804.html 1 0 0 0 /news/30thdecember2003.html 1 0 0 0 /news/doverathletic050121 3 16974 1 1 /news/snodlandtown300420 5 17717 0 0 /news/eastbourne190219 3 11952 0 0 /news/jenkinspleasedwithstarttonewcampaign 1 4275 0 0 /news/saturdayssoccer18thmarch2006 1 3189 0 0 /news/551a9c91a8a86 1 4937 0 0 /news/drmartens/eastern/folkestone/folkvhist030204.html 1 0 0 0 /news/18thjune05.html 2 0 0 0 /news/shittuwillfrightenyouwarnsyorath 2 7302 0 0 /news/bromslabber010615 4 16726 0 0 /news/haritunb220920 6 53072 0 0 /news/7thjan06.html 2 0 0 0 /news/551bc5e2f2547 2 9046 0 0 /news/doverathletic210720 2 6874 0 0 /news/facarlsbergvasesecondrounddraw 1 3228 0 0 /news/tonbridgeangels0-4craywanderers-weneedtosticktogethersaysdefiantangelsboss 1 7793 0 0 /news/itwillbeagreatendtoadisappointingseasontowalkawaywithatrophysaysmarkgoldberg 2 7862 0 0 /news/kentleague/sevenoaks/26thsept04.html 1 0 0 0 /news/ticketssellingoutasfansflocktoprincesparkforheroesreturn-exclusive 2 10354 0 0 /news/ineedtoknowwhereistandwithmybudgetsayswarrilow 2 12361 0 0 /news/marghern300917 3 34017 0 0 /news/22ndjune04.html 1 0 0 0 /news/beaconsfield170804.html 1 0 0 0 /news/kentfacampaign121019 3 11414 0 0 /news/billericay040904.html 2 0 0 0 /news/551bc99b2fa27 1 6628 0 0 /news-conference-2003-2006 17 50215 1 4 /news/maidstone220619 10 80644 5 6 /assets/select2/docs/vendor/css/ 1 416 0 0 /news/iftheproperbeckenhamturnupifancyustogetaresultsaysmichaelmarks 1 5115 0 0 /news/mcmahonstakingleaguecupseriously 1 4517 0 0 /news/dovercanonlygetbetterwarnshessenthaler 2 9381 0 0 /news/folkvdart130304.html 2 0 0 0 /news/folkestone130616 4 13889 0 0 /news/stoneshaveyearsonyouthfulopeningdayopponents 1 3859 0 0 /news/robbinsconfidentforlengthyvaseawayday 1 4954 0 0 /news/sevenoakstown2hernebay2exclusiveinterviews 4 21693 0 0 /news/wemightbeabletohaveafewsurprisesfortonbridgeangelssaysdartsbosstonyburman 3 16393 0 0 /news/hythe010916 2 7549 0 0 /news/charltonathletic250920 3 9521 0 0 /news/baratami310518 3 18371 0 0 /news/vickersgroundlooksapicture 6 23324 0 0 /news/wellsbankingonsponsorsmoney-exclusive 4 15439 0 0 /news/nostonewillbeleftunturnedsaysholmesdalecoachrossmitchell 2 9073 0 1 /news/551bc5df9ed63 1 4006 0 0 /news/whitstabletown1-0merstham-threepointstodaywereoffgreatrewardadmitspeternott 1 6261 0 0 /news/sevenoaks080517 2 6955 0 0 /news/maidvfolk171203.html 1 0 0 0 /news/551a9677642f9 1 3435 0 0 /news/26thfeb04.html 2 0 0 0 /news/greenwich060716 1 3612 0 0 /news/ashfordfacetoughtestinfrontofthetelevisioncameras 1 3942 0 0 /news/551bc99dbe7a4 1 15660 0 0 /news/eritoakw150919 3 32259 0 0 /news/hallsathletic101120 6 28152 1 1 /news/dontshutthegateappealletspulltogethertohelponeofourown 1 5276 0 0 /news/kentleague/cray/crayvsporting160803.html 1 0 0 0 /news/aveley290904.html 2 0 0 0 /news/18thnov03.html 2 0 0 0 /news/iamrelishingthechancetobepartofahugelyambitiousclubsaysjamielawrence 4 17610 0 0 /news/wefeelwevenotplayedconsistenltywellfor90minutessaysneilcugley 2 8326 0 0 /news/BHTown131205.html 2 0 0 0 /news/therewillbeaturningpointsaysfrustratedobrien 1 4418 0 0 /news/maidstoneunited0-3hendon-wefaceahellofachallengesayscaretakernott 2 9996 0 0 /news/drmartens/eastern/sittingbourne/corbvsitt131203.html 1 0 0 0 /news/greenholl290316 5 30146 0 0 /news/tonbridgeangels090920 6 50665 3 3 /news/551bc99c4fcc8 1 6759 0 0 /news/charlescalledupbyengland 1 4128 0 0 /news/table-toppingcugleyispleasedwiththetogethernesswithinhisranks 1 3685 0 0 /news/othernews/8thJan04.html 1 0 0 0 /news/551bc5dab80ea 2 6152 0 0 /news/burmanunveilsdoublesigning 5 17467 0 0 /news/wellcarl061215 6 57798 0 1 /news/ashford111116 1 3332 0 0 /news/ifplayersarentattrainingthentheywontplaywarnsmiltonfulstonbossaaronperry 1 4836 0 0 /news/budgetcutswillmakeittoughwarnshume 1 4741 0 0 /news/seagerskentishprideasunderdogsbitedisrespectfulbromley 2 10444 0 0 /news/vcdrussell230415 4 16342 0 0 /news/maidstoneunited120221 5 28137 1 1 /news/holmesdale160717 4 16038 0 0 /archive-2006-2014/192 4 17618 0 0 /news/glebelewis090816 6 137937 3 3 /news/folkestonebeginsearchfornewscout 5 25030 1 1 /news/folkvbht070204.html 2 0 0 0 /news/551a9799bf839 2 8408 0 0 /news/moneynotanissueforstrikercass 2 8786 0 1 /news/ramsvlords270903.html 2 0 0 0 /news/dockersclawthemselvesoffootoftable 3 9280 0 0 /assets/uploads/content/Greenwich_Borough_Travis_Gregory.html 1 48141 0 0 /news/wevegotsomegreatpeoplegettinginvolvedforgeorgehowardsbenefitmatchsaysmickycollins 4 24294 0 0 /news/ramsgate140719 3 11640 0 0 /news/sittingbourne230919 3 9490 0 0 /news/551a99e3a79b2 1 4106 0 0 /news/vcdathleticfc.uk 1 0 0 0 /news/englandmanagerroyhodgsonpitchesinatbigginhillschool 3 14798 0 0 /news/wecantkeepthrowingpointsawaysaystonbridgeangelsbosstommywarrilow 1 4275 0 1 /news/folkestoneinvictabringgillinghamgameforward 1 4050 0 0 /news/lewesladies5-0gravesendnorthfleetladies 3 14321 0 0 /news/myambitionistobecomeaprosays20-year-oldsammacneil 2 8934 0 0 /news/wellmaid060819 4 28461 1 0 /news/gillingham090704.html 2 0 0 0 /news/sheppey091020 4 20086 0 0 /news/drmartens/eastern/dartford/26thoct03.html 1 0 0 0 /news/wembleyissocloseyoucanalmosttouchitsaystommysampson 1 5479 0 0 /news/551a979aa66e8 2 9470 0 0 /news/maidstone260719 3 9240 0 0 /news/october2009fixtures 2 14255 0 0 /news/tramshopingforasmoothride-exclusiveinterview 1 4358 0 0 /news/craywanderers2-0metropolitanpolice-wedeserveacrackattherymanpremiersaysroyston 1 4802 0 0 /news/englandlionesses030715 4 19534 0 0 /assets/ckeditor/plugins/templates/dialogs/ 1 390 0 0 /news/theclubisverycloseofgoingoutofexistenceifpeopledonthelpuswarnskeithmcmahon 1 6946 0 0 /news/aldershottown010121 6 19492 1 1 /news/551a931e62689 2 8266 0 0 /news/551a97b0a355c 4 18724 0 0 /news/racistabusehbeb121119 2 7500 0 0 /news/rivalsstrengthenaheadofbasementbattle-exclusive 1 4906 0 0 /news/margatedelightedtoannouncenewchairman 1 3020 0 0 /news/greenwichboroughfacemake-or-breakgroundsharetalks 2 9811 1 0 /news/551bc5e280ff8 1 3438 0 0 /news/tosponsorkentishfootballtelephonestephenmccartneyon07979418360 2 5089 2 0 /news/kentcounty/bromleians20thjuly03.html 3 0 0 0 /news/fumingcugleytellshisplayersshowourfansthatyoucare 1 5100 0 0 /news/fleetappointnewchairman 1 3977 0 0 /news/551bc5dd0d7c9 1 6155 0 0 /news/kentleague/beckenham/2ndsept04.html 1 0 0 0 /news/fisher261116 2 7690 0 0 /news/gowerstepsdown 5 16321 0 0 /news/donsarepunishedoverdarlingtonblunder 2 7087 0 0 /news/theunityisbeginningtoshowthroughandweregonigtoneedthatsaysrayturner 3 11282 1 0 /news/sargentoptstostayputwithtanners 2 7458 0 0 /news/551a9c924ed8b 3 20275 0 0 /news/CEStatement270420 3 15758 0 0 /news/itsawrenchtoleavefisheradmitsassistantmanagerbryanglover 1 3496 0 0 /news/eastvsitt170404.html 2 0 0 0 /assets/images/money/ 8 4199 0 0 /news/phoenix010115 3 11613 0 0 /news/551bc99c3e719 4 88905 2 3 /news/drmartens/eastern/erith&belvedere/9thdec04.html 1 0 0 0 /news/favershamenjoyeuroadventure 5 28701 0 0 /news/resultsaugust2017 3 23739 0 0 /news/551bc5e442173 3 11863 0 0 /news/sheppey031117 1 3511 0 0 /news/crowborough020520 4 11904 0 0 /news/551a96782b1c4 1 3718 0 0 /news/551bc5dac9b6c 2 6108 0 0 /news/greencor031017 1 8392 0 0 /news/27thaug03a.html 1 0 0 0 /news/warrilow200615 4 22389 0 1 /news/margate120118 1 3645 0 0 /archive-2006-2014/227 2 8766 0 0 /news/screritht080816 3 26345 1 1 /news/afccroy291216 2 8344 1 0 /news/gillslonc250315 5 95952 1 1 /news/chathamtown3-2burgesshilltown-ourplayersshowedmaturitybeyondtheiryears-obrien 1 5386 0 0 /news/551bc5dc393ee 2 9988 0 0 /news/wearestrugglingtoputoutafirstteamsquadadmitsrusthallbossgarysharman 3 11294 0 0 /news/erithbelv040816 2 7528 0 0 /news/sittingbourne0-1folkestoneinvicta-abbottfentshisfuryatkentrivals 2 13241 1 1 /news/weneedtoshowabitmoreenthusiasmandabitmoreenergysaysbromleycoachneilsmith 2 9788 0 0 /news/drmartens/premier/welling/sutton131104.html 1 0 0 0 /news/551bc5e411041 1 5248 0 0 /news/16thjuly03.htm 2 0 0 0 /news/bournewilltightenupourdefencesaysabbott 1 4338 0 0 /news/craywanderers1-0crystalpalace-werelookingtobouncebackatfirstattemptsayskeithbird 5 42617 2 1 /news/rustcray050919 3 39090 0 0 /news/crayvdeal200304.html 1 0 0 0 /news/craybright160116 4 39240 0 0 /news/tonbridgeangels3-2harrowborough-wereincontrolofourdestinysayswarrilow 2 13220 0 0 /news/firstteamwasaprioritythisseasonsaystonbridgeangelsnewkeeperkylemerson 4 15610 0 0 /news/imguttedfortheplayersthatwerestillaroundtherelegationzone-oconnell 1 4070 0 1 /news/hessenthalerunveilsshort-termbodkindeal 2 6939 0 0 /news/margate280617 1 3614 0 0 /news/theclubcouldnotsupportmyvisionsandabilitytomovethefirstteamforwardsayschristuley 6 31111 1 1 /news/551a9678516dd 1 2958 0 0 /news/elmesboostasstrikerreturnsfromlengthylay-off-exclusive 1 4198 0 0 /news/greenwich221216 2 7540 0 0 /news/maidstone100517 2 8631 0 0 /assets/select2/dist/js/i18n/ 1 682 0 0 /news/551a956c462c6 4 18986 0 0 /news/margatevexeter160803.html 1 0 0 0 /news/dartford2-1eastbourneborough-ivegottobehappywithtwowinsoutoftwosaystonyburman 1 6355 0 0 /news/fcelmstead030120 3 11347 0 0 /news/551a9250a6464 1 3399 0 0 /news/saturdaysmatchreports-1 2 23364 1 0 /news/551bc5dfd7662 1 2742 0 0 /news/551a97b262d93 1 4726 0 0 /news/favershampulloffwalkercoup 2 8208 0 0 /news/wellingunited2-2afcwimbledon-werebuildingtowardspromotion-ford 1 5389 0 0 /news/halstead200617 2 6286 0 0 /ramsgate-2003-2006/ 1 3067 0 0 /news/ashford241117 2 9411 0 0 /news/551a956c85f12 2 7668 0 0 /news/bromley130919 3 16342 0 0 /news/fisher2-2craywanderers4-3pens-thedifferencewasthefisherkeepersaysjenkins 2 14666 0 0 /news/whitstable230517 2 6344 0 0 /news/drmartens/eastern/ashford/28thjuly04.html 1 0 0 0 /news/thebigkickoffkentleaguemanagersrelishopeningday-exclusives 1 5184 0 0 /news/theroadtowembleyshownoheartagainandweregoingnowarewarnsfisk-exclusive 1 4299 0 0 /news/FootballSuspensionStatements160320 5 27532 0 0 /news/werenotinasituationtowintheleaguesayscugley 2 10255 0 0 /news/551a99e34fb29 1 3593 0 0 /news/whitstabletownunveiljimanddannywardastheirnewmanagementpairing 3 10968 0 0 /news/551a9c0e8e615 1 4994 0 0 /news/wellhaveafighttokeepwhitehouseadmitsfarnie-exclusiveinterview 1 4758 1 0 /news/crowborough020418 2 10570 0 0 /news/wewillgiveeverythingwecantomakesureramsgategive100everyweekvowstimdixon 1 3530 0 0 /news/551a95b456b36 1 5248 0 0 /news/cugleypleasedwithpre-seasonfitness 2 10302 0 0 /news/551a931e6d035 1 3501 0 0 /news/551bc5e5b4459 3 10762 0 0 /news/olsonleavesdartfordforregularfirstteamfootball 1 3630 0 0 /news/vcdathletic3-2tilbury-ihavesomuchbeliefintheboyssaystonyrussell 5 41785 0 0 /news/ebbsfleet020618 4 16397 0 0 /assets/select2/tests/options/ 5 2255 0 0 /kent-county-league/4 5 36996 1 1 /news/551bc99c21b5e 1 4951 0 0 /news/551a99e527faf 1 6898 0 0 /news/ravensswoopintofacupfirstroundbringonthebigboyssaysbromleyskippertutuhenriques 1 7006 0 0 /news/551a97998123d 2 9146 0 0 /news/folkharl030318 2 19788 0 0 /news/hollands&blair231120 2 8278 0 0 /news/angelschairmantargets24morepointsandruninfacup 2 7360 0 0 /news/becksimprovefloodlightingatedenparkavenue 1 3406 0 0 /news/ivebeentryingtosignpulmanforalongtimeadmitslovell 1 4690 0 0 /news/551bc5dd747d8 3 10976 0 0 /news/kentleague/cray/15thjuly03.html 2 0 0 0 /news/sevenoaks191017 1 4758 0 0 /news/doncasteraretheteamtobeatsaysmillwalllionessesskipperdionnelennon 4 16056 0 0 /news/drmartens/premier/welling/8thaug04.html 1 0 0 0 /news/legendhessenthalerileavedoverathleticwithaheavyheart 1 4070 0 0 /news/sporfore261020 5 59546 0 0 /news/thefacarlsbergtrophyfinal-buildupebbsfleetunitedvtorquayunited 2 15994 0 0 /news/551bc5dfce9ed 2 13218 0 0 /news/angelspartcompanywithskipperpowell-exclusive 2 8996 0 0 /news/551bc5dfba296 1 3342 0 0 /news/westviewcupthirdrounddraw 2 6115 0 0 /news/wardsealsabelloandeal-exclusive 3 21168 1 1 /news/wingatefinchley1-0thamesmeadtown-weneedtogetourselvesadecentgoalscorersaysmcmahon 1 7304 0 0 /news/resultsaugsept2017 2 26606 0 0 /folkestone-2003-2006/5 4 12397 0 0 /news/551a967913cae 1 5501 0 0 /news/551a97b1b1dc2 1 4424 0 0 /news/551bc5dccfbbe 1 5803 0 0 /news/kentleaguemanagersdemandcuprethink-exclusiveinterviews 1 5859 0 0 /news/soccershortsletshopecome5pmonsaturdaywereinthenextroundofthefacup-longhurst 3 34623 1 0 /cray-2003-2006/4 4 11369 0 0 /news/13thnov05.html 2 0 0 0 /assets/ckeditor/plugins/magicline/ 5 1813 0 0 /news/ebbsfleet010720 2 6048 0 0 /news/faversham210417 2 8144 0 0 /news/551bc5dc1fbe0 2 9338 0 0 /news/worganskneeinjurynotasbadasfirstfearedrevealswarrilow 2 9862 0 0 /news/deal030905.html 1 0 0 0 /news/ithinkwevemadevirtually10000onstuartkinginsideamatterofmonthssaysneilcugley 5 25637 0 0 /news/soccershortsburgesshilltownsecuretheirrymanleaguestatus 1 6393 0 0 /news/rusthall241220 6 28017 1 2 /news/drmartens/eastern/folkestone/welling070804.html 1 0 0 0 /news/thamesmead060718 4 14193 0 0 /news/hythe190615 4 13460 1 0 /news/beckenhamtown3-0littlehamptontown-garygormanhastoscoreinthebiggamessayshuntley 1 6288 0 0 /news/tunbkspor141020 6 47046 0 0 /news/551bc5e1ae7d6 2 9132 0 0 /news/greenwich010116 5 38503 1 1 /news/crowboroughathleticappointgoalkeepercoachandyirvineasnewassistantmanager 3 11419 0 0 /news/551bc5e528b45 2 13190 0 0 /news/soccershorts170517 4 35166 0 0 /news/whoeverholdstheirnervesthelongestwillwinthegamesayshollandsblairbosspaulpiggott 2 10856 0 0 /news/invictaunveilfundaydetails 1 5656 0 0 /news/fisher280519 3 11637 0 0 /news/aheadoframscrunchgamewithhorshamwardsaysthespiritisfantastic-exclusive 1 4347 0 0 /news/551a97b133e20 1 4676 0 0 /news/maidstoneunited0-5bromley-someonehaditcomingtothemsaysbromleymanagerpaulproctor 2 14736 0 1 /news/kennington251119 3 11369 0 0 /news/theresnoreasonwhywecantgetpromotedsayshogg-exclusive 1 4764 0 0 /news/bromley0-0havantwaterlooville-oneofthesedaysitsallgoingtocometogether-goldberg 1 7205 0 0 /news/princesparkspecialastadiumwherefamiliescanwatchthedarts-exclusiveinterview 2 8230 0 0 /news/thamesmeadtown1-1pottersbartown-lastminutegoalsdrawlittlecomfortformcmahon 1 6093 0 0 /archive-2006-2014/136 2 9190 0 0 /news/werestillquiteconfidentwecaninstallartificialpitchsayssevenoakstownbosspaullansdale 3 14592 0 0 /news/anynewswillfollowhere-2 2 5039 0 1 /news/crayvalley220219 5 25602 0 0 /national-league/5 5 35112 1 1 /news/thehoneymoonperiodisover-itsnowaboutresultssayssammacneil 2 7900 1 0 /news/injurieshaveknockedusforsixadmitslovell 1 4360 0 0 /news/551bc5de37421 2 22731 1 0 /news/doverathletictickledpinktosupportcancercharity 6 24769 0 0 /news/chathamtown3-0metropolitanpolice 1 3561 0 0 /news/ramsgate190205.html 2 0 0 0 /news/12thaug04.html 1 0 0 0 /news/NationalLeague260321 21 94269 6 8 /news/chatshep281219 5 61665 0 0 /news/kentleague/cray/20thjuly03.html 2 0 0 0 /news/itllbeamiracleifwegetpromotionwithouroff-fieldproblemssayscugley 2 7230 0 0 /news/tunwells170804.html 1 0 0 0 /news/hollands&blair130221 4 14892 0 0 /assets/ckeditor/plugins/ 8 5876 1 0 /news/hythe141216 2 8164 0 0 /news/551a99e4144c3 1 4564 0 0 /news/sevenseven150815 4 41122 0 0 /news/kinetic120121 6 19038 1 2 /news/ebbsfleetunited2-1tonbridgeangels-westtakeshischancetoimpress 1 7424 0 0 /news/sevenoaks260416 4 16566 0 0 /news/551a9c91caea1 1 4292 0 0 /news/drmartens/eastern/folkestone/folkevhemelfat011103.html 1 0 0 0 /news/greenhythe070418 2 20668 0 0 /news/brickiesawardedabandonedcuptie 3 8671 0 0 /news/lordswood150219 4 13705 0 0 /news/othernews/22ndjune03.html 2 0 0 1 /news/thamesmeadtown0-4sittingbourne-lovellkeepshisfeetontheground-exclusive 2 12435 1 1 /news/iseenoreasonwhywecantachievepromotionthisseasonsaysnewhythetownchairman 6 21056 0 0 /news/ashfordtown0-1whitstabletown-illjustbegladwhenitsalloversayslovell 1 5167 0 0 /news/12thjan05.html 1 0 0 0 /kent-county-league/11 5 36220 1 1 /news/craywands170116 3 14355 0 0 /news/hythe080216 4 17934 0 0 /news/551bc5e622e8d 1 3781 0 0 /news/551a956be8587 2 17521 0 1 /news/weveshotourselvesinthefootadmitsmaidstoneunitedbossjaysaunders 2 10265 0 0 /news/phoenixsports0-3whyteleafe-jonmainistheclubsbiggestsigningbyamilesaysbeckingham 4 38366 0 0 /news/harisitt131117 2 16965 0 0 /news/redbridge220105.html 2 0 0 0 /news/werekeepingourfeetonthegroundinsistslovell-exclusiveinterview 1 4321 0 0 /news/551bc99a90ee7 2 8056 0 0 /isthmian-league/29 10 48232 0 0 /isthmian-league/46 8 38408 0 0 /news/fisherproblemsmountbothonandoffthepitch 2 7376 0 0 /news/welling090218 4 13494 0 0 /news/kentleague/hernebay/hernebay.html 1 0 0 0 /archive-2006-2014/156 3 13534 0 0 /news/tunbridgewells1sladegreen1 1 4081 0 0 /news/glebe030120 2 7584 0 0 /news/drmartens/premier/dover/15thaug04.html 1 0 0 0 /news/crayvalley1-3raynesparkvale-itsnotlookinggoodformeatthemomentadmitspaulgross 3 26828 0 0 /news/hythetown1-1sittingbourne-icantputmyfingeronwhatsgonewrongathomesaysscottporter 3 21533 0 0 /news/551a96dbd03c8 1 3553 0 0 /news/551a96dbda869 1 3965 0 0 /news/favershamtownbeginsearchfornewmanager 2 6807 0 0 /news/soccershortsjohnbealespensnewcontracttostayatmargate 7 73939 2 3 /news/tonbridgeangelswillbeatoughnuttocrackwarnsdartfordbosstonyburman 1 3899 0 1 /news/5thjune05.html 2 0 0 0 /news/starstrikerjonmainshowndoorbytonbridgeangels 3 12407 2 2 /news/551bc5e053ab8 3 14852 0 0 /news/facupfirstrounddrawdoverathletic90minutesawayfromgillinghamshowdown 2 7592 0 0 /news/NationalLeague240920 2 6358 0 0 /news/551bc5dea193b 1 3493 0 0 /news/thechairmanhasgivenmetimetobuildproperlysayscanterburycityplayer-bosssimonaustin 1 4201 0 0 /news/holmesdale1-2hernebay-wewontgiveupontitleuntilitsmathematicalinsistshalsey 1 6858 0 0 /news/rymantvfailstoliftoff-fornow 1 3014 0 0 /news/corinthiansagreatclubtoplayforsaysbossjamescollins 3 12551 0 0 /news/ramsgate310119 4 14798 0 0 /news/facupdrawwearemassiveunderdogsatstainessayssittingbournebossnickdavis 5 22706 1 0 /news/kentleague/tunbridgewells/14thaug03.html 2 0 0 0 /news/mainonvergeofafcwimbledonmoveforanundisclosedfee-exclusive 1 2875 0 0 /news/doverathletic300720 3 10991 0 0 /news/trottsettomakemargatedebut 4 17138 1 0 /news/grayswell251015 6 79238 3 2 /news/erithbelvedere2-0croydon 1 4108 0 0 /news/drmartens/eastern/folkestone/18thjuly04.html 1 0 0 0 /news/itstooearlytoopanicsaypromotionchasingrivals 1 4680 0 0 /news/bridcrow110117 5 59872 0 1 /archive-2006-2014/209 2 9376 0 0 /assets/smartmenus/css/sm-simple/ 5 1828 0 0 /news/hythe180616 1 3857 0 0 /news/FAStatement031120 6 23522 0 0 /news/erithtown300815 4 15138 0 0 /news/sladegreenaimfortoptenfinish-exclusive 1 4402 0 1 /news/isthmianleaguestatement301220 5 22776 1 1 /news/fraserfranksdeservestomovebackintofull-timefootballsayswellingunitedbossjamieday 2 7787 0 0 /news/dartford5-1alfretontown-wefeltthiscouldbeamassivethreepointssaystonyburman 3 19690 0 0 /news/wedontwanttobestrugglingagainstrelegationnextyearsayslane 1 4902 0 0 /news/kentleague/lordswood/1stjuly03.html 2 0 0 0 /news/folkmers020515 4 39658 0 0 /news/551a956c42f18 1 3871 0 0 /news/uxbridge300405.html 2 0 0 0 /news/iamnothidinginsistsdolbyafterfanscallforanewmanager 1 4575 0 0 /news/favershamtown1-2beckenhamtown-theresnopressureonmyladssaysluchford 2 11263 0 0 /news/sittingbourne290116 3 11037 0 0 /news/ramsgate310320 3 10880 0 0 /news/551bc99a88d4a 1 3309 0 0 /news/gravesendnorthfleet1-4staffordrangers-sparsestonebridgesufferstaffordshocker 3 14144 0 0 /news/stevebrownextendshisstaywithebbsfleetunitedforanothertwoyears 4 17142 0 0 /news/thamesmead050216 4 14966 0 0 /news/wimbebbs261115 3 25992 0 0 /news/championsthanksforthesupportsaysprouddartschairman-exclusive 1 4619 0 0 /news/gillsbossandyhessenthalertellsscottporterimheretohelpyou 2 10124 0 0 /news/551bc5e82bccb 2 14090 0 0 /news/wedontwanthernebaytowalkawaywithitsaystunbridgewellsbossmartinlarkin 2 10931 0 0 /news/551a9cf555803 2 10110 0 0 /news/thambrig291017 3 28808 0 0 /news/26thjuly05.html 1 0 0 0 /news/sevenoakstown4-1tunbridgewells-wevehadalittlebitoftherubofthegreenadmitslevett 1 7141 1 0 /news/faversham240818 3 12813 0 0 /news/craymissoutonkentderbyaftertrophyexit 2 6274 0 0 /news/iwouldlovetosee3g4gpitcheseverywheresaysbexleyboroughbossliamkelly 2 12516 0 0 /news/551bc5dab18cc 2 7174 0 0 /news/551a96dbd8acd 2 6364 0 0 /sevenoaks-2003-2006/2 2 6014 0 0 /news/iwantanothercrackplayingrymanleaguefootballsaysnorthwood-exclusiveinterview 1 3848 0 0 /news/551a95b3df1f9 4 27706 0 0 /southern-counties-east-football-league/ 1 4743 0 0 /news/dealtown201218 3 9819 0 0 /news/551a9799b2fa8 2 9077 0 0 /news/werelookingatlong-termgrowthratherthanshort-termglorysaystonybeckingham 1 3713 0 0 /news/idontreallyknowwhattoexpectinthisdivisionadmitshernebaybosssimonhalsey 3 16711 0 0 /news/bromley070320 2 9830 0 0 /news/imgivingbeckenhamplentyofrespectsaysthamesmeadbosskeithmcmahon 2 10608 0 0 /news/idoknowwevegottoimprovesaysfolkestoneinvictabossneilcugley 3 15781 0 0 /news/wellingtown300519 3 9720 0 0 /news/551a931e2db07 1 3437 0 0 /news/conference/gravesend/2ndjuly03.html 2 0 0 0 /news/551bc5e668789 2 11061 0 0 /news/itsbeenagreatjourneyanditsnowtimetoleavethebussaysdartfordco-chairmanbillarcher 3 12631 0 0 /news/creditcrunchwerestrugglingtocopesaysonelocalchairman 1 3756 0 0 /news/imhopingwellgoupintothekentinvictaleaguesayselthampalacemanagerterrynaden 1 4732 0 0 /news/holdersconfidentofavoidingquarter-finalexit 1 5009 0 0 /news/crowholl210117 1 11974 0 0 /news/dartford030619 4 13781 0 0 /news/IsthmianLeague240320 4 15748 0 0 /news/fcelmstead081015 3 10959 0 0 /news/bromley210615 4 16510 0 0 /news/stoneschairmanissuesrallyingcryforbetterhomesupport 2 10124 0 0 /news/folkestone260519 4 13689 0 0 /news/thepressureisoffusatthemomentsaysluchford 2 11055 0 0 /news/PMStatement160320 5 25701 0 0 /assets/js/ 8 4889 0 0 /news/551bc5e29881d 3 11522 0 0 /news/margdulw140515 4 40218 1 0 /news/sittvtonb221103.html 2 0 0 0 /news/hillingdon231004.html 1 0 0 0 /sevenoaks-2003-2006 12 36409 0 0 /news/4thmar04.html 2 0 0 0 /news/dulwich281016 1 3446 0 0 /news/ashford250918 3 9800 0 1 /news/wellkeepatightshipatsittingbournesaysjoint-bossjimward 1 3934 0 0 /news/hoursofhardgraftontrainingpitchpaysdividendsfordarts-exclusive 1 5773 0 0 /news/charltonathleticsvisittodartfordmadeall-ticket 2 7036 0 0 /news/ashfordtown2-3chipstead-seanlakeepsuphisimpressivegoalscoringform 1 5193 0 0 /news/leatherhead220517 1 3513 0 0 /news/torquayunited4-0bromley-weregoingtotryandgetajobdoneintheleaguenowsaysgoldberg 4 36652 0 0 /news/kentleague/maidstone/10thjuly03.html 2 0 0 0 /news/werestartingtoturncrabblenowintoalittlebitofafortresssaysnickyforster 3 11921 0 0 /news/trophygiantkillingmakesupforearlyfacupexitsayswhitstablechief 1 4677 0 0 /news/braintree010105.html 2 0 0 0 /news/apartofmyheartwillalwaysbelongathartsdownpark-oconnell 1 5259 0 0 /news/folkcugley270415 4 19842 0 0 /news/wellseehowfarwevecomesayswhitstablebossseager 4 12145 0 0 /news/iwanttokeepthewinningmenalitygoingsayshernebaybosssimonhalsey 1 4984 0 0 /news/holmesdaleunveiljohnwilfortastheirnewmanager 4 16666 0 0 /news/ramsarun070919 5 43516 0 0 /news/crowboroughA201016 2 6729 0 0 /news/18thjuly03.html 1 0 0 0 /news/thepressureisallonhytheinsistsmartinlarkin 1 4290 0 0 /news/horshamymca050904.html 1 0 0 0 /news/vcd190918 3 14118 0 0 /news/drmartens/eastern/folkestone/folkvstam221103.html 1 0 0 0 /news/551a9cf4e236e 1 3736 0 0 /news/ivegotsomethinginthepipelinerevealswarrilow 1 5172 0 0 /news/conference/gravesend/28thjuly04.html 1 0 0 0 /news/wewanttoimprovetheleagueformsaysfolkestoneinvictabossneilcugley 5 19662 0 0 /news/551bc5e557690 2 16038 0 0 /news/dartford101019 3 13028 0 0 /news/sevenoaksupsetwithbengalsgreatprovocation 3 10276 0 0 /news/ashfordtown0-2craywanderers-jenkinstargetssecondplace 1 4093 0 0 /news/551bc5e2c7337 1 3118 0 0 /news/551a9c91ace31 1 4801 0 0 /news/wevegottoperformathomesaysbromleybossmarkgoldberg 2 8742 0 0 /news/mitchellragesundayleagueclubsarerunbetterthanlordswood-itsashambles-exclusive 2 6572 0 0 /news/ryman/bromley/Bromvhors100104.html 1 0 0 0 /assets/fonts/glyphicons-halflings-regular.eot 1 20335 0 0 /news/donotruleusoutoftherunningforkentleaguetitlesaysrobbins 2 8173 0 0 /archive-2006-2014/178 5 22157 0 0 /news/crayvalley020817 1 4498 0 0 /news/kingpledgeshisfuturewithchampions-electwhitstable 2 7906 0 0 /news/hillsborough 2 5530 0 0 /news/craywanderers0-0leiston-wevehadabadrunathomesoitsgoodtogetapoint-ianjenkins 2 14846 0 0 /news/leicester281018 3 14993 0 0 /news/croyholl090316 5 77147 1 1 /news/wehadfourorfiveplayersthatididntthinkwanteditenoughadmitskeithmcmahon 2 8012 0 0 /news/551a96780d78c 1 4207 0 0 /news/charlton180915 4 15070 0 0 /news/dartford2-1maidstoneunited 3 17984 0 1 /assets/uploads/content/Crockenhill_pitch%20-%20Copy%201 1 238894 0 0 /news/sittingbourne240218 1 3608 0 0 /national-league/17 2 9480 0 0 /news/sevenoakstown2-3lordswood-ileftayeartooearlyadmitslordswoodbossjasonlillis 4 39236 0 0 /news/551bc5e5b7969 1 4426 0 0 /news/ihopewehavethehonourofbeatingburgesshilltwicesaysdartfordbosstonyburman 4 22604 0 0 /news/drmartens/premier/welling/22ndjuly03.html 2 0 0 0 /archive-2006-2014/197 4 16822 1 0 /news/brompete101118 5 50854 1 0 /news/dartfordchoosethurrockforfinancialreasons-exclusiveinterview 6 28040 0 0 /news/soccershortsmysidecanholdtheirownintherymanpremier-burman 1 4980 0 0 /news/invictastopdrawlottery 1 3196 0 0 /news/551bc5e63b777 2 11038 0 0 /news/maldon041204.html 2 0 0 0 /news/ramsbosswardtargetsmaximumfestivehaul 3 10865 0 0 /news/binkswantsmaxiumumpointsbeforetrophytriptoharrow 1 4103 0 0 /news/dalersunderdogsfortheirhistoricnightclaimsbeckingham 1 5538 0 0 /news/drmartens/eastern/sittingbourne/tootingvsittfat041003.html 1 0 0 0 /news/tonightsresults 2 5327 0 0 /news/ryman/bromley/casuals140904.html 1 0 0 0 /news/campaign100820 3 12995 0 0 /news/ryman/bromley/13thoct03.html 1 0 0 0 /news/itwasclearfromtheoutsetthatsuttonathleticareanambitiousclubsaysnewbossjamescollins 6 23072 0 0 /news/551a9cf505ce2 2 11582 0 0 /news/551bc5e446813 3 12866 0 1 /news/doverathletic030820 5 16966 0 0 /news/hayesyeadingunited4-2ebbsfleetunited-myplayershavecheatedmesaysdaish 2 13070 0 1 /news/premierleaguerefereeisstarnameatfavershamtownsdinner 2 6105 0 0 /assets/ckeditor/plugins/forms/dialogs/ 1 492 0 0 /news/blyspartans0-0phoenixsports-wewerethebettersideanddeservedtowinsaysphoenixboss 1 5172 0 0 /news/rossflitneyismynumberonekeepersayshessenthaler 1 3660 0 0 /news/drmartens/premier/dover/leyton301104.html 1 0 0 0 /news/itsveryimportanttogettoacupfinalsaysluchford 1 3486 0 0 /news/kentleague/hythe/15thjuly04.html 1 0 0 0 /news/ebbsfleet070419 3 19419 0 0 /dartford-2003-2006/2 3 9216 0 0 /news/weregoingintotheunknownadmitspromotedholmesdalechairman-exclusive 1 4153 0 0 /news/19thjuly04.html 1 0 0 0 /news/crowborough261218 4 16510 0 0 /news/doverathletic0-0tonbridgeangels-ijusthavetofindtherightmixadmitsdoverbosshayes 1 7887 0 0 /news/thekentleaguetitleraceiswideopensaysnortonbossbentaylor 2 10486 0 0 /archive-2006-2014/188 4 17666 0 0 /news/551a931dacd3e 1 3309 0 0 /news/ryman/bromley/suttonreplay201004.html 1 0 0 0 /news/snodlandtown030719 4 17064 0 0 /news/551bc5e4844b3 1 2874 0 0 /news/sceflstatement170820 3 9302 0 0 /news/england03072018 5 29470 1 1 /news/play-offfinalspecialitsourturntogoup-jenkins 1 4218 0 0 /news/rusthall130217 4 13228 0 0 /news/3gpitchstatement260817 1 5936 0 0 /news/brombrai280217 3 27339 0 0 /news/kentleague/tunbridgewells/23rdjuly03.html 2 0 0 0 /news/551a9250a81ad 2 7634 0 0 /news/dartford1uxbridge2tonightsresults 4 21618 0 0 /news/longlu18vbromu18090404.html 1 0 0 0 /news/normannetsinhomecountyagain 5 34055 0 0 /news/welfordpensnewdealtostayatdoverathletic 1 3156 0 0 /news/dartstoannouncepulmanreplacement 4 13542 0 0 /news/peckham220117 4 14182 2 1 /news/sittingbournefc.uk 1 0 0 0 /news/hollands&blair040920 4 15361 1 1 /news/wewillprovethebookieswronginsistsobrien 1 4758 1 0 /news/551a99e4b3d8b 3 17382 0 0 /news/holmesdale040617 3 14256 0 0 /news/kentleague/lordswood/23rdjuly03.html 2 0 0 0 /news/wewontgiveuponthetitleracesaysjenkins 1 3950 0 0 /news/theresmoretocomefromussaystable-toppinghessenthaler 2 8120 0 0 /news/punjab150219 4 15246 0 0 /news/iwillbegettingmyselffitanddoingapre-seasonaswelackcharacters-obrien 2 8968 0 0 /news/deal090205.html 2 0 0 0 /news/europeancupwinnersignsformaidstoneunited 1 3880 0 0 /news/551a97b286c15 1 4935 0 0 /news/551bc99cbe7db 1 5212 0 0 /news/greeniesfridaypreview-4 2 12005 0 0 /news/phoenix230916 2 6380 0 0 /news/551a931ebac55 2 8325 0 0 /news/anyteamthatwantstobattlewellbeupforitsaysthamesmeadtownbosskeithmcmahon 3 13001 0 0 /news/weredelightedwithourstartbutnotsurprisedsayswhitstablejoint-bossjimward 3 13466 0 0 /news/waltoncasuals180105.html 1 0 0 0 /news/fcelmstead140517 4 12681 0 0 /news/ashfordtown0-0dartford 1 4342 0 0 /news/551a96db8926e 1 4762 0 0 /archive-2006-2014/222 2 8772 0 0 /news/rusthall020817 1 3702 0 0 /news/withaheavyheartihavebeenforcedtoresignsaysnickdavis 4 15302 0 0 /news/gillsports260415 3 24056 0 0 /news/551a9c0e5db24 1 4221 0 0 /news/crayvdeal030216 4 37734 0 0 /news/551a97b21c405 1 4095 0 0 /news/dartsirving280415 6 59460 0 3 /news/topsixwouldbeniceandafinalsaysfleetleisurebossleerichmond 4 17869 0 0 /news/bromley140817 2 9842 0 0 /news/doverathletic300619 4 14474 0 0 /news/551a97b25076e 1 4191 0 0 /news/ourluck-andtime-isrunningoutsaysconcernedmargatedirector 1 3300 0 0 /news/dealtown190120 2 8730 0 0 /news/dulwichhamlet0-1tunbridgewells-martinlarkinveryproudofhisresilientfacupgiant-killers 1 9057 0 0 /news/bromalt141115 3 24618 0 0 /news/favehyth270819 5 44137 0 0 /news/werenowherenearwhereiwantusintermsofperformancessaysmattlonghurst 3 11382 0 0 /news/adamsbidstoendcrockenhillssaddemise 2 8440 0 0 /news/mylong-termaimistolookathomegrowntalentsaysbutler 2 8078 0 0 /news/tooting230805.html 2 0 0 0 /news/rusthall011216 3 12246 0 0 /news/maidstone220518 4 13410 0 0 /news/off-coloursevenoaksgodownatwhitstable 5 33968 1 1 /news/werestrongenoughtogetoutofrelegationbattleinsistsross 2 10298 0 0 /erith-belvedere-2003-2006/4 4 11250 0 0 /news/sevenacresidcup2-1tudorsports-wevedoneeverythingwewantedtodosaysdannyfrost 7 64038 1 0 /news/thamesmeadtownsubmitplanstobuild385mmini-dartfordatbaylissavenue-exclusive 1 4209 0 0 /news/551a967722788 1 4622 0 0 /news/weneedtobouncebackquicklysayscrayvalleybossstevechapman 2 9682 0 0 /news/greenwich210120 6 19614 2 2 /news/decemberresults 1 5250 0 0 /news/551bc5e2dbd92 1 3575 0 0 /news/ivegotafewthingswrongbutillputthemrightinsistsdartsbosstonyburman 2 8950 1 0 /news/ashford140116 4 17369 0 0 /news/rivalmanagerscomplainaboutderbydraw-exclusiveinterviews 1 6093 0 0 /news/atriptoleistoncantcomequickenoughformesaysjoefrancis 4 15768 0 0 /news/harrow011005.html 2 0 0 0 /news/ashfordcancelwhybournesigning 2 6357 0 0 /news/551a96dca0bc4 1 5875 0 0 /news/kentcountyleagueformerashfordstarboormannetsbraceforborough 2 7388 0 0 /news/lydd060917 3 11154 0 0 /news/jenkinswaryofclinicalrivalstrikers 1 3966 0 0 /news/ithinktheyvedoneusallveryveryproudsayswhitstabletownchairmangaryjohnson 1 5491 0 0 /news/kentleague/ramsgate/ramsu18vchat210304.html 1 0 0 0 /news/ilford1-0thamesmeadtown-illoffertowalkifwedontmakeplay-offswarnskeithmcmahon 1 7033 0 0 /news/greensitt151217 1 4839 0 0 /archive-2006-2014/90 1 5037 1 0 /news/folkestoneinvicta0-1maidstoneunited-theagonyandtheecstasy 5 48077 4 4 /news/tonbridge070416 4 12205 0 0 /news/551bc5df24fc0 1 4503 0 0 /news/weveblownhotandcoldthisseasonadmitstonbridgeangelsbosstommywarrilow 1 5022 0 0 /news/wevegottobuildonourrecentformsaysyorath 2 7114 0 0 /news/kentfootballunited171119 4 16995 1 0 /news/551a9c92bf445 2 10273 0 0 /news/suttonunited3gpitchdebate050218 3 13905 0 0 /news/dulwich231018 4 15954 0 0 /news/ashford240704.html 2 0 0 0 /news/551a9c9284535 5 52627 1 0 /news/ramssitt190119 5 57833 1 1 /news/theroadtowembleyiwanttoreachthefirstroundfortheveryfirsttimesaysremy-exclusive 2 9027 0 0 /news/551a96772b949 4 20604 1 1 /news/cugleyhailsremywonderstrike 2 13294 0 0 /news/deresappointroystonandhunteruntiltheendoftheseason 1 4947 0 0 /news/coachingyoungstersisthemostrewardingpartoffootballsayssevenoakscoachmickyhazard 1 5452 0 0 /news/iowealottochriskinnearforwhativedoneinthegamesaysstonesbossjaysaunders 3 13733 0 0 /news/doverstrikeroptsfortakingintensivephysiobutdeclinesoperation 6 18389 0 0 /news/favershamtown0-0merstham-idhaveaskedformymoneybackafterthatadmitsjustinluchford 2 14117 0 0 /news/ryman/bromley/5thdec03.html 1 0 0 0 /news/doverchasepromotion 1 3130 0 0 /news/gillingham170817 4 12641 0 0 /news/drmartens/eastern/sittingbourne/lymington040904.html 1 0 0 0 /news/rusthallpartcompanywithmanagerpaulmcdonagh 3 10469 0 0 /news/16thfeb04.html 2 0 0 0 /news/tonbridgeangels2-3burytown-itakefullresponsibilityitwasntgoodenough-warrilow 1 7443 0 0 /news/551a96dba0e22 2 6090 0 0 /news/551a979a8b967 1 5122 0 0 /southern-counties-east-football-league/45 2 9932 0 0 /news/kentleague/deal/Sampson19.html 1 0 0 0 /news/leighton120205.html 2 0 0 0 /news/ebbsfleetunited2-2salisburycity-daishspeaksabouthisfleetfuture 2 13074 0 0 /news/dealtown200619 4 12957 0 0 /news/fcelmstead010819 3 11831 0 0 /news/rochnewh100816 3 46284 1 2 /news/play-offfinalspecialiwanttosendmybelovedcrayupsaysloyalservantwood 1 4848 0 0 /news/kentleague/cray/chatham081204.html 1 0 0 0 /news/resultsaug2016 3 25675 0 0 /news/ramsgate180919 5 19379 0 0 /news/welllew080818 3 34167 0 0 /news/kentleague/VCD/27thaug04.html 1 0 0 0 /news/idontknowtoomuchaboutclubsoff-the-fieldproblemsadmitschalmers-stevens 1 4189 0 0 /news/551a9678b44b5 1 3937 0 0 /news/ivehadanawfulrecordinthetrophyandihopetoputitrightsaysbromleybossmarkgoldberg 3 14769 0 0 /news/hopefullywellmakesittingbourneamajorforcesaysnewcoachwillgraham 1 4203 0 0 /news/fleetmcmahon030515 4 16441 0 1 /news/margate010620 5 23021 0 0 /news/KentCountyLeague140517 3 17461 0 0 /news/margate181217 1 3246 0 0 /news/welling061115 3 12834 0 0 /news/kentleague/lordswood/1stdec03.html 1 0 0 0 /news/kentleague/ramsgate/7thjuly03.html 2 0 0 0 /news/warrilow070116 3 16437 0 0 /archive-2006-2014/241 3 12712 0 0 /news/abbottthinksaboutplayingthreeupfrontagainstwhitstable 1 4407 0 1 /news/28thjune05.html 1 0 0 0 /news/ourperformanceshaventbeengreatagainstthebottomsidesadmitsramsgatebosstimdixon 2 9654 0 0 /news/concernsraisedoversorrystateofkentleagueclub-exclusive 1 3568 0 0 /news/551a97b215967 1 4292 0 0 /news/folkestoneinvictasellstrikerstuartkingtomaidstoneunited 3 14150 0 0 /news/hampton061205.html 1 0 0 0 /news/tramswillrunsmoothywhilstchairmanrecovers 1 3447 0 0 /news/fatrophyspecialdefenderleemakeshiscomebackfromhorrificleginjury 1 3892 0 0 /news/551bc5dabce8d 2 7002 0 0 /news/drmartens/eastern/sittingbourne/burgesshill061104.html 1 0 0 0 /news/bridonropes120216 4 16857 0 0 /news/strikernugentcompletesstones18-mansquad 1 3270 1 0 /news/iwaslivingaliesaysenglandgayfootballercaseystoney 7 91516 4 5 /news/greenwich080319 3 9873 0 0 /news/werenotgoingtocrippletheclubinsistswarrilow 1 5824 0 0 /news/stainvbrom090304.html 1 0 0 0 /news/lewisissuesbattlecrytoturnaroundstonesseason 2 6878 0 0 /news/lewisham040518 3 11550 0 0 /news/thetitleraceisfarfromoverinsistsharwood 2 8530 0 0 /news/wemighthavetofindourfeetinthesceflsayscrowboroughjoint-bossseanmuggeridge 4 15934 0 0 /news/551bc5e8c038b 1 3235 0 0 /news/imlearningaswellastheplayerssayshernebaybosssimonhalsey 3 13085 0 1 /news/FAStatement070420 3 12974 0 0 /news/weresecondfavouritestowintheleaguesaysvcdathleticbosstonyrussell 2 9394 0 0 /news/margate240717 4 17265 0 0 /archive-2006-2014/21 4 20451 0 0 /news/elthrust040217 4 19888 0 0 /news/551bc5dfe5737 1 4129 0 0 /news/551bc99c3294a 1 5676 0 0 /news/ithasnotbeeneasytolandjackpartersayswhitstabletownchairmangaryjohnson 2 8140 0 0 /news/bridgrav100216 4 43959 0 0 /news/551a979920a10 2 12483 1 0 /news/maldontiptree2-2thamesmeadtown-whenwereupagainstitwecomeoutfightingsaysmcmahon 2 24592 0 0 /news/billericaytown2bromley2 3 12020 0 0 /news/wemustgetstadiumapplicationrightsaysstoneschairman 1 3374 0 0 /news/BlairKSTFinal100415 3 14888 0 0 /news/dolbyholdscleartheairtalkswithtwokeyplayers 2 7938 0 0 /news/greenwich050815 3 13542 0 0 /news/wedontfearhernebaywerespectthemsayserithtownbosstonyrussell 1 4309 0 0 /news/ashford151005.html 1 0 0 0 /news/ryman/bromley/28thJan04.html 1 0 0 0 /news/apm080416 3 10599 0 0 /news/551a97b150385 1 5443 0 0 /news/551bc5e5363c8 2 10778 0 0 /news/wevegotalottoplayforinournextthreegamessayschathamtownassistantkeithlevett 4 19284 0 0 /news/conference/margate/3rdoct04.html 1 0 0 0 /news/sittingbourne110320 5 30832 0 0 /news/thebigkickoffcosgroveinsistsdereswillwinkentleaguecrown 1 6348 0 0 /news/theroadtowembleyfacarlsbergvasesecondrounddraw 1 3018 0 0 /news/kentleague/greenwich/greenvslade281003.html 1 0 0 0 /news/551a99e43d5ce 1 3772 0 0 /news/551a99e49031a 1 3619 0 0 /news/greenthankyouforyourmessagesofsupport-iwillbeback 1 6415 0 0 /news/551bc99c76114 1 5129 0 0 /news/londonbridge040617A 3 9617 0 0 /news/wereinaquarter-finalwhynotlooktowintherymanleaguecupsaysstonesbossjaysaunders 1 5075 0 0 /news/favershamdismissmanagementteam 2 7568 0 0 /news/invictahailsuccessfulfamilyfunday 1 3873 0 0 /news/551a979929f5d 2 9674 0 1 /news/tunbridgewells150320 3 14558 0 0 /news/551a95b464a59 1 3857 0 0 /news/ambitiousclubawaitfloodlightdecisionbeforeapplyingtokentleague-exclusiveinterviews 2 10236 0 0 /news/ryman/bromley/17thsept04.html 1 0 0 0 /news/othernews/5thnov04.html 1 0 0 0 /news/551a924ff0736 1 3605 0 0 /news/ryman/12thaug03.html 2 0 0 0 /news/ourqualityshonethroughintheendsaysplay-offchasingford 2 7652 1 0 /news/ryman/bromley/28thoct03.html 1 0 0 0 /news/551bc5dd9819c 1 3411 0 0 /news/551bc5dc6de5c 2 8082 0 0 /news/andyhessenthalerbackskentfascampaigntocutoutbadbehaviour 2 11506 0 0 /news/tonbneed040317 1 10754 0 0 /news/kentleague/sladegreen/25thjuly03.html 2 0 0 0 /news/ihavethebackingoftheboardinsistslovell 1 4991 0 0 /news/invictafacedog-fightintheirlasttwogames 1 6329 0 0 /news/ebbsfleetunited4-0wellingunited-itwasmenagainstboysadmitssorryjamieday 2 15689 0 0 /news/551a956c7aca0 1 3304 0 0 /news/lashingsmakingprogressastheybidtotakeovermaidstoneunited 1 3683 0 0 /news/kentleague/hernebay/7thjuly03.html 2 0 0 0 /news/wevegotaplatformtobuildonsaysthamesmeadtownbosskeithmcmahon 1 3982 0 0 /news/windsorvbrom090903.html 1 0 0 0 /news/ebbsfleetunited3-1aldershottown-heroicfleetwithintouchingdistanceofwembley 1 5719 0 0 /news/croydon130919 3 10586 0 0 /news/horsham2-0whitstabletown-ifwegetto40pointsithinkweresafesaysnickysouthall 3 24137 0 0 /news/kentleague/beckenham/21stnov04.html 1 0 0 0 /assets/fileman/lang/cs.json 1 3420 0 0 /news/collegepaintingchathamtownredblackandwhite 4 12333 0 0 /news/resultsmarch2013 2 19204 0 0 /news/chairmanhasgroundsforoptimismaheadofplay-offs-exclusive 1 5028 1 0 /news/551bc99b9da23 1 3328 0 0 /news/longhurstpleasedwithcharactershownbyhisnine-men 1 3490 0 0 /news/kentleague/sladegreen/8thaug04.html 1 0 0 0 /news/1stapr05.html 1 0 0 0 /news/doverathletic2-1afchornchurch-thewaitisalmostoversayshare 2 10213 0 0 /news/cashflowproblemsforceswarrilowtoditchferguson 1 5103 1 0 /news/bathebbsfleet050221 5 32788 1 1 /news/theresgoingtobeloadsoftwistsandturnsthisseasonsaysangelsbosstommywarrilow 1 3610 0 0 /news/othernews/15thsept03.html 1 0 0 0 /news/facuppreviews 1 7332 0 0 /news/551bc5e89d518 2 10403 0 0 /news/stadiumblowforebbsfleetunited 1 4282 0 0 /news/nationalleague290119 3 10314 0 0 /news/gillinghamsignformermargatedefendergaryborrowdale 5 66289 3 2 /news/elthamstansfeld2880816 4 18410 1 0 /news/551a99e454f14 1 4540 0 0 /news/forthcomingfixtureswc300106 4 14154 1 0 /news/craygleb130419 4 43754 0 0 /news/welearntafterthethreebridgesgamethatwejustcantturnupandrollteamsoversayssaunders 5 24837 0 0 /news/humeexpectssuccessontheroad 2 7806 0 0 /news/fatrophyspecialchatsplottinganothertrophysurprise 1 4573 0 0 /news/maidstone100518 4 12890 0 0 /news/dulwich020618 3 10884 0 0 /news/resultsnovember2013 5 58937 0 0 /news/551a979a29ec8 2 9428 0 1 /news/uccdhfsp120419 5 41957 0 0 /news/bromleyunveilthereturnofmidfieldacealifuseini 2 7744 0 0 /news/551a967728f96 1 4067 0 0 /news/551a97b0cfaab 3 13029 0 0 /news/sladegreen180904.html 1 0 0 0 /news/lymington040904.html 2 0 0 0 /news/gormandreamingofnationallimelight 1 4012 0 0 /news/wedontfeelanypressuresaystable-toppingmcmahon-exclusive 1 4632 0 0 /tunbridge-wells-2003-2006 11 33508 0 0 /news/smithbeginssearchfornewclub 3 13400 1 0 /news/gillinghamapproachdoverathleticforhessenthaler 2 7072 0 0 /news/ryman/bromley/7thdec03.html 1 0 0 0 /news/sheernesseast4-4lewishamborough 5 31537 0 0 /archive-2006-2014/125 3 13386 0 0 /news/551a967735759 1 4571 0 0 /news/551bc5dbbe4d6 3 13701 0 0 /news/dartford050820 3 9737 0 0 /news/fisher0-5vcdathletic-wellpileonthepressureandcarryonwinningsaysraypowell 3 30968 0 1 /news/wevehadresultsgoourwayandnottakenadvantageofitsaysstonesbossjaysaunders 1 4007 0 1 /news/millwallpavey090515 4 15749 0 0 /assets/smartmenus/demo/ 9 5532 0 0 /news/doverathletic1-4gillingham-timetopayupjack 1 5249 0 0 /news/harrbrom050319 3 29712 0 0 /news/551a96dc1b831 3 13821 0 0 /news/hastingsunited2-1chathamtown 1 4197 0 0 /news/shockassussexfootballercollapses-andlaterdies-duringmatch 2 6444 0 0 /news/craywanderers1-1lowestofttown-ithinkourpositionisperfectsaysianjenkins 3 22804 0 0 /news/mynextgoalistoputsimonhalseyonacontractsayshernebaychairman 2 8113 0 0 /news/551bc5e2b86e1 2 7140 0 0 /news/maidstoneunited1-0bognorregistown-thestonesarestayingup 2 10883 0 0 /news/dartford1-4afctelfordunited-wehavebeenpunishedseverelyforourmistakessaystonyburman 3 24004 0 0 /news/afcwimbledon261105.html 1 0 0 0 /news/gravesendnorthfleetladies3longlaneladies2 2 16129 0 0 /news/legendhessenthalerreturnshometogillingham 1 4025 0 0 /news/doverre-signmainsponsor 2 6942 0 0 /news/wellingunited080719 3 10890 0 0 /news/abbottifwedontmaketheplay-offswevegotourselvestoblame 1 3408 0 0 /news/sevenoaks220715 4 19245 0 0 /news/itsbeenaverychallengingtransitionperiodsayscraywanderersbosskeithbird 2 8346 0 0 /news/drmartens/premier/dover/25thsept04.html 1 0 0 0 /news/gillingham020919 2 7338 0 0 /news/bigcrowdexpectedatthebelmontforcanterburycitysreturn 2 9052 0 0 /news/ithinkweredueafacuprunsayswellingunitedbossjamieday 2 9072 0 0 /news/wellingmcentegart051215 3 11610 0 0 /margate-2003-2006/ 1 3031 0 0 /news/551bc5e2ab850 1 3202 0 0 /news/theroadtowembleythreekentsidesleftinthefinalqualifyinground 2 6828 0 0 /news/chatham061020 4 13786 0 0 /news/whitstabletownunveilantbodlesigning 1 3286 0 0 /news/bromley250321 22 97803 10 5 /news/weregoingfortheplay-offssayswhitstabletownjoint-bossjimward 4 19016 0 0 /news/burmanthrashesoutdealforkadi 1 3495 0 0 /news/26thoct05.html 1 0 0 0 /news/thefleetatwembleykentsredarmydescendonwembley 1 3638 0 0 /news/greenwichborough3-1erithbelvedere 1 4170 0 0 /news/ramsgate030519 4 14986 0 0 /news/wemustprogressinthefacupsaysburman 2 7390 0 0 /news/kentleague/ramsgate/15thmar04.html 1 0 0 0 /news/551a99e46a5e8 1 4406 0 0 /news/551bc5dc0df3b 1 3490 0 0 /news/dulwichhamlet1-2craywanderers-dolbymaintainswandspushforthetitle 1 4854 0 0 /news/mattleereleasedbywings 3 8860 0 0 /news/welling251006 4 24832 0 0 /news/crowborough140919 3 10029 0 0 /news/statattackrickyfreemanleadsgoalscoringchartwith15goals-crocksstartwith9defeats 6 25778 0 0 /news/dockersdemandafour-figurecompensationfeefor43-goalstrikercassius 2 11376 0 1 /news/margate041217 2 8611 0 1 /news/joeford220619 3 9902 0 0 /news/sevenoaks020717 1 3997 0 0 /news/haywashf021018 4 39378 1 0 /news/551a96dba6dec 4 15705 0 0 /news/pre-seasonfriendlies-2 1 5266 0 0 /news/wejusthavetotryandwingamesaswevegotnocontroloverleaderswellingsayschriskinnear 4 20529 0 0 /news/charlton220318 3 11347 0 0 /news/tonbridgeangels0-3bromley-weneededthethreepointssobadlysaysmarkgoldberg 3 29384 0 0 /news/longhurstplaysdownhissideschances 1 4770 0 0 /news/drmartens/eastern/ashford/4thjuly04.html 1 0 0 0 /news/craythurr150316 4 38450 0 0 /news/551bc5df9bfe8 1 3815 0 0 /news/551a9cf581413 2 8676 0 0 /news/551a95b3b1171 4 19322 0 0 /news/551a92505401c 2 7482 0 0 /news/overtonbeginscomebacktrail 2 7313 0 0 /news/551a9c917ad43 4 19366 0 0 /news/oldbrom211217 2 7018 0 0 /news/stadiumrevamphasbeenalongtimecomingsaysmargatesecretarykentomlinson 1 5170 0 0 /news/weregoingtogivesomeoneahidingwarnsbinks 2 7828 0 0 /news/551a95b373843 1 4235 0 0 /news/cupdraws2007-2008 1 4037 0 0 /news/fordcriticiseskcfaforhiscupfinalban 1 4363 0 0 /news/sykes130405.html 2 0 0 0 /news/ksports060418 3 12843 0 0 /news/holmesdale280419 4 16516 0 0 /news/kentleaguereleasefixtures 5 21219 0 0 /news/wellingtown091019 3 13032 0 0 /news/551a9c0ec2981 4 16294 0 0 /news/werebuildingfoundationsfornextyearssustainableplay-offpushsaysbromleybosshaydenbird 1 4814 0 0 /news/sladevrams200304.html 2 0 0 0 /news/rusthall030317 4 15370 0 0 /news/crayhillman150515 5 32166 0 1 /news/imhappywithmyreducedbudgetsaysward 3 13195 0 0 /news/12thsept05.html 1 0 0 0 /news/sct060718 4 16314 0 0 /news/tonbridge150615 3 10149 0 0 /news/redbridge2-3sittingbourne 1 4110 0 0 /news/beckenham100119 4 19321 0 0 /news/551bc5dcd4db0 1 5128 0 0 /news/lewes3-1wellingunited-wewerealittlebitlifelesstodayadmitsday 2 41491 1 0 /news/wemusttakeourchancessaysfirkins 1 4255 0 0 /news/weregoingtowellingtocauseanupsetinsistswarrilow 1 4366 0 0 /news/folkestoneinvicta0-2billericaytown-wedidntdoourselvesjusticeadmitswatson 2 14891 0 0 /news/hythetownskipperdavecookreturnsforclashattunbridgewells 1 4559 0 0 /news/craymone221117 3 29936 0 0 /news/creditcrunchchangeswillbemadesaysconcernedangelschairman 2 9846 0 0 /news/folkestoneinvictafansamjonesrunslondonmarathoninmemoryofpaulsykes 3 13907 0 0 /news/lyddtown281217 4 15653 0 0 /news/hernebay280519 4 15430 0 0 /news/danishfootballfansbecomejointownersofcroydonathletic 1 4285 0 0 /news/soccershortsmargatesfuturelooksbleak 1 7329 0 0 /news/whyteleafe270918 3 13527 0 0 /news/greenwich040217 1 4053 0 0 /news/stonesreleasetwotocutbacktheirbigsquad 2 6836 0 0 /news/drmartens/eastern/sittingbourne/sittvchat261203.html 1 0 0 0 /news/551bc5dad9d42 3 29215 0 1 /news/weareplay-offcontenderssaysthamesmeadtownbosskeithmcmahon 2 9296 0 0 /news/burmanwantsaperfectchristmas-exclusive 1 4261 0 0 /news/holmesdale5-3westwickham-ourrootswillstayfirmlywheretheyaresayskeithdurso 4 39772 0 0 /news/rusthall310818 1 3428 0 0 /news/ournewgroundwillensurethelongtermstabilityoftheclubsayskfubosssammacneil 3 16389 0 0 /news/crowborough210617 1 4191 0 0 /news/hernebaychairmanblamescontractorsforplayingsurface-exclusive 1 3438 0 0 /news/tonbridgeangels2-0bognorregistown-patched-upangelsturnugly 4 65058 0 0 /news/maidstoneunited3-1burytown-wemustcutoutdefensivemistakessayshume 2 9210 0 0 /news/onedaystevehansonwillbecaptainofhernebaysaysbosssimonhalsey 3 14669 0 0 /news/bromleysmostfamouspartofhayeslanedisappeartomeetconferencepremiergroundgrading 1 4607 0 0 /assets/images/site/Thumbs.db 1 779264 0 0 /news/551a96dba27e4 1 2918 0 0 /archive-2006-2014/111 2 10176 0 0 /news/leatherhead0doverathletic0 1 3639 1 0 /news/kentleague/ramsgate/12thoct03.html 1 0 0 0 /news/551a97b24a2e0 1 4414 0 0 /news/zanonerecord260415 10 64828 2 4 /news/lordswood041217 2 7826 0 0 /news/kentleague/sporting/20thjuly03.html 2 0 0 0 /news/wedefinatelywontbetakingbansteadlightlysaysstonesbossjaysaunders 1 3946 0 0 /news/551a931ded838 4 32243 1 0 /news/whitworthi031015 4 36505 0 0 /news/ambitiousvickersjoinconferenceyouthelite 1 3839 0 0 /news/12thoct03.html 1 0 0 0 /news/rusthall081118 4 14923 0 0 /news/vcdathletic1-3hythetowncrawfordhelpshythebuzz-exclusiveinterviews 3 17153 0 0 /news/derespullofffarleytransfercoup 4 14650 1 1 /news/551bc5ddf096b 1 3521 0 0 /news/beckenham141019 3 11829 0 0 /news/551bc5e810bd1 2 8158 0 0 /news/ryman/bromley/bromvashfordfac160903.html 1 0 0 0 /news/sullivanquitsastonbridgeangelschairmanbutwarrilowstaysonasboss 2 7370 0 0 /news/551bc99ae2f4c 1 3462 0 0 /news/dulwichhamlet140720 2 7386 0 0 /news/erithtown170617 3 11820 0 0 /news/itsimportantthatwekeepastablebasetocompetesuccessfullysayshernebaybosssamdenly 4 15350 0 0 /news/ashfordunited251118 5 17180 0 0 /news/werelookingtoplayinvictaleaguefootballnextyearsaysmetrogasmanagerroydavies 3 14144 0 0 /news/improudofourteamperformancesayswellsskipperjasonbourne 2 10588 0 0 /news/chatham050516 4 15006 0 0 /news/551a9cf4ed8dd 1 3038 0 0 /news/bromleytitlewaldren190415 4 19754 0 0 /news/551bc5e687649 1 3854 0 0 /news/cyrilwindiate260219 3 10253 0 0 /news/margate230218 1 3618 0 0 /news/dartford1-2sittingbourne 3 14289 1 1 /news/551a9798cee2e 2 9344 0 0 /news/councilhandcontrolofprincesparktodarts 1 4532 0 0 /news/werenotthefinishedarticlesaystable-toppingrobbins 2 7438 1 0 /news/facarlsbergtrophysecondqualifyingrounddraw-1 1 2906 0 0 /news/canterburystadium230415 4 13369 0 0 /news/wemustenjoyhomecomfortsinsistspatterson 1 6101 0 0 /news/welling081115 3 12969 0 0 /news/oureffortshavetakentheirtolladmitsseager 2 10461 0 0 /news/551bc5e07516c 1 8019 0 0 /news/erithbelvedere2-3vcdathletic-wevebeencheated-ragesgorman 7 111938 5 3 /news/lewisham010916 3 11808 0 0 /news/barton030905.html 2 0 0 0 /news/551bc99a67dd3 3 9770 0 0 /news/warrilowhits-backatmindlessforumjibes-exclusive/ 1 16522 1 0 /news/bromleydavidgregory130518 4 20669 0 0 /news/kentcountyleaguescoopsfarespectaward 3 11858 0 0 /news/favershamtown4-0sittingbourne-itwasimportanttobouncebacksaysfavershambossrayturner 1 5912 0 0 /news/craywanderers1-1canveyisland-itwasagoodpointagainstateaminfifthsaysianjenkins 3 23228 0 0 /news/ryman/bromley/havantvbromfayc020903.html 1 0 0 0 /news/matchreports 1 11756 0 0 /news/bromley061218 4 13925 0 0 /news/waltoncasuals1-2maidstoneunited-thestonesaregoingup 2 12510 1 1 /news/doverchairmancallsforasupportersclub 1 3831 0 0 /news/wellingunited300121 4 21555 1 1 /news/thamesmeadbossmcmahontargetstop-tenfinish 2 8675 0 0 /news/fordbeatscompetitiontolandfootballadvisoryroleatderes 2 7936 0 0 /news/goldbergquitsbromley 1 2971 0 0 /news/margate0-2craywanderers-weshouldbehigheruptheleagueadmitsmargatebossiainoconnell 1 6421 0 0 /news/craywands180119 3 13242 0 0 /news/deal100818 2 6667 0 0 /news/bromley211016 3 10113 0 0 /news/uckfdart220918 3 30405 0 0 /news/punjab250920 9 38828 1 1 /news/FAVaseStatement060720 4 13161 1 1 /news/themovetoramsgateisjusttobettermyselfsaystomparkinson 3 15777 0 1 /news/ryman/bromley/25thsept03.html 1 0 0 0 /news/bearsted280719 4 16098 0 0 /news/wellingunited3-1afchornchurchpennockbeatingurchinsisagreatresultforus-exclusive 2 12015 0 0 /news/551a97985c314 2 8844 0 0 /news/sheppeyunited300819 3 14538 0 0 /news/southhern050418 1 9518 0 0 /assets/fileman/images/filetypes/ 5 7386 0 0 /news/iwanttotakehytheuptotherymanleaguesaystakaloo 1 5201 0 0 /news/krisbrowning280819 5 16535 0 0 /news/pre-season2017 3 23613 0 0 /news/idontreallywanttobestuckinthekentinvictaforthenextfiveyearssaysseanglover 2 9830 0 0 /news/ramsgate1-3bromley-wardslamsrefovercostlyblunders 2 12979 0 0 /news/ourbiglocalderbyagainstwhitstablearealwaysgoodtobeapartoffsayshernebayssamdenly 2 8906 0 0 /news/punjab290319 4 14278 0 1 /news/chatfav211116 2 16368 0 0 /news/551a95b45ea6d 1 4344 0 0 /news/drmartens/eastern/folkestone/folkvash261203.html 1 0 0 0 /news/tonbridgeangels1-4dartford-ijusttoldthemtobelieveinthemselvesrevealedburman 2 15267 0 0 /news/fiskwantstoturnreachfieldsbackintoafortress 1 3972 0 0 /news/551bc5df5c76f 1 4509 0 0 /news/HarrVCD240315 4 58845 1 0 /news/kentleague/sladegreen/hernebay091004.html 1 0 0 0 /news/crayvhyth260404.html 1 0 0 0 /news/551a956b643fa 1 4803 0 0 /news/wehavetomakesureweturnupanddoourselvesjusticeagainstlutontownsaysjamieday 2 10060 0 0 /news/jenkinsadmitswereuneracheivingandweshouldbehigherinthetable 1 5057 0 0 /news/551bc5e4a8b70 2 8774 0 0 /news/chathamtown0-4waltoncasuals 1 4737 0 0 /news/abbottkeentomakeupforlosttime 2 8071 0 0 /archive-2006-2014/14 2 9653 0 0 /news/garystevensmyplansfortunbridgewells 1 5028 0 0 /news/mypersonalambitionsaretomakeitallthewaysays20-year-oldbosssammacneil 1 5666 0 0 /news/drmartens/eastern/ashford/22ndnov04.html 1 0 0 0 /news/ebbsfleetunitedcalltheshots-weregoingtowembley 1 2618 0 0 /news/maidstoneunited1-2dartford-burmanwevestartedtobelieveinourselvesagain 1 4913 0 0 /news/holdertobeskipperofasuccessfulfavershamtownsidewouldbeagreathonour 4 23880 0 0 /news/551a96db43fb9 1 3432 0 0 /news/kentleague/hythe/2ndaug04.html 1 0 0 0 /news/thamesmeadtownwait12weeksforplanningpermissiontobuildtheirmini-dartford-exclusive 1 4316 0 0 /news/whitstabletownunveilpeternottastheirnewmanager 1 4434 0 0 /news/1stjuly03.html 1 0 0 0 /news/kentleague/ramsgate/ashfordu18vramsgateu18.html 1 0 0 0 /news/wejustneedtoturnupandplaytoourbestsaysdoverathleticdefenderollieschulz 1 3840 0 0 /news/england270616 3 15056 0 0 /news/craywands130318 1 4070 0 0 /news/congratulationsramsgatefootballclubrymanleaguecupwinners2008 1 2572 1 0 /news/bromley260617 2 9637 0 0 /news/dockerscupheroeswehavenothingtofearsaystompkins-exclusive 1 4877 0 0 /news/2ndjune04.html 1 0 0 0 /news/551a9c9163138 1 4249 0 0 /news/kentleague/ramsgate/21stjuly04.html 1 0 0 0 /news/sladegreen0-4whitstabletown-whitstablemoveonestepclosertoryman 1 3572 0 0 /assets/select2/src/scss/_single.scss 1 466 0 0 /news/9thjuly03.html 2 0 0 0 /news/daywantstostartpre-seasontrainingwithatleast12players 1 3365 0 0 /news/ebbsfleetunitedtarget1200fansforearlykick-off 1 3903 1 0 /news/551a97b112dd2 3 13812 0 0 /news/everythinghereisreadyforbluesquarefootballsaysdoverchairman 2 9937 1 0 /news/kentleague/beckenham/westwickham271104.html 1 0 0 0 /news/hythetown250416 4 23317 0 0 /news/bromleyrogerjohnson130518 5 27168 0 0 /news/aldebrom200218 4 34958 0 0 /news/551a9c91c4c24 1 4179 0 0 /news/bearspag100916 2 19118 0 0 /news/trottcontemplatessteppingdownfromplaying 1 3474 0 0 /news/fisher0-6afccroydonathletic-allicandoistotallyapologisesaysfisherbossbillywalton 5 47937 0 0 /news/vcdeast050116 4 37428 1 1 /assets/fileman/php/copydir.php 1 45 0 0 /news/whitstabletownoperateonasoundfinancialfooting-brownett 1 4031 0 0 /news/visittonewstadiumhelpsstrikerstaywithdarts 1 3383 0 0 /news/quinnisourcaptainmarvelsaysseager-exclusive 2 10316 0 0 /news/warrilowtargetshomeplay-offsemi-final 2 9774 0 0 /news/wevecomeanawfullongwayinaveryshortspaceoftimesayscanterburycitybosssimonaustin 2 8437 0 0 /news/paulfoley100420 34 283740 27 26 /news/551a95b36e8b4 2 8870 0 1 /news/22ndaug05G.html 4 0 0 0 /news/brodstairsmergewithramsgatetogivelocalplayersthebestopportunitytofulfiltheirpotential 2 7073 0 1 /news/21stnov05.html 1 0 0 0 /news/bashley011005.html 2 0 0 0 /news/letsplayourparttobringfisherbackhometoend10-yearexile 4 17162 0 0 /news/9000raisedforsewell-dartsapproachinvictadefender-invictainsisttheypaytheirteam 1 4298 0 0 /news/bearsapm200416 3 29304 0 0 /news/northwood190205.html 2 0 0 0 /archive-2006-2014/129 5 23743 0 0 /news/ryman/bromley/hampvbrom210204.html 1 0 0 0 /news/drmartens/premier/dover/4thfeb04.html 1 0 0 0 /news/551bc99c93e61 1 5255 0 0 /news/baldacchinoweneedthatluckybreaktokickstartourseason-exclusive 1 3609 0 0 /news/kentleague/tunbridgewells/20thsept04.html 1 0 0 0 /news/dartford210220 2 6424 0 0 /news/weretreatingbearswithrespectsaysmoore-exclusiveinterview 1 5060 0 0 /news/bromley281019 5 20047 0 0 /news/whitstable020220 2 7378 0 0 /assets/ckeditor/plugins/Thumbs.db 1 6144 0 0 /news/soccershortswhitstabletownunveilashleymillersarrival 2 15400 0 0 /news/wellbedoingourhomeworkonringmersayserithtownassistantmanagerraypowell 2 8912 0 0 /news/lastseasonsheartbreakwillspurusonsayswhitesdefendercloke-exclusiveinterviews 1 3770 0 0 /news/551a979a9cd34 1 4958 0 0 /news/ournewchairmanisntgoingtopumploadsofmoneyintotheclubsaysjohncumberbatch 7 37173 1 0 /news/greenseven010116 3 14040 0 0 /news/551a9c92e5865 3 21215 0 0 /news/elmsteadareembarkingonafive-yearambitiousdevelopmentplansaysfabiorossi 6 22532 0 0 /news/glebling080519 3 25377 0 0 /news/bhtvsitt140204.html 2 0 0 0 /news/longhurstsdeparturesparksreturnofrespectedduo 2 6115 0 0 /news/551a97b1e3733 1 5364 0 0 /news/fisher01112019 3 10314 1 1 /news/harlow271104.html 1 0 0 0 /news/whitstablevdeal250803.html 2 0 0 0 /news/facupspecialstonesconfidentastheybidtoplaythebigboys 1 3961 0 0 /news/othernews/SECWFL210304.html 1 0 0 0 /news/werenotoverthewhitelineyetsayshernebaybosssimonhalsey 1 4117 0 0 /news/weneedfourwinsfromourlastsevengamestosecureplay-offplacesayswingsbossjamieday 1 4094 0 0 /news/551a9798277b1 2 6400 0 0 /news/sundayrepresentsanopportunitytoputadifficultweekbehindussaysfavershamtownbossturner 5 22107 0 0 /news/sevenoaks171217 2 8661 0 1 /news/Ebbsfleetgreenlight090415 4 14985 0 0 /news/blyspartans0-0suttonathletic-wevenotlostthetitletodaysaysblyspartansbossmatthume 1 7986 0 0 /news/paulegan280620 2 6472 0 0 /news/551a979a87b13 1 4424 0 0 /news/wemustcutoutindividualmistakes-daish 2 7286 0 0 /news/vcdathletic3-0erithtown 2 10011 0 0 /news/whitstabletownunveilthearrivalofformersittingbournestrikerryangolding 4 16898 0 0 /news/gillingham031019 5 16001 0 0 /news/othernews/youthleaguetables020204.html 1 0 0 0 /news/wewilltakethegametothempromiseshessenthaler 1 5210 0 0 /news/wewanttodevelopyoungerplayerssayskentfootballunitedbosssammacneil 4 19209 0 0 /news/bromleyrecallstrikerpaulvinesfromhisloanspellatmaidstoneunited 1 4139 0 0 /news/rochbans180815 16 355462 11 9 /news/551bc99a65284 3 11164 0 0 /news/551a97981e6b0 1 3275 0 0 /news/bromley1-2concordrangers-weweresecondbesttonightineverydepartmentadmitsmarkgoldberg 2 15229 0 0 /news/iwanttobemakingthefinaldecisionssaysdarrenanslow 3 15782 0 0 /news/bedfordtown2-3maidstoneunited-itwasnotaclosegameitwasmorecomfortable-jaysaunders 3 17918 0 0 /news/werecashstrappedandthecoffersarebare-ebbsfleetunited 2 7602 0 0 /news/craywanderersbossianjenkinsreachesmilestone 4 24733 2 1 /news/15thnov05A.html 1 0 0 0 /news/TheBromleyBoys231018 3 17544 0 0 /news/dover030816 9 78873 3 5 /news/551a931e0d453 1 2812 0 0 /news/harestacticalmasterstrokepaysofffortitlechasingdover-exclusive 3 22442 0 1 /news/551a979882f7c 4 18413 0 0 /news/kingstonian221105.html 2 0 0 0 /news/everyoneslookingforwardtoplayinggillinghamsaysashfordunitedbosspaulchambers 6 20995 0 0 /news/kentleague/sevenoaks/aldershot280904.html 1 0 0 0 /news/17thjune05.html 2 0 0 0 /news/wellgetourfeetfirmlybackonthegroundsayshernebaybosssimonhalsey 1 3985 0 0 /news/551a9cf50c054 2 10460 0 0 /news/wingate&finchley101205.html 2 0 0 0 /news/uckfield200919 4 17878 0 0 /news/payeflamingo100515 6 52685 2 2 /news/551a9250aba32 4 14606 0 0 /news/551bc5e2bd220 1 3327 0 0 /news/551bc5dbabaf6 3 13817 0 0 /news/bromley3-1gillingham-itwasmenagainstboyssaysbromleybossmarkgoldberg 2 19162 0 0 /news/maidstoneunited101220 2 9974 0 0 /news/vcdathletic3-1withamtown-wevegivenourselvesachancetowintitlesaystonyrussell 4 42882 0 0 /news/dulwmetp210215 3 21434 0 0 /news/farnieiwantthesamecommitment-exclusive 1 4207 0 0 /news/wewanttofinishashighaswepossiblycansayshernebaybosssimonhalsey 2 10246 0 0 /news/sevencant130118 3 36647 0 0 /news/tonbleat020216 5 68743 1 1 /news/bromley081119 9 123721 4 6 /news/17thnov03.html 1 0 0 0 /news/551a979b0f766 2 10046 0 0 /news/551a99e393373 1 4207 0 0 /news/sevebark160719 3 26835 0 0 /news/kfu040718 4 14790 0 0 /news/TheFAStatement060420 5 19397 0 0 /news/craywalt010518 1 11414 0 0 /news/551a979a08d3c 2 9819 0 0 /news/sandemanjoinstunbridgewellsmanagementteam 2 11376 0 0 /news/vcdfav2087 1 11002 0 0 /news/twokentsidesmovetorymanonenorth-exclusive 2 9949 0 0 /news/sittingbourne250915 3 11469 0 0 /news/tunbridgewells020819 4 14055 0 0 /news/soccershortswellingunitedsharesupforgrabsfor450each 1 7695 0 0 /news/551a9798c6d6f 2 9689 0 0 /news/thefacarlsbergtrophyfinalebbsfleetunited1-0torquayunited-fleetbringthetrophyhome 1 5682 0 0 /news/iwanttocontinuethegoodworksetoutbyrobpalmersaysconeyhallbosschristucker 4 16385 0 0 /news/kentleague/hernebay/hernevafcwimfav181003.html 1 0 0 0 /news/ashford081217 1 3939 0 0 /news/faversham211119 4 13988 0 0 /news/theleagueisoutofourhandsnowadmitshuntley-exclusiveinterviews 2 10076 1 0 /news/abbottwantstokeepgoodmannersatbournepark-exclusive 1 4952 0 0 /news/551bc99c2abb6 1 5347 0 0 /news/oboyleaddsyouthandexperiencetohissquad 1 3351 0 0 /news/nodisrespecttothelondoncupbutpromotionisourprioritysaysianjenkins 1 4874 0 0 /news/seagerreflectsonahistoricyearforwhitstabletown 2 9836 0 0 /news/daishurgesallkentfanstowatchhisside-exclusiveinterview 3 14138 0 0 /news/soccershortsabbottclaimshedidntswearatthelinesmanafterpowerscontroversialgoal 2 12487 0 0 /news/551a97b0c9a92 3 20778 0 0 /news/vcdathletic270119 3 10962 0 0 /news/charlton141116 3 10307 0 0 /news/551a96789b78b 1 5017 0 0 /news/yorathitwasembarrassing 2 8118 0 0 /news/551bc5dff1951 1 3735 0 0 /news/snodland031117 3 10971 0 0 /news/551a931e403a0 2 7938 0 0 /news/kentleague/whitstable/19thnov04.html 1 0 0 0 /news/551a931e6eb02 1 2940 0 0 /news/cultheroratchfordreturnstofootball 2 8264 0 0 /news/bromley071218 3 10611 0 0 /news/dartfordleftinthedark 2 7933 0 0 /news/551a9718e9ed0 4 18065 0 0 /news/kentleague/tunbridgewells/13thaug04.html 1 0 0 0 /news/drmartens/eastern/ashford/20thoct04.html 1 0 0 0 /news/551a9c92ace77 2 7090 0 0 /news/chathamhopingitsthirdtimelucky-exclusive 1 3911 0 0 /news/24thnov05.html 1 0 0 0 /news/cvalwing180215 3 23045 0 0 /news/daviesquitsderestoseekfreshchallenges 2 7381 0 1 /news/kentleaguecupfinaltompkinsplayingcareerendsonahigh-note-exclusive 1 5281 0 0 /news/farnobg200516 2 7510 0 0 /news/wembleywinnersweregettingbacktonormalitynowsaysfleetsecretary 2 7416 0 0 /news/maidvslade251003.html 1 0 0 0 /news/coribeck180220 4 50244 0 0 /news/phoenix301016 1 4560 0 0 /news/tonbridge260216 4 17105 0 1 /news/cugleymakeschangesforhamptonsvisit 2 8208 0 0 /news/rookiemanagerprovesdoubterswrong-exclusive 1 3304 0 0 /news/drmartens/1stnov03.html 1 0 0 0 /news/daishunveilsbarrettsigning 1 3138 0 0 /news/551a979b09d2f 2 9830 0 0 /news/sevenoaks181015 3 11634 0 0 /news/551a9c92105a0 2 10366 0 0 /news/ebbsfleet071118 4 13421 0 0 /news/551bc5df90e10 2 7768 0 0 /southern-counties-east-football-league/28 11 54244 0 0 /news/551a956b7b94e 2 6024 0 0 /news/551a979ad1ab1 1 4937 0 0 /news/helpusbecomeanestablishedrymanleaguesidesayschathambossmiles-exclusive 2 9218 0 0 /news/551a925036de5 3 10760 1 0 /news/551a9798ebb4a 3 16029 1 0 /news/burmanbringsnormantoforwardthinkingdarts-exclusiveinterview 3 12161 0 0 /news/sittingbourneturndowntakeoverbidbutlaunchfootballacademy 2 10762 1 0 /news/charliesheringhampenstwo-yearcontractwithebbsfleetunited 4 15818 0 0 /news/551a9c92912ed 3 15091 0 0 /news/cantbigg240219 6 58766 0 0 /news/maidstoneunited4-2godalmingtown-weveshowngoodcharactertocomebacksayssaunders 1 6614 1 1 /news/erithbelvedere2-0ashfordtown-imfindingrymanfootballhardadmitswhincup-exclusive 1 6998 0 0 /news/soccershortswewillrunebbsfleetunitedinafinanciallyresponsiblemannersayspetervarney 6 63494 0 0 /news/crowborough090720 3 9112 0 0 /news/policewelcomestrikeramoako 3 9134 0 0 /news/551bc99c1f14a 1 4034 0 0 /news/erithandbelvedere300819 3 11109 0 0 /news/cugleywantstowinramsbattle 1 6234 0 0 /news/wellingunited2a1bromley-itsridiclouswecantbringinthekidsfumesbarryashby 1 7924 0 0 /news/fisher090619 4 14246 0 0 /news/weshouldbeathollandsblaircomfortablysaysconfidentbeckenhamcoachjasonclews 1 3850 0 0 /news/holmesdale2-4ashfordunited-itsnotevenworthtalkingaboutthetablesayspaulchambers 2 17777 0 0 /news/emilysawyer240320 3 9991 0 0 /news/cugleyexpectedtodraftinwork-experiencepair 2 8738 0 0 /news/myhurtplayerswanttoputthingsrightsaysburman 2 8015 0 0 /news/threebridges0-0ramsgate-idontwanttheseasontofinishonawhimpersaysjustinluchford 2 16457 0 0 /news/sevenacresidcup1-2suttonathletic-cupdoublewillmakeitagreatseasonsaysjamietodd 4 38688 0 0 /assets/uploads/content/Sevenoaks_Town_Greatness_Park_Ju.htm 1 87438 0 0 /news/tunbridgewells210320 3 12470 0 1 /kent-county-league/8 5 35505 1 1 /news/itremainsourintentiontoappointanambitiousandsuitablequalifiedpersonsaysgaryjohnson 1 4018 0 0 /news/drmartens/eastern/fisher/12thmar04.html 1 0 0 0 /news/bromley230705.html 3 0 0 0 /news/bromley260216 3 13815 0 0 /archive-2006-2014/271 2 8466 0 0 /news/youhavetobeasprofessionalasyoupossiblycanbeatthislevelsaysdarrenanslow 3 15766 0 0 /news/cugleyrockingaboutpipertransfer-exclusive 1 4607 1 0 /news/tonbridgeangels210320 2 8678 0 0 /news/sixrecentdepartureshavehitushardadmitslarkin 2 7009 0 0 /news/iwanttotakedoverupsayswhite 1 4267 0 0 /news/9thnov05.html 1 0 0 0 /news/tunbridgewells6-1farnhamtownfarnieasksfansformoreemotion-exclusive 3 30622 1 1 /news/soccershortsnevillesouthallbringsthefacuptomargate 2 11555 0 1 /news/ksports281016 4 15234 0 0 /news/bromley110720 2 8346 0 0 /news/ramsgate231219 3 12461 0 0 /news/drmartens/premier/dover/13thoct04.html 1 0 0 0 /news/cugleycashwillbespentonthepitchduringthesummer 2 10720 0 0 /news/wehaveunderachievedconsideringthesquadwehaveadmitschathamtownbosskevinwatson 1 3460 0 0 /news/551bc99a63087 3 10148 0 0 /news/15thnov05.html 1 0 0 0 /news/scoutssearchforkentishtalent-exclusiveinterviews 1 5607 0 0 /news/sittingbourne2-2leatherhead-bradytakentohospitalfollowingfreakheadinjury 1 5188 0 0 /news/erithtown11062018 2 7734 0 0 /news/dover150618 3 12573 0 0 /news/sladegreen041005.html 1 0 0 0 /news/margate010917 1 3479 0 0 /national-league/6 5 37806 2 1 /news/erithtown020715 4 22133 0 0 /news/551a956c4a35d 3 12237 0 0 /news/theweekahead-14 1 3098 0 0 /news/ramsgatesplayerdevelopmentprogrammegetsunderway 6 21283 0 0 /news/sittingbourne250420 3 9910 0 0 /news/erithtown020518 2 7121 0 0 /news/ashframs261119 6 69168 0 0 /news/551bc5e2a6e61 2 9970 0 0 /news/drmartens/eastern/folkestone/folkestone.html 2 0 0 0 /news/fatrophyspecialwemustkeepfocusedineverygamesayswalker 1 4237 0 0 /news/551a96dc64aa4 4 17150 0 0 /news/551bc99e10c89 1 4370 0 0 /news/551a956c61d5a 1 5390 0 0 /southern-counties-east-football-league/41 4 19049 0 0 /news/kingstonian1-2ramsgatewardno-oneatramsgatecanscoregoalslikemoexclusive 2 11689 0 0 /news/23rdmar04.html 1 0 0 0 /news/30thjuly03.html 1 0 0 0 /news/wingsextendlinkswithpremiershipneighbours 3 11317 0 1 /news/wehavetobeatourabsolutebesttogetanythingagainstmargatesaysrayturner 1 4704 0 0 /news/ware2-1thamesmeadtown-meadsufferlateheartbreakonrymandebut 1 4000 0 0 /news/erithbel201017 3 12834 0 0 /news/itwillbegreatforsevenoakstowntowinthebiggesttrophytheyveeverwonsaysdarrenanslow 1 5819 1 0 /news/ashfordtown0-1metropolitanpolice-weveachanceofcatchingthesidesaboveussayslovell 2 9397 0 0 /news/maidstoneunited4vcdathletic0stroutsplatformforstonesfootballleaguereturn 1 5405 0 0 /news/551bc5e259c36 3 11750 1 0 /news/551a96db418ba 4 14494 0 0 /news/harrow280804.html 2 0 0 0 /news/faversham070220 3 11705 0 0 /news/glebe201017 1 3567 0 0 /news/chairmanbenwestmancotthailsfishersgreatestvictory 4 31042 0 0 /news/supportersplantoresuscitatesunkenfish 1 3286 0 0 /news/tunwells030317 1 4150 0 0 /news/sevenapm080116 5 18277 0 0 /news/vcdathleticpmaidstoneunitedp 2 5246 0 0 /news/ramsgate050420 3 10103 0 0 /news/folkestone060516 4 16329 0 0 /news/sittingbourne1enfield0 1 4339 0 0 /southern-counties-east-football-league/37 3 14246 0 0 /news/551a9c0e85a63 1 3911 0 0 /news/wevegottostartmakingwhitstableabitofafortresssaysbossjustinluchford 2 7837 0 0 /news/wedbearealassettothekentleagueinsistsfavershamboss 1 4652 0 1 /news/wecanstillkeepimprovingsaysdoverathleticbossnickyforster 2 8624 0 0 /news/551a967870bc6 1 3775 0 0 /archive-2006-2014/99 1 5031 0 0 /news/ashfordtown2-3fleettown-lovellruesbeveneyredcardandcostlymistake 2 12296 0 0 /news/551a9250cca0b 1 3961 0 0 /news/wellgetoutofourstickyspotinsistsfrancis 1 3954 0 0 /news/newboysforcedtositonsidelinesforwingslucrativecurtainraiser 1 4712 0 0 /news/doverathletic281119 3 10490 0 1 /news/dartfordputfatrophytieback24hourstobeatbigfreeze 1 3051 0 0 /news/doverswoopforprolificstrikercooper 3 10591 0 0 /news/551bc99ccd261 1 5845 0 0 /news/beckenham230720 4 16282 0 0 /news/lewisham271115 4 16665 0 0 /news/someonewilltakeahugebeatingfromuswarnsobrien 1 3782 0 0 /news/crayvalley121115 3 13428 0 0 /news/cablebrothersarestayingputinsistsmcmahon 1 3394 0 0 /news/wehavenothingtofearinsistsfrancis 2 9397 1 0 /news/dealtown041220 2 8840 0 0 /news/signinganewstrikermighttakeabitoftimesaysdartfordbosstonyburman 1 4266 0 0 /news/551a956bc69be 2 7414 0 0 /news/gillingham260419 3 9411 0 0 /news/frozenfebruarystrikesanothervictim 1 3596 1 0 /news/hessenthalerbringsinsecondbarnetyoungsteronloan 1 3687 1 0 /news/itsmyjobtogivefisheritspridebacksaysbillywalton 5 28545 0 1 /news/soccershortsdoverstarclokepensnewtwo-yeardeal 2 18927 0 0 /news/lordswoodisaniceplacetobeatthemomentsaysbossjasonlillis 2 8432 0 0 /news/chatham270917 1 3296 0 0 /news/wevehadturmoilattheclubwithalossofasponsorsaysthamesmeadtownbosskeithmcmahon 3 13196 0 0 /news/drmartens/eastern/folkestone/northwood161004.html 1 0 0 0 /news/lyddpunj010918 4 54190 0 0 /news/walkertellshissidetostayclearofrelegationzone 2 7697 0 0 /news/drmartens/eastern/erith&belvedere/15thaug04.html 1 0 0 0 /news/itshardforakentsidetogetoutofthisleaguesayshythetownbossscottporter 3 12089 0 0 /news/beckenhamtown0-1westwickham-itdoesntgetanylowerthanthisadmitshuntley 2 15082 0 0 /news/transferdeadlineday310120 2 17974 0 0 /news/illbedisappointedifwerenotinthetoptwoattheendsayscharltonbossdarrenphillips 4 38487 2 1 /news/chathamtown2-0craywanderers-werelowonconfidenceatthemomentadmitsjenkins 1 6171 0 0 /news/releasedplayersonthemarketlookingfornewclubs 1 3313 1 0 /news/551a979996bea 1 4691 0 0 /news/dartfordstarsditchtheirfootballbootstoplaycricket 1 4027 0 0 /news/tunwells101205.html 1 0 0 0 /news/braithwaitewilladdpositiveimpression 2 6680 0 0 /news/wetrulybelievewecanfinishinastrongpositionsayselthampalacescharliemccarthy 3 10606 0 0 /news/thurrockawaywasoneofourbestawayperformancesreflectshessenthaler 1 3386 0 0 /news/drmartens/eastern/ashford/11thdec03.html 1 0 0 0 /news/rusthall140719 2 6528 0 0 /news/erithbelvedere0-4fisherathletic 1 5519 0 0 /news/thamescray121015 4 41358 0 0 /news/wellingunited130121 5 24696 1 1 /news/suttonunited3-2margate-keisterdidnotswearatthereferee-insistsyorath 1 6748 0 0 /news/kentleague/sevenoaks/14jan04.html 1 0 0 0 /news/ksports280816 3 15822 0 0 /assets/uploads/content/Neil_Smith_celebrates_FA_Cup_win%20-%20Copy%201.html 1 44640 0 0 /news/pioneerstunbridgewellspondersyntheticpitchatculverdenstadium 2 10636 0 0 /news/551a96db93f89 2 11262 0 0 /news/ryman/bromley/bromvmarl171203.html 1 0 0 0 /news/humegivesyoungstersachancetoprovetheirworth 1 4144 0 0 /news/551a97b059c5c 1 3878 0 0 /news/chatham170117 1 4145 0 0 /news/gillsatwembleyroycesettobowoutonanall-timehigh 2 7584 0 0 /news/wardadmitshewaswrongtoberaterefereefollowinglatepenaltydrama-exclusive 4 15729 0 0 /news/dartford0-2doverathletic-moorestrikesqualityintokentishpride 1 7196 0 0 /news/maidstoneunited0-2heybridgeswifts-theplayersleteveryonedownslamshume 2 8878 0 0 /news/mywifehastoldmetotakethewhitstablejobsayslane 2 9795 0 0 /news/balrust09082019A 5 42737 1 0 /news/ramsgate3-2harlowtown 2 7600 0 0 /assets/smartmenus/libs/demo-assets/ 5 2245 0 0 /news/whitstableisacompetitivegameandagamewellbelookingtowinsayshernebaybosssamdenly 4 17773 0 0 /news/551a925084716 5 35836 1 1 /news/hernebht140315 5 39567 0 1 /news/tonyrussellisnotgoingintotherymanpremiertobeanalso-ransaysvickerschairmangaryrump 5 46503 1 1 /news/bromley120118 3 11106 0 0 /news/maidstoneunited0-3histon-wedidntdeservetoloselikethatsaysproudhume 1 5493 0 0 /news/bromley170120 2 10736 0 0 /news/crayrams251118 3 31872 0 0 /news/30thjune05.html 1 0 0 0 /news/crayvalacre190715 4 43054 0 0 /news/othernews/SECWFL180104.html 1 0 0 0 /news/551bc99ad7291 1 6494 0 0 /news/ithinkwereaheadofscheduleadmitsvcdathleticbosstonyrussell 1 4321 0 0 /news/erithbel090217 1 4453 0 0 /news/dartford4-1bromley-ineedtoputmystamponthisclubinthesummersaysbromleybossbird 1 8550 0 0 /news/robbinshythehasgreatpotentialexclusive 3 13624 0 0 /news/551a9250ef4fa 2 7218 0 0 /news/mysidewillbefiringonallcylindersinsistsfoley-exclusive 1 4771 0 1 /news/wecanonlygetbettersayscharltonathleticskipperjennynewman 1 4950 0 0 /news/folkestoneinvictabossneilcugleygoesintothenewseasonfearingtheworse 1 4627 0 0 /news/erithbel050317 1 4817 0 0 /news/craywands090218 1 4013 0 0 /news/hallsathletic050320 2 5992 0 0 /news/wellmaybegiveitagoodgonextyearsayssuttonathleticbossjamescollins 2 8686 0 0 /news/551bc5dbd47e0 4 15601 0 0 /news/cugleybringsinaustin 2 7898 0 0 /news/kingstonianhandtheinitiativeovertocraywanderers 2 10722 0 0 /news/weneedtokeepincontentionforaplay-offplacesayswellingstarjamieday 2 7171 1 0 /news/551a9798718b9 4 20630 0 0 /news/stevenshopefuloftyinguptunbridgewellsdeal 2 8568 1 1 /news/551bc5d9b0a72 2 6596 0 0 /news/mcmahonworkingonloverdeal 1 4379 0 0 /news/vcdathletic0-2afchornchurch-wecouldnthitabarndoorwithabanjoadmitstonyrussell 3 25955 0 0 /news/sctlew130317 4 47898 0 0 /news/stoptalkingaboutmybudgetsayswarrilow 2 10504 0 0 /news/551a9250d46d2 2 5881 0 0 /news/othernews/SECWFL080204.html 1 0 0 0 /news/warrilowmyaimistogetangelsflyinghigh-exclusive 1 5888 0 0 /news/findingtherightmanwhoisgoingtodelivertoourexpectationsisgoingtobedifficult-piper 1 3845 0 0 /news/leworp130517 3 31208 0 0 /news/canterbury120718 1 3325 0 0 /news/greenbeltlandisprecioustousinsistbromleycouncil 3 11546 0 0 /news/phoenixsports091020 2 7120 0 0 /news/greenwich030118 1 4076 0 0 /news/itwouldhavebeennicetobegivenlongertoturnthingsaroundsaysaxedkeithbird 3 15959 0 0 /news/ashfordunited260918 3 11970 0 0 /news/weveprovedwecancompetewiththebestteamssaysluchford 1 5090 0 0 /news/wellchar280317 1 10785 0 0 /news/AFCWimbledon121105.html 2 0 0 0 /news/holmesdalechairmanpleasegiveusthechancetoplaykentleaguefootball-exclusiveinterview 2 10112 1 0 /news/551bc5e736946 3 27083 1 1 /news/faversham310119 4 14346 0 0 /news/idontthinkwinningtheleagueisthebe-allandendallformesaysvcdbosstonyrussell 2 10710 0 0 /news/bromley270718 3 11094 0 0 /news/6thjuly03.html 1 0 0 0 /news/kennington141019 4 14198 0 0 /news/favstrike050715 4 15045 0 0 /news/gillingham2-1rochdale-jacksononthespotasgillsheadtowembley 1 5554 0 0 /news/scefl280517 5 24746 1 1 /news/551a97b137d6b 1 4452 0 0 /news/bromley090618 3 16623 0 0 /news/peckpunj290417 3 29294 0 0 /news/rochester181015 3 11232 0 0 /archive-2006-2014/107 1 5093 0 0 /news/guildford110904.html 1 0 0 0 /news/backingkenttowembleyvickersprepareforvaseshowdown-exclusive 2 9822 0 0 /news/thechairmanbacksus100witheverythingsaysgreenwichboroughbossianjenkins 2 10603 0 0 /news/551bc5e8859aa 2 8294 0 0 /news/daishwantstransferwindowscrapped 4 13826 0 0 /news/newstofollowherelater 1 2530 0 0 /news/tofinishintheplay-offswouldbeanunbelievableachievementsaysmcmahon 1 4494 0 0 /news/dulwichhamlet1-2leiston-itwasntgoingtobeourdayadmitstitle-chasinggavinrose 4 33392 0 0 /news/tonbridge021115 4 15960 0 0 /news/cugleybothramsgateandfolkestonehavedoneeversowelltogetwherewearenow-exclusive 2 10027 0 0 /news/wearecurrentlyinthetransitionofmovingtheclubtothenextlevelsaysjamescollins 1 4070 0 0 /news/dealtown291217 2 6745 0 0 /news/greeniesfridaypreview17thmarch2006 1 6609 0 0 /news/tilbury030105.html 2 0 0 0 /news/livecoveragedoverathletic1-0burgesshilltownresultdoverarechampions 1 8582 0 0 /news/yorathrueshissidesbadluck 2 9045 0 0 /news/whitstable241115 9 102531 5 5 /news/wecouldntcompetewithtonbridgesofferforharwoodsaysbutler 1 5271 0 0 /news/parkinsonweshouldhavealittlebitinourlockertoprogress 1 4429 0 0 /news/551a931e86ef7 4 21522 0 0 /news/theboyswillgettheirheadsdownandshowwhattheycandosayssittingbournebossgaryabbott 1 3877 0 0 /news/holmesdaleneedasugardaddytoprogressfurthersayscoachgrantwatts 2 10633 0 0 /news/erhunoztumerhasacquittedhimselfwellonhistrialatburnleysaysdulwichhamletsgavinrose 2 7542 0 0 /news/551a96790da41 1 6084 0 0 /archive-2006-2014/17 2 9624 0 0 /news/thamesmead090618 4 18394 0 0 /news/dartsvisittoashfordhasslimchanceofgoingahead 2 6088 0 0 /news/tonbbill290816 2 17232 0 0 /news/youvejustgottopinchyourselfsometimestoseewherewearesaysdartfordbosstonyburman 2 10658 0 0 /news/bromgoldberg150415 4 21193 0 0 /news/bromleyhaveanexcitingfutureaheadsaysnewlyappointedreserveteambosskeithbird 1 3978 0 0 /news/551bc99e2ff89 1 5620 0 0 /news/551a931e59554 1 4074 0 0 /news/othernews/SECFLTABS220204.html 1 0 0 0 /news/sladegreen080105.html 2 0 0 0 /news/newstofollowherelater-1 2 5062 0 0 /news/greenwichboroughbossstevefirkinsislookingforwardtohisfacupdebut 1 4745 0 0 /news/dulwich010516 3 11706 0 0 /news/drmartens/eastern/fisher/11thsept04.html 1 0 0 0 /news/coricant031118 5 70252 0 0 /news/drmartens/eastern/chatham/11thaug03.html 2 0 0 0 /news/6thnov05.html 2 0 0 0 /news/wingsshinethrough-exclusiveinterview 4 17722 0 1 /news/551a9677bb8f1 3 28228 2 1 /news/wecanhandlethepressureduringgamessaysburman 1 3568 0 0 /news/drmartens/eastern/fisher/7thdec03.html 1 0 0 0 /news/551bc5e01653f 1 3335 0 0 /assets/fileman/lang/cs1.json 1 3617 0 0 /news/bearsted280520 3 13817 0 0 /news/bearsted291217 2 7594 0 1 /news/kentleague/maidstone/3rdmar04.html 1 0 0 0 /news/theplayershaveexceededmyexpectationssayscugley 4 19313 0 0 /news/7thfeb05.html 1 0 0 0 /news/youllbefoolishtowriteusoffwarnstonbridgeangelsbosstommywarrilow 1 5772 0 0 /news/551a9cf4dcef0 1 3238 0 0 /news/551a956c3837c 3 12813 0 0 /news/northwoodrelishesdualfornumberonejersey-exclusive 2 8549 0 0 /news/ashfordtown3-3sittingbourne 1 4381 0 0 /news/551bc5e0337d7 2 13508 0 0 /news/rymanleaguepublishfixtures 1 4371 0 0 /news/greenwichborough0erithbelvedere1 3 10081 0 0 /news/thebigkickoffwemustliveuptoourexpectationssaysnewbosslangton-exclusive 1 3621 0 0 /news/22ndoct04.html 1 0 0 0 /news/othernews/24thjuly03.html 1 0 0 0 /news/wewantourlotterynumberstocomeupsaystitlechasingfrancis 2 9386 0 0 /news/bromkidd220915 4 35122 0 0 /news/otfordunited090520 2 6300 0 0 /news/551a96db99f47 1 3949 0 0 /news/wemustcreatehistorybyreachingthefavasewembleyfinalsayshernebaybosssimonhalsey 1 5606 0 0 /news/craywands220416 4 15701 0 0 /news/greenwich291216 1 3386 0 0 /news/weshouldbefightingforaplay-offplacesayshythetownbosstimdixon 5 19047 0 0 /news/fordsearchesforbigtargetman 2 7533 1 0 /news/ebbsmcmahon280415 4 14990 0 0 /news/25thsept03.html 1 0 0 0 /news/whyteleafe0-4erithbelvedere-ialwaysknewitwouldgodowntothewiresaysmickycollins 2 18470 0 0 /news/drmartens/eastern/chatham/8thdec03.html 1 0 0 0 /news/crowborough060418 2 6903 0 0 /news/tomphipppensnewcontractatebbsfleetunited 1 3744 0 0 /news/comeandsupportourpromotiondrive 1 3350 1 0 /news/sevenmaids160715 4 42798 0 0 /isthmian-league/42 4 18571 0 0 /news/fisherstatement291219 4 16904 0 0 /news/dartfordbosstonyburmanwantstoliftthefogonthethames 1 5593 0 0 /news/ifweapplyourselvesintherightwaywecancauseanupsetsaysramsgatebosstimdixon 3 12498 0 0 /news/tonbridgeangels4-1dartford-wecouldntlivewithtonbridgeadmitsburman 1 6565 0 0 /news/551bc5e8391bc 2 9308 0 0 /news/werekeepingourheadsabovewatersaysmargatedirector 3 26096 1 0 /news/craywanderers250321A 33 134234 9 15 /news/bromeast241015 6 108135 3 3 /news/drmartens/premier/dover/25thnov04.html 1 0 0 0 /news/ryman/bromley/14thdec03.html 1 0 0 0 /news/enfieldtown1sittingbourne1 2 9304 0 0 /news/fishphoe230118 3 32469 0 0 /news/551bc5e747ef2 2 10375 0 0 /news/seagerreachingfinalisicingonthecake 2 6048 0 0 /news/ashfordtown0-2merstham-lovelltakespositivestobuildon 1 6025 0 0 /news/551a9c9314711 2 13080 0 0 /news/beckenhamtown2-5sportingbengal-myworstresultinfootballadmitsshell-shockedjasonhuntley 2 15763 0 0 /news/windsor010105.html 2 0 0 0 /news/551bc99af15a9 2 11692 0 0 /news/graystonb060116 3 8967 0 0 /sittingbourne-2003-2006 12 36482 0 0 /news/weregoingtobeadifficultsidetobeatthisseasonsayshernebaybosssamdenly 3 11663 0 0 /news/wrexham3-2ebbsfleetunited-daishruessloppydefending 2 10721 1 0 /isthmian-league/39 2 9301 0 0 /news/wecanmixitwiththebestofthemsayshythetownbossscottporter 1 4050 1 0 /news/551bc99ba215f 1 8614 0 0 /archive-2006-2014/51 8 39243 0 0 /news/livecoverageerithtown1-0hythetown-dockerscelebratethankstocookowngoal 1 9028 0 0 /cray-2003-2006/ 1 3042 0 0 /news/idlovetohavegivenitacrackandtestedourselvessayshildenboroughbossandrewmakechnie 4 18672 0 0 /news/551a9678e9b23 1 6506 0 0 /news/wehavehadanoverwhelminglevelofsupporttocomehomesayscraywandererschairmangaryhillman 2 9162 0 0 /news/551bc5db98ca8 4 16557 0 0 /news/greenwich130805.html 2 0 0 0 /news/ryman/bromley/bromvslou100204A.html 1 0 0 0 /news/soccershortslordswoodputinsurprisebidtolandmuch-travelleddimmock 1 11026 0 0 /news/drmartens/premier/dover/7thjuly04.html 1 0 0 0 /news/drmartens/premier/dover/28thoct04.html 1 0 0 0 /news/youmustreadthis 1 3124 0 0 /news/soccershortsididconsiderhandinginmyresignationsaysfisherbossstevefirkins 1 9468 0 0 /news/fanshavebeenhithardinthepocketsayssittingbournessecretary 2 9013 1 0 /news/kentleague/deal/Sampson15.html 1 0 0 0 /news/kentleague/lordswood/26thsept04.html 1 0 0 0 /news/corinthiancasuals0-3ashfordtown 2 7984 0 0 /news/wearegoingforthetreble-seager 2 6830 0 1 /news/chatham020818 1 4316 0 0 /news/lewisham060917 4 15440 0 1 /news/tonbridgeangels180120 4 15776 1 0 /news/dartfordstrikerpoisedtosignfornorwich 1 3141 0 0 /news/ivelearntalotfromlovellandithankhimsaysdepartinglangton 1 4568 0 0 /news/tunwells011216 2 8151 0 0 /news/chathampitchintomaintaintheirrymanleaguestatus 2 7706 0 0 /news/551a956c9f786 1 3208 0 0 /news/craywanderers2-0burnhamramblers-wevegottoturnthisclubaroundsaysmichaelpaye 3 24945 0 0 /news/brentwoodtown1-1thamesmeadtown-wecameheretomakeushardtobeatsaysmeadbossmcmahon 2 28234 1 1 /news/wevehadtoworkhardtogettothestagewereatnowsaysvcdathleticsgeorgemitchell 2 11521 0 0 /news/albiebarkerquitsasdealtownboss 2 7356 0 0 /news/paulbowden-brownhascomeintopointtheclubintherightdirectionsaysmeadbosskeithmcmahon 1 4661 0 0 /news/551a99e41a77f 3 14655 0 0 /news/suttbeck201115 5 99773 2 2 /news/sladegreenunveiltheirnewmanager 2 6655 0 0 /news/kentcountyleagueannounceextendedsponsorshipdeal 6 24872 0 1 /news/9thapr04.html 1 0 0 0 /news/folkestonewanttoshineinfrontoftelevisioncameras 1 5407 0 0 /news/folkestoneinvicta1-0thamesmeadtown-welackedsharpnessadmitscugley 3 20434 0 0 /news/waltoncassitt041015 4 37597 0 0 /news/iwanttorepaythefaithshowninmebymakingderessuccessfulsayscollins 2 9045 0 0 /news/17thjuly03.html 2 0 0 0 /news/551a97b273c30 1 4974 0 0 /news/harrvbromlgecup181103.html 1 0 0 0 /news/gillingham6-1mkdons-itwasonewaytrafficsaysgillinghambossjamesmarrs 4 38222 1 0 /news/ryman/bromley/cpalace030804A.html 1 0 0 0 /news/lovellbringsleaderflanagantohomelands 1 3746 0 0 /news/beatingangelswasadelightadmitsgibbons-exclusiveinterview 5 21179 0 0 /news/bromley150421 89 382790 5 46 /news/craywanderers3doverathletic1 3 19316 0 0 /news/atrophyinthenextcoupleofyearswouldbetheicingonthecakesaysholmesdalechairmanharris 2 8972 1 0 /news/stagingmargatewasamassivelearningcurveforpromotionchasingwhitstable-exclusive 3 18430 0 0 /news/wearesuresittingbournewillbehappyintheirnewhomesayswoodstockchairmanmauricedunk 2 8024 0 0 /news/551bc5ddded5f 1 4069 0 0 /news/hastingsleftinthedarkasdartsbidforplay-offs 2 8794 0 0 /news/phoenixsports1-0erithbelvedere-ijusthopeourformlastsuntilaprilsayssteveoboyle 2 20270 0 0 /news/gravesendnorthfleet2-0graysathleticdeadlyduostrikeagainassixthplacedfleetshine 2 11092 0 0 /news/soccershortssittingbourneinviteapplicantsformanagerialvacancy 2 13017 0 0 /news/beckchat161019 4 50024 0 0 /news/croydonlookingforhomefriendly 6 17228 1 0 /news/551bc5e399360 1 4376 0 0 /news/nottbeginssearchforfirstteamcoach 2 7680 0 0 /news/taitisdesperatetoshowhisfullpotentialsaysburman 2 9403 0 0 /news/superpowersarsenalarecomingtochathamtoplaygillinghamladies 1 4087 0 0 /news/551bc5e14328f 1 3883 0 0 /news/KentFAStatement050620 4 19854 0 1 /news/craywanderers0-4ebbsfleetunited-iwantmooretrophiessaysdaish 1 7132 0 0 /news/specialyouthreportweneedtogivetheyoungstersachancetodevelop 1 7086 0 0 /news/wemustdevelopourownhomegrowntalentsaysjenner 2 9722 0 1 /news/slough031205.html 1 0 0 0 /news/dealtownrecognisepastcontributionsofexplayersandmanagerswithlifemembershipscheme 1 4152 0 0 /news/statattackleadinggoalscorersclubbyclub20102013 5 20788 0 0 /assets/ckeditor/plugins/colordialog/ 5 1822 0 0 /news/551a97b1916f7 1 4213 0 0 /news/wardwellrolloursleevesuptogoonanotherrunexclusive 3 13126 0 0 /news/whitstabletown3-2worthing-itreallyisgoingtobeadog-fighttotheendsayspeternott 1 7228 0 0 /news/welldonekeithyoudeserveditsayspromotedbossseager 2 9058 0 0 /news/551bc99d2d542 1 5781 0 0 /news/favershamtownunveilambitious25mredevelopmentplanstotransformsalterslane 1 3585 0 0 /news/weneedthewholesquaddoingtheirbitsaysnott 1 4305 0 0 /news/ebbsfleet230718 4 15693 1 0 /news/wehavenotbrokenthebanktolandhocktonsayshume 1 5519 0 0 /news/kentleague/beckenham/whitres040904.html 1 0 0 0 /news/michealeveritthasbeenatremendousservanttothisclubsaysfolkestoneinvictabossneilcugley 1 3817 1 0 /news/ivetoldthechairmanthatwerenotreadytogetpromotedsayssittingbournebossdannyward 2 8904 0 0 /news/dulwichhamlet050221 5 27120 1 1 /news/peckhamtown020519 3 12136 0 0 /news/tonbridgeangels1-2bishopsstortford-iapologisetoeveryonethatcameheretonight-warrilow 1 7017 0 0 /news/551a97b1ee2f9 1 4330 0 0 /news/wevejustdrawntoomanygamesadmitstonbridgeangelsbosstommywarrilow 3 13880 0 0 /news/ashvsitt240204.html 1 0 0 0 /news/551a96dc3f653 4 20538 0 0 /news/glebe230717 2 8755 0 0 /news/25thnov05.html 2 0 0 0 /news/canterburycity241219 4 15384 0 0 /herne-bay-2003-2006/ 1 3018 0 0 /news/wevegottowinourownmini-leaguetosurvivesaysyorath 1 3821 0 0 /isthmian-league/4 5 37750 1 1 /news/551a956c97753 4 15578 0 0 /news/resultsjanuary2009 2 11326 0 0 /news/wejustneedtokeepprogressingsaysthamesmeadbosskeithmcmahon 2 8838 0 0 /news/drmartens/eastern/folkestone/cheshunt131104.html 1 0 0 0 /news/ksports080917 4 13901 0 0 /news/tonbridgeangelsblock500kmysterytakeoverbid 2 9610 0 0 /news/whitstabletaketheirtimetogettherightperson 5 15538 0 0 /news/favershamunveilfournewsigningstostrengthensquad 2 10935 0 0 /news/welldoourlevelbesttoknockholdersoutsayslovell 1 4015 0 0 /news/bromley210517 3 13965 0 0 /news/551a9798b7001 2 8952 0 0 /news/wellingunited2-2dartford-wejusthavetogetoutofthisrutsaysdartfordbosstonyburman 3 27395 0 0 /news/folkestoneinvictahelptheheroes 1 3491 0 0 /news/conference/margate/31staug04.html 1 0 0 0 /news/551bc99b73419 1 3057 0 0 /news/ourlatestsigningswilladdcreativityandflairsaysfrancis 2 7846 0 0 /news/canterbury310517 2 7910 1 0 /news/4thjan05.html 1 0 0 0 /news/soccershorts170720 3 19753 0 0 /news/551a931e9cc9a 4 20818 0 0 /news/551a9678a6f59 1 5177 0 0 /archive-2006-2014/18 2 10042 0 0 /news/551bc99e33bc1 1 5546 0 0 /news/551bc5e31db52 2 7130 0 0 /news/cugleystrikersneedtoscorethegoals 3 14801 0 0 /news/551bc5e863180 2 6734 0 0 /news/551bc5e11baf7 1 2952 0 0 /news/sladegreenunveilfordastheirnewboss 2 9373 0 0 /news/kentleague/4thnov03.html 1 0 0 0 /news/transferwindowwillstopalltheseseven-dayapproachessayscroydonchairmandicksongill 3 15287 0 0 /news/erithbelvedere2-3chathamtown-weshowedalitltebitofresiliencesayskevinwatson 5 52422 0 0 /news/bromley230218 4 15826 0 0 /news/tonbridge040116 3 13848 0 0 /news/fiskwemustconcentratethroughoutifweretobeatvickersagain 2 9224 0 0 /news/folkestonemaketheirpointtoleagueleaders 1 5058 0 0 /news/551a931e27f87 4 18234 0 0 /news/nobodyexpectsustowinthekentleaguetitlenowsayserithtownbossjamescollins 2 10010 0 0 /news/shorts200515 5 39486 1 1 /news/vcdathletic0-2needhammarketaet-thequalitywasmissingadmitsfoley-exclusive 3 30316 0 1 /news/wereunderachievingattheminuteadmitscraywanderersbossianjenkins 3 12499 1 0 /news/sladevgreen140204.html 2 0 0 0 /news/ramsofferteenagepaircontracts-exclusiveinterviews 2 9692 0 0 /news/itwouldbenicetogetintotheplay-offzoneatthisstageoftheseasonsaysfavershamtownboss 1 4936 0 0 /news/551a956c896ef 1 3342 0 0 /news/chathamtown1barkingeasthamunited1 2 7104 0 0 /news/551a9799460df 2 12388 0 0 /news/clapton4-3bridonropes-wevehadsomeverypromisingmomentssaysgarylisney 3 25284 0 0 /news/drmartens/eastern/chatham/23rdjuly03.html 2 0 0 0 /news/maldon231104.html 2 0 0 0 /news/ithinkwevemadetherightmovesaysaylesfordpapermillschairmanbrianreynolds 1 4879 0 0 /news/sevenoaks311216 2 10690 0 0 /news/sevenoaksboundahwanpleasedwithmessagesofsupport 2 7934 0 1 /news/551a99e39e8c6 1 3511 0 0 /news/551bc5e611a53 1 5250 0 0 /news/greenwichboroughareapillarinthecommunitysaysoutgoingsecretary 2 7834 0 0 /news/takaloowefearnoone-exclusiveinterview 2 8604 0 0 /news/vcdathletic2-0walthamabbey-ithinkwevegotachancetodoitsaysvcdbosstonyrussell 1 8284 0 0 /news/beckenham170716 3 12648 0 0 /news/pitchero.com/clubs/afccroydonathletic 2 0 0 0 /news/Greevlord130104.html 1 0 0 0 /news/resultsaugust-september2011 2 22738 0 0 /news/14thnov05.html 1 0 0 0 /news/theresnootherkentleaguemanagerthatdoeswhatstevefirkinsdoessaysbillywalton 1 4094 0 0 /news/jenkinswantstoleadwandsintofirstround 1 4180 0 0 /news/holmesdale160317 4 17098 0 0 /news/551a931dafa21 1 3426 0 0 /news/wewanttogetthroughandgetoneofthosebigdrawsthateveryonedreamsaboutsaysjamieday 3 12852 0 0 /news/kentleague/thamesmead/greenwich170804.html 1 0 0 0 /news/crayrussell070515 4 13858 0 0 /news/marathonmanianjenkinscelebratestwentyyearsatcraywanderers 3 9684 0 0 /news/lewes250705.html 1 0 0 0 /news/551bc5dbeb0e9 1 3816 0 0 /news/welivewithinourmeansinsistsfavershamtownbossjustinluchford 1 5060 0 0 /assets/signpad/offline.html 1 186 0 0 /news/lordswood130619 4 13036 0 0 /news/wedlovetoseeabigcrowdbackingtheladssaysfisherbossstevefirkins 3 12602 0 0 /news/PMStatement230320 3 14893 0 0 /news/551a96db6fb30 2 9238 0 0 /news/heybridgeswifts2folkestoneinvicta0 2 8448 0 0 /news/551a967719a92 1 4145 0 0 /news/rusthlord261116 4 40925 0 0 /news/croydonath220917 1 3665 0 0 /news/weareenteringacriticalstageinfishershistorysayssecretarydanyork 3 13748 0 0 /assets/ckeditor/plugins/flash/images/ 1 374 0 0 /news/favershamtownplewishamboroughp 3 9323 0 0 /news/chathamtown3-2waltoncasuals-onegameatatimeforsurvivaldreamssayscaretakerbosswatson 1 6009 0 0 /news/chathamannouncepresentationnightdetails 1 2796 0 0 /news/punjab031117 3 10065 0 0 /news/erith147sports130615 4 18510 0 1 /news/hollands290617 1 3648 0 0 /news/thereareafewwellknownnamesonboardsayssevenacresidcupbosschristuley 1 4220 0 0 /news/erithbelvedere3-2beckenhamtown 2 9480 0 0 /news/551bc5e080561 1 5012 0 0 /news/wedidnotachievewhatwesetouttodolastaugustadmitsporter 1 3414 0 0 /news/wevealwayslookedupwardssaystonbridgeangelsbosstommywarrilow 1 4541 0 0 /kent-invicta-league/21 2 9472 0 0 /news/thisisalearningcurveforusinsomanywayssaysglebebossrockymcmillan 1 4841 0 0 /news/whitlanc230917 2 20936 0 0 /news/dulwich120617 2 7678 0 0 /news/ramsgate040620 2 6266 0 0 /news/sampsontostartextensivephysioprogrammetoaidreturnhome 2 6992 0 1 /news/erithglebe060818 1 8721 0 0 /news/injury-hitstonessigndefenderswattsandroyston 4 12828 0 0 /news/thebigkickoffthanetsidesaimtoupsetpremiergiants-exclusive 1 4741 0 1 /news/stonessettounveilnewfaceaheadofvisittobromley 1 3834 0 0 /news/becksprepareformeetingtoregainfaacceptance 1 3214 0 1 /news/dartscontinueperfectseasonontheroaddespitewanderersfightback 1 5859 0 0 /news/folkestone121017 2 8998 1 1 /news/horsham1tonbridgeangels0-dolbygoalscoringisamassiveproblemforus 3 14770 0 0 /news/27thnov03.html 1 0 0 0 /news/sctjoy091216 4 15762 0 0 /news/commentenglishfootballisinmourningoverworldcupdefeatstorussiaandqatar 1 3110 0 0 /news/eritsutt130519 4 42368 0 0 /news/12thmay04.html 4 0 0 0 /news/wemustclaimbraggingrightsagainsayswarrilow 1 4271 0 0 /news/drmartens/eastern/ashford/24thoct03.html 1 0 0 0 /news/szkearme050618 3 20366 0 0 /assets/fileman/php/deletedir.php 1 45 0 0 /news/551bc5da72e95 4 31073 1 0 /news/maidstoneunited240119 6 53646 5 5 /news/kentleaguechairwomanre-organisationisastepforward 3 13373 0 0 /news/saturdaysfacuptieatdartfordisamassivedayforbromleyfootballclubsaysmarkgoldberg 1 4433 0 0 /news/itsamatterofpickingupthepointsoverchristmassaysdartfordbosstonyburman 1 4935 0 0 /news/worfav300416 5 80112 2 2 /news/folkestoneinvictamustcleardebtsbeforetheycanmoveforwardsayschairmanmarkjenner 3 14170 0 0 /news/frometown231220 3 9897 0 0 /news/no-onecancatchwhitstableconceedsmcmahon-exclusiveinterview 2 9058 0 0 /news/erithandbelvedere050320 3 12020 0 0 /news/gillbemoansaboutlackoftrams-exclusiveinterview 1 4161 0 0 /news/larkfield140221 17 73473 3 5 /news/holmesdale041215 3 14079 0 0 /news/22ndfeb05.html 2 0 0 0 /news/ilikeitbecauseitsgotaringtoanicefacuptiesaystonbridgeangelsbosstommywarrilow 5 24146 0 0 /news/lifesabeachforrams 2 7938 0 0 /news/crockenhill150616 5 24533 1 1 /news/leyton1folkestoneinvicta1 5 42148 1 1 /news/551a9c919dfe1 2 11225 0 0 /news/fisher310818 1 3344 0 0 /assets/images/signpad/Thumbs.db 1 3072 0 0 /news/erithtownunveilenniogonnellaastheirnewmanager 3 9752 0 0 /news/jamieleggettleavesbexleyboroughforanewchallenge 6 43605 3 3 /news/dartfordincludedinenglands2018worldcupbid 2 7257 0 0 /news/lordswood031117 1 3712 0 0 /news/551bc5e4624aa 1 5128 0 0 /news/kentleague/sladegreen/tunwells191004A.html 1 0 0 0 /news/theroadtowembleyeverettsmellscupsuccessforhishome-townclub 1 4890 0 0 /news/551bc5dece9f3 2 7620 0 0 /news/551bc5e8ef4c2 6 63623 2 3 /archive-2006-2014/218 2 9124 0 0 /news/listenwellpickourselvesupinsistsdartfordbosstonyburman 1 4703 0 0 /news/whitstable281217 2 7749 0 0 /news/sittingbourne281016 1 3762 0 0 /news/margate090717 3 34776 1 0 /assets/select2/docs/vendor/ 5 1893 0 0 /news/551a931ddfdbb 1 3238 0 0 /news/fastatement240517 3 12236 1 0 /news/starstrikersrejectwellsadvances 1 3860 0 0 /archive-2006-2014/205 2 9380 0 0 /news/551a96dc6c69b 4 18290 0 0 /news/chairmanleadstributesforsadloss 1 3196 0 0 /news/551bc5e19e402 2 8068 0 0 /news/bromleyontheorientwereallhungrytosucceedsaysbromleyskippertutuhenriques 1 5439 0 0 /news/sevenoaks170416 4 15030 0 0 /news/ashfordunited200220 3 13967 1 0 /news/barnbrom081019 3 30629 0 0 /news/icertainlydontwanttofinishbottomsayscrayvalleybossstevechapman 1 4145 0 0 /news/27thjune05.html 1 0 0 0 /news/551a97b106c35 3 13662 0 0 /news/wellingunited181019 3 10051 0 0 /news/wevegotachancetogoallthewayinthefavasesaysgreenwichboroughassistantpaulblade 2 8498 0 0 /news/wevegottoseecharacteragainstbeckenhamsayssevenoaksassistantmartinbarnard 1 4015 0 0 /news/winningbreedsconfidencebutwereexpectingatoughgameateastthurrocksaysjaysaunders 3 15352 1 0 /news/551a9719002fc 4 18405 0 0 /news/imlookingforwardtoanewchallengeatambitioustunbridgewellssaysstrikerpaulbooth 2 9884 0 0 /news/isthmianleague150619 4 13912 1 0 /news/fcelmstead210119 3 11108 0 0 /news/otford230516 2 6990 0 0 /news/ebbsfleetunitedtakeoverdrawsastepcloser 6 19783 0 0 /news/551bc5e8610f6 2 6303 0 0 /news/chathamtown0-1worthing-iwantsomethingtoplayforsaysobrien 1 5695 0 0 /isthmian-league/8 6 45202 1 1 /news/551bc99d7c934 1 4410 0 0 /news/canterbury090218 3 11591 0 0 /news/ithinkwellholdourownandouraimistofinishashighaswecansaysdealbossderekhares 2 8428 0 0 /news/lewisham290615 3 9459 0 0 /news/4thmar05.html 2 0 0 0 /news/greenlew250317 1 9949 0 0 /news/werehappywiththewaythingsaregoingsaysholmesdalecoach 2 7180 0 0 /news/garlandkeepsfaithwithhistwomainstrikers-exclusiveinterview 4 18164 0 0 /news/wedlovearuninthefacupsayscorinthianbosstonysitford 1 3533 0 0 /news/551a979ab7095 2 35642 0 0 /news/wecanhandlethepressureandexpectationsayslovell-exclusive 1 4112 0 0 /news/erithandbelvedere170920 4 16274 0 0 /news/whitehousepensnewdoverdeal 1 3054 0 0 /news/551a979b20616 2 10895 0 0 /news/whitstable290105.html 1 0 0 0 /news/beckbren250919 3 29841 0 0 /news/kentleague/maidstone/7thjuly03.html 2 0 0 0 /news/wevejustgottogooutthereanddothebusinesssayspeckhamtownbossalanjacobs 1 5238 0 0 /news/551a931df11c8 4 16274 0 0 /news/cugleywecoulddowithalift 2 11686 0 0 /news/thefavaseisawinnabletrophysayshythetownbossscottporter 1 4393 0 0 /tier-football/2 11 38253 0 1 /news/fisher010816 3 13598 0 0 /news/sevenelms231116 4 39766 0 0 /news/551a96dc6731c 4 23978 0 0 /news/551a925111821 2 12718 0 0 /news/cantcray230319 8 92626 0 0 /news/tunbridgewellsunveilfutureplans 3 16577 0 0 /news/folkestoneinvicta0-1hitchintown-wepayourstrikerstoscoregoals-cugley 2 12748 0 0 /news/bromley170116 4 19469 0 0 /news/whitstablesnumberscomeononanightwheneverythingclicked 2 7604 0 0 /news/epsomgrav070816 4 38294 0 0 /news/drmartens/eastern/sittingbourne/sittvburn081103.html 1 0 0 0 /news/dartford1-3chathamtown 1 3941 0 0 /news/ashford170817 3 11745 0 1 /news/canterbuty180915 4 15240 0 0 /news/551a967869765 1 3365 0 0 /news/stansfeld110920 3 13598 0 0 /news/gravesend160705.html 2 0 0 0 /news/551a956cb44bc 1 4949 0 0 /news/vcd311218 3 12132 0 0 /news/551bc99a99301 1 4191 0 0 /news/sittingbourne2-1fleettown-wedesperatelyneedthecrowdstopayourbills-abbott 1 5591 0 0 /news/wellingtown020719 7 30654 0 0 /news/551bc5e0d0627 1 4225 0 0 /news/8thnov03.html 3 0 0 0 /news/jenkinspleasedwithemergenceofreservetrio 1 3939 0 0 /news/afchornchurch0-0dartford-burmansatisfiedwithboredraw-exclusive 2 11687 0 0 /news/551bc5e2ddc5f 2 8652 0 0 /news/rusthallleftinthedark 1 4477 0 0 /news/vcdaburg161119 2 20670 0 0 /news/551a956d028f0 1 5902 0 0 /archive-2006-2014/160 4 17200 0 0 /news/bromley3wealdstone2exclusiveinterview 4 22842 0 0 /news/wellhavethestrengthtowinkentleaguetitlevowscosgrove 1 3757 0 0 /archive-2006-2014/154 5 23122 0 0 /news/holmesdale080319 2 8180 0 0 /news/welltakewhitstableallthewayinsiststramschief-exclusiveinterviews 1 4737 0 0 /news/24thsept03.html 1 0 0 0 /news/whitesanddartsfansreceivepraise 2 8698 0 0 /news/ramsgate281119 2 7498 0 0 /news/551bc5e0e65cd 1 4314 0 0 /news/holmesdale190719 2 8766 0 0 /news/thamesmeadtown2-1concordrangers-itwilltakeanexceptionalsidetobeatussaysmcmahon 1 7836 0 0 /news/werestillfindingourfeetintherymanleagueadmitslilywhitesbossjustinluchford 1 4587 1 0 /news/margate1millwall1wewillbefitterbeforethestartoftheleagueseasoninsiststrott 5 29874 0 0 /news/551a956ba9848 1 4828 0 0 /news/7thAug05A.html 2 0 0 0 /news/otfordkenn310318 2 17824 0 0 /news/comment190117 3 12361 0 0 /assets/images/Thumbs.db 1 279552 0 0 /news/hessenthalerschargesturnonthelights 2 9316 0 1 /news/fisherbossgarylisneywantshissidetoshowprogression 2 6428 1 0 /news/551bc5da0bc8a 3 14030 1 0 /news/weregettingbetterinsistsfarnie-exclusiveinterview 2 7889 0 0 /news/bromley1-0dartford-wehadtoremoveacertainelementfromtheclubsaysmarkgoldberg 5 47815 0 0 /news/chathamtown1harlowtown1 4 15106 0 0 /news/ryman/bromley/lewesvbrom160304.html 1 0 0 0 /news/551bc5e89440b 3 11057 0 0 /news/cosgrovewantssteelfromhissidetoavoidthirdstraightcupexit 1 4553 0 0 /news/ashfordownerwelcomesstonesbacktohomelandsstadium 2 7433 0 0 /news/551bc5d9e8ffd 3 10727 0 0 /news/favershamtown2-2margate-imdisappointedthatwethrewawaytwoleadssaysrayturner 2 13068 0 0 /news/thamesmeadcompletedoubletransferswoop 6 23308 0 0 /news/551a97989cdb3 4 19906 0 1 /archive-2006-2014/281 4 17149 0 0 /news/beckenham250118 3 11231 0 0 /news/sittvburg170104.html 2 0 0 0 /news/woodstockfolding200415 4 13638 0 0 /news/lewisham140816 4 18470 0 0 /news/551a96782dade 3 12744 0 0 /news/itsabouttimewerewritetheclubshistorysaysbromleycoachneilsmith 3 21771 0 0 /news/hythetownsecretarymartingilesvoiceshispitchconcerns 1 3961 0 0 /news/wehavearesponsibilitytoplaythegameintherightspiritsayswhitstabletownsnickysouthall 2 8709 0 0 /news/fisher281116 3 13566 0 0 /news/erithbelvedere3-2gillingham-weveshownourloyalfanswerenotabadlittleside-ford 4 44720 0 0 /news/551a99e5155f5 1 6677 0 0 /news/brridon080917 4 14729 0 0 /news/hythetown0-1burgesshilltown-wegaveittothemonaplateadmitshythetownbosstimdixon 4 31001 1 0 /news/cray130805.html 1 0 0 0 /news/iwouldbeatragedyifakentclublosestheirrymanleaguestatussaystommysampson 1 5283 0 0 /news/ebbsfleetunited4-1bromley-theyweremoreclinicalthanwewereadmitsmarkgoldberg 2 21834 0 0 /news/wefaceanightmarefixturepile-upbemoansabbott 1 3905 0 0 /news/beckenhamtown1-1holmesdale-weknewwewouldbeinforabattlesaysjasonhuntley 3 30194 0 0 /news/erithtown030217 1 3678 0 0 /assets/js/jsign/ 5 1783 0 0 /news/sladevhyth130304.html 2 0 0 0 /news/redbridge101205.html 1 0 0 0 /news/leistoncalloffhythetownsridiculoustriptosuffolk 1 4609 0 0 /news/thefleetatwembleyangelsofthesouthbidforwembleyglory-exclusive 1 6034 0 1 /news/burmanidontwantmercanariesatdartford-exclusiveinterview 5 25870 0 0 /news/kentleague/whitstable/whitstablevlordswood130903.html 1 0 0 0 /news/collkspo090917 4 43346 0 0 /news/resultsaugustseptember2012 2 22408 1 0 /archive-2006-2014/65 2 10161 0 0 /news/551bc5e5225b2 1 3291 0 0 /news/doverathletic020519 3 15462 0 0 /news/everyonehastopitchintoopenupthetitleracesayswellsbossmartinlarkin 1 4605 0 0 /news/holmholl240718 4 40890 0 0 /news/otford220917 2 7916 0 0 /news/Governmentpetition061020 2 8420 0 0 /news/ramsgate301219 5 18327 0 0 /news/croydon170120 3 10712 0 0 /news/sportvtun081103.html 2 0 0 0 /news/horsham041005.html 2 0 0 0 /news/wewillnotjeopardisetheangelslong-termfutureinsistsnewchairman 1 4007 0 0 /news/kennington201218 3 12443 0 1 /news/bromtran230116 4 50531 1 1 /news/gatebrom240318 6 49568 0 0 /news/551bc5e06cf86 2 11000 0 0 /news/leatherhead1-2favershamtown-wewereoutstandingsaysfavershamassistantclivewalker 5 46477 2 2 /news/promotionisabigdealforstones 1 3971 0 0 /news/ashfordtownunveilgillmancapture 1 3299 0 1 /news/sitthythe191116 1 11754 0 0 /archive-2006-2014/40 2 9864 0 0 /news/fisher161116 2 9992 0 0 /news/youjustwontmeetabraverpersonthanleenoblesaysdartsbosstonyburman 1 4991 0 0 /news/maidstone200720 2 8454 0 0 /news/greenways250518 4 16937 0 0 /news/DCMSStatement231120 3 13051 0 0 /news/rusthall3-2bromleygreen 2 7628 0 0 /news/551a97b1a2f33 1 4877 0 0 /news/551a96db77a94 2 7634 0 0 /news/harristeamsupwithmcintyrebackatks 6 17720 0 0 /news/abelrejectsreturnmovetofolkestoneinvicta 1 4387 1 0 /news/thisweeksfixures 2 6078 0 0 /news/beckenhamtown0-0erithtown-wastellleavesdominantbecksfrustrated 5 65502 2 3 /news/newwhitstablebosspeternottlooksforwardtorenewpartnershipwithstevenolan 2 10212 1 0 /news/othernews/KYLFIX160204.html 1 0 0 0 /news/alanturveytostanddownasrymanleaguechairman 4 14898 0 0 /news/holmesdale120118 3 10236 0 0 /news/dartford0-1margate-wedefendedabsolutelyheroically-oconnell 1 6161 0 0 /news/crowborough150117 2 9284 0 0 /news/soccershortsbromleyplacestrikerwarrenmcbeanonthetransferlist 1 11501 0 0 /news/theroadtowembleyasuccessfulnightforkentsidesbriefroundup 1 4109 0 0 /news/coneyhallappointhullettastheirnewmanager 2 6156 0 0 /news/crowborough130917 1 3656 0 0 /news/beckenhamtown3-3whitstabletown 2 10563 0 0 /news/15thsept03.html 2 0 0 0 /news/rochesterunited121120 3 9446 0 0 /news/whitstable100517 2 7208 0 0 /news/drmartens/eastern/ashford/4thnov03.html 1 0 0 0 /news/tonbridgeangels290620 2 6732 0 0 /news/gillingham1-2astonvilla-defiantgillsbeatenonlybycontroversiallatepenalty 2 11035 0 0 /news/551bc5e24e9e3 1 3223 0 0 /news/seagerplotsthirdcupscalptoreachfinal 2 7540 0 0 /news/lancinggroundimprovementsforcefavershamcupswitch 1 3145 0 0 /news/551a979a17655 2 9901 0 0 /news/dulwich050718 3 12513 0 0 /news/thebigkickoffwereprapredforlifeintherymanpremiersayshume-exclusive 1 3822 0 0 /news/551bc5e77bae5 1 4467 0 0 /news/551bc5de7511d 1 4418 0 0 /news/kselm041116 3 30738 0 0 /news/hythetownpulltheirreservesoutofthekentleague 1 3530 0 0 /news/551a979a35040 2 9537 0 0 /news/dartford040919 3 10121 0 0 /margate-2003-2006/4 4 11777 0 0 /news/doversweekofdestinydoverstartplanningfornextseason 1 4075 0 0 /news/gillingham0-2westhamunited-wejustcantseemtoputtheballinthenetsaysjamesmarrs 2 17934 0 0 /kent-county-league/7 5 38252 1 1 /news/marcuscassisusissuesbromleybossmarkgoldbergagentlereminderofhisgoalscoringprowess 2 9502 0 0 /sporting-2003-2006 12 31921 0 0 /news/burmanwantshissidetocontinueimpressiveform 1 3728 0 0 /news/bromley121115 3 14787 0 0 /news/canterbury100616 3 11001 0 0 /news/numbercruncherabbottdreamsoffolkestonecupclash 2 9464 0 0 /news/greenwich120917 1 3230 0 0 /news/bromley150117 3 14208 0 0 /news/shorts200615 4 31474 0 0 /news/rooksetshissightshigher 1 4398 1 0 /news/fisher2-3greenwichborough-itsobviouslynicetowinheresaysgerrycox 1 8757 0 0 /news/theclubhasmovedonquiteabitinthelast10yearssaysfcelmsteadchairmantonyalliband 1 4335 0 0 /news/wedeservetoplayinfrontofabigcrowdsayswellingassistantbarryashby 2 10146 0 0 /news/ashfordhavemajorsayinwhowinstitle-exclusiveinterview 1 4163 0 0 /news/551a9678c6ccd 1 4813 0 0 /news/slattersignsnewone-yeardealtostayatfleet 1 3208 0 0 /news/knightoptsforcraywanderers-exclusive 1 4741 0 0 /news/doverathletic120820 4 13425 1 0 /news/551bc99dced39 1 4895 0 0 /news/daishtherewillbeafewyoungstersinoursquad 6 20552 0 1 /news/bowryjoinsbromleysnewlookmanagementteam 1 2915 0 0 /news/dartford1-0wellingunited-mybestmomentinfootballmanagementsaysproudtonyburman 1 8151 0 0 /news/resultsdec2016 4 39594 0 0 /news/hopefullywecandotheislandproudandbringbacktheglorydayssayssheppeybosskevinhake 4 20690 0 0 /archive-2006-2014/163 3 13087 0 0 /news/drmartens/eastern/folkestone/22ndjuly03.html 2 0 0 0 /news/tonbridgeangels2-1doverathletic-everyonesgiventheiralltodaysaystommywarrilow 3 30749 0 0 /news/551a97990701a 2 9154 0 0 /news/sutubrom030315 3 24596 0 0 /news/imgoingtohavestrikerscassandmayattheclubnextseasoninsistsburman-exclusive 2 7716 0 0 /news/fivestarfleet 5 17572 0 0 /southern-counties-east-football-league/8 5 42120 1 1 /news/lydd271115 4 13601 0 0 /news/551a97b1c55e7 1 4371 0 0 /archive-2006-2014/148 4 18600 0 0 /isthmian-league/11 7 49730 1 1 /news/hanscombestepsdownascraysreserveteammanager 1 3243 0 0 /news/beckenhamtown240120 4 14644 0 0 /news/kentfootballunited310818 4 15266 0 0 /news/managersrelishkentleagueopeningday 6 78562 1 1 /news/margate091118 4 14030 0 0 /news/erithtown2-1vcdathletic-someonesgoingtogetagoodhidingwarnserithtownstonyrussell 1 7509 0 0 /news/16feb04.html 1 0 0 0 /news/controversialcorinthianmovewasapprovedbyfootballassociationinsistskentleaguechairman 1 3725 0 0 /news/kentleague/sladegreen/13thoct04.html 1 0 0 0 /news/margate060619 4 12538 0 0 /news/qotshear120221 13 91158 0 1 /news/ebbsfleetunited4-1dartford 2 10704 0 0 /news/othernews/6thdec04.html 1 0 0 0 /news/holmesdale090815 4 19957 0 0 /news/551bc5e5bc762 2 7334 0 0 /news/gillingham200517 2 6581 0 0 /news/crowborough270620 2 9088 0 0 /news/551bc99b91208 2 13552 0 0 /news/hillsborough260416 4 16821 0 0 /news/551bc5e8b0434 2 15034 1 0 /news/crayvgree061203.html 1 0 0 0 /news/poutonsignsnewdoverdeal 1 3254 0 0 /news/wingssquadtakesshapefornextseason 1 3109 0 0 /news/cugleywantstodistancehimselffromhendon 3 14079 0 0 /news/elmskspo171117 3 26550 0 0 /news/wewereleftinanunlikelypositionofhavingonlyninefitplayers-hythetown 2 11118 0 0 /news/milesappointedheadcoachatharrowmeadow-exclusive 6 20769 0 0 /news/favershamtown0-0whyteleafe-iwouldhavetakenapointbeforehandadmitsrayturner 2 9663 0 0 /news/deresbossmickycollinswantsafacuprun 2 7662 0 0 /news/tunbridgewells080819 4 13445 0 0 /news/fordunveiledasnewwingsboss 2 7154 0 0 /news/snodlandperry310515 3 14171 0 0 /news/resultsfebruary2018 4 38178 0 1 /news/tootfolk241017 2 18702 0 0 /news/12thapr04.html 1 0 0 0 /news/551a979999e1f 2 11030 0 0 /southern-counties-east-football-league/15 3 14734 0 1 /news/lewbri020316 7 155950 3 3 /news/mcmahonpleasedwithstrengthindepth 1 3895 0 0 /news/imtalkingtothreeplayerstobethespineofmyteamsayssevenoakstownbosssimonjones 1 3823 0 0 /news/teamworkhashelpedwithoursuccesssaysaward-winninglovell 2 10461 0 0 /news/fleetnamechangewasastrategicdecisionsayschairman 1 3750 0 0 /news/folkestoneinvicta1windsoreton0 3 12700 0 0 /news/browndelightedwithdebollasigning 2 6812 0 0 /news/551bc5e80a5a1 2 15210 0 0 /assets/select2/src/ 6 2189 0 0 /news/craywands081217 1 3674 0 0 /news/maidstoneunited0-0harrowborough-thecommitmentshownwithninemenshouldkick-startus-ford 2 12024 0 0 /news/551a95b479d55 1 4437 0 0 /news/maliniwillunearthplayerstoplayfornothing-exclusiveinterview 2 9852 0 0 /news/ivelearntalotmoreaboutmyplayerssaysbutler 1 3724 0 0 /news/hemensmakesswitchtowells 3 10709 0 0 /news/551a9799ccf54 1 6021 0 0 /news/maidvlord271203.html 1 0 0 0 /news/horshamymca2-1chathamtown 1 3590 0 0 /news/edinburghleavesfisherduetonewbudgetrestrictions 3 10523 1 0 /news/dartsutt051116 3 28686 0 0 /news/sheppey161116 2 8085 0 0 /news/folkestoneinvicta1-0whitstabletown-fumingmundaywevebeenletdownbytheofficialsagain 2 11900 0 0 /news/fcelmstead220219 2 8090 0 0 /news/dartford2-2bromley-wewantedtobethefirstsidetobeatbromleysaysdartsbosstonyburman 1 9363 0 0 /news/drmartens/premier/welling/23rdsept03.html 1 0 0 0 /news/drmartens/premier/dover/7thsept04.html 1 0 0 0 /news/familymancablemissesvitalcupreplay 1 4545 0 0 /archive-2006-2014/134 4 18794 0 0 /news/therewillbenoplacetohideatmaidenheadsaysfavershamtownbossrayturner 3 12011 0 0 /news/dulwichhamlet060619 5 17566 0 0 /news/greenways110517 3 11768 0 0 /news/chathamtown1-1kingstonian 1 3955 0 0 /news/551a96dc2fe25 4 25085 0 0 /news/farnborough070218 2 6318 0 0 /news/rushdenapproachgravesendsdiamondmanager 3 9969 0 0 /news/craywands280617 1 4145 0 0 /news/wellgotoawkwardtootingtryingtowinthegamesaysfavershamtownbossrayturner 3 10751 0 0 /news/wecantwaittogetgoingagainsaysfolkestoneinvictabossneilcugley 1 3831 0 0 /news/551a9250ed327 2 6158 1 0 /news/ramsgate011216 3 12213 0 0 /news/551bc5e47201d 1 3925 0 0 /news/fishbear120119 4 46539 0 0 /news/ashfordunited280320 6 18667 0 0 /news/gavinhoare310119 3 10216 0 0 /news/carshaltonathletic1-2margate-ofcoursewecandefinitelystayupsaysupbeatoconnell 2 12032 0 0 /news/wearethrilledtobehostingourfirstinternationalsaysdartfordco-chairmanbillarcher 3 11071 0 0 /news/fordpleasedwithwingscharacter 2 6456 0 0 /news/pre-seasonfriendlies 5 26263 0 0 /news/drmartens/eastern/folkestone/crawley270704.html 1 0 0 0 /archive-2006-2014/86 1 4902 0 0 /news/walkertellsdoverboardthanksforshowingfaithinme 1 4570 0 0 /news/folkestone040416 4 15329 0 0 /news/551bc99ac1ae4 1 4671 0 0 /news/whitstable190205.html 1 0 0 0 /news/wevenothadmuchsuccessinthefacupadmitsdulwichhamletbossgavinrose 5 24176 0 0 /news/gibbonspraiseswhitstablefortheirgood-willtowardsinjuredkeeper-exclusiveinterview 2 11728 0 0 /news/551a956b80aeb 2 9772 0 0 /news/shorts160615 5 44365 1 1 /news/afccroy210316 4 15810 0 0 /news/chathamtown2-0thamesmeadtown-chatsnewboysimpressduringderbydaydelight 2 11356 0 0 /archive-2006-2014/63 2 10200 0 1 /news/551bc99ab4174 1 6070 0 0 /news/walkerpartscompanywithdoverathletic 1 3387 0 1 /news/ashford200117 1 3713 0 0 /news/holmesdale200720 2 6258 0 0 /news/551a9c92b7d8d 1 4467 0 0 /news/eastbourne221019 3 15688 0 0 /news/wellingunitedunveiltheloansigningoftyronemarsh 4 34636 1 0 /news/sevenoaks171218 3 9993 0 0 /news/outstandingshot-stopperstaysatbromley 1 2983 0 0 /news/9thsept05.html 1 0 0 0 /news/551a9799e8ba5 1 5649 0 0 /news/folkestoneinvictaonvergeofgoingintoadministration 1 5854 1 0 /news/551a97997de83 2 8326 0 0 /news/crockenhill180915 3 10950 0 0 /news/ialwayssaidtherewasmoretocomesaysashfordunitedbosspaulchambers 1 4253 0 0 /news/sceflsponsor151119 3 9401 0 0 /news/551a99e441a90 3 13206 0 0 /news/1stsept05.html 2 0 0 0 /news/theroadtowembleyfleetaimingtoendturbulenthistoryagainstexeter 2 7333 0 0 /news/tunwells210616 4 22890 0 0 /news/dulwich071116 1 3474 0 0 /news/corinthian2-0erithbelvedere-wewontlastlongintherymanifweplaylikethatsaysford 4 38908 0 0 /archive-2006-2014/102 2 9960 0 0 /news/8thjune05.html 1 0 0 0 /news/stonesloveshackforturningdownlucrativemove 2 7109 0 0 /news/national200617 2 8964 0 0 /news/drmartens/eastern/folkestone/billericay040904.html 1 0 0 0 /news/551a99e3c0f32 1 3672 0 0 /news/bromsut261216 3 26001 0 0 /news/wevegotnothingtolosesayserithtownbossmarktompkins 4 21460 0 0 /news/eastbournetown2-4sittingbourne-wereonlylookingonewayandthatsupsaysnickdavis 1 9206 0 0 /national-league/10 5 38789 1 1 /news/harlowtown1-2maidstoneunited-stonesclimboutofdropzonethankstosaunderslatewinner 3 23087 1 1 /news/wewillmovetheclubforwardvowsnewwhitstablebossmunday 2 6641 0 0 /news/stonesheroicdefenderchargedoverseriousoffence 1 3013 0 0 /news/whitstablegunningforreserveteamglory 1 3434 0 0 /news/soccershorts240516 4 25818 1 0 /news/kentleague/maidstone/30thdecember2003.html 1 0 0 0 /news/folkvniow010504.html 2 0 0 0 /news/sittvfolk030404.html 2 0 0 0 /news/iveprobablyhadeightorninegoodplayerscometomewhowanttocomenextseasonsayscollins 3 12149 0 0 /assets/select2/src/scss/mixins/ 1 369 0 0 /news/wehavetheplayerstoclimbthetableinsistsfrustratedbinks 1 4446 0 0 /news/551bc5de22f97 2 8830 0 0 /news/merssitt311017 3 27389 0 0 /news/551bc5e67ec09 2 7972 0 0 /news/shorts270515 5 27588 0 0 /news/promotionthisyearwouldbethehighlightofmycareersayscugley 3 13149 1 0 /news/wedontwanttoliveoffwhatwedonelastyearsayshythetownbossscottporter 1 3724 0 0 /news/ramsgate0-1sittingbourne-lovellgivestrialiststimetoimpress-exclusiveinterview 5 33249 1 0 /news/graemeandrewsreturnstobearstedafterseven-yearsaway 8 61957 3 4 /news/IsthmianLeagueStatement271120 3 12593 0 0 /news/punjab310818 1 3617 0 0 /news/oldbrom200516 4 31078 0 0 /news/1stmay04A.html 2 0 0 0 /news/bromley101116 3 14667 0 0 /news/551bc5e45511b 1 3448 0 0 /news/backingborotowembleyborogivenfire-powerboost-exclusive 2 11112 0 0 /news/kentleague/sladegreen/reading280804A.html 1 0 0 0 /news/drmartens/eastern/ashford/ashvbromleyfac130903.html 1 0 0 0 /news/margatebossoconnelltargetssigere 1 4272 0 0 /national-league/3 5 38331 1 1 /news/apmcontrast290116 4 14266 0 0 /news/551a96773123f 1 3989 0 0 /news/burmanrelishingstonesshowdown 1 4746 0 0 /news/hessenthalerhastrioinjuredforopeningtest 1 3133 0 0 /news/sheppey070418 2 8936 0 0 /news/stonesgivestudentsalessoninfootball 2 7078 0 0 /news/25thjuly03.html 2 0 0 0 /news/CEPMStatement200320 5 35442 0 0 /news/551a92500d255 2 6620 0 0 /news/beckgleb210120 2 6208 0 0 /news/margate210518 1 3584 0 0 /news/newsigningisamassiveboostforusgoingintoareallyimportantweekendsaysmickycollins 3 12950 0 0 /news/hythe181015 4 16529 0 0 /news/ashford010418 1 3458 0 0 /news/dulwwell281118 5 63247 1 1 /news/binkstakespositivesfromspiritedmidweekdisplay-exclusive 1 3760 0 0 /news/dartford3-2fchalifaxtown-theresaneasywayandadartfordwaysaysproudbosstonyburman 2 15700 0 0 /news/slysettofollowfriendoncontract 5 24854 0 1 /news/erithbelvedere6-1sladegreen-theagonyandtheecstacy-exclusives 1 6916 0 0 /news/drmartens/eastern/erith&belvedere/29thnov04.html 1 0 0 0 /news/soccershorts180516 4 16918 0 1 /news/craywands080319 3 13488 0 0 /news/551a956bcbdd7 3 13818 0 0 /news/kentcountyleagueannouncesquadsforfainterleaguecupwarm-upgames 2 8060 0 0 /news/551a967838831 1 4015 0 0 /news/chathamtown1-3corinthian-casuals-welackedsomeleadershipadmitsfrustratedobrien 1 5705 0 0 /news/551a96dc02f1f 1 4636 0 0 /news/hythe090305.html 1 0 0 0 /news/resultsdidntmatchourexpectationssaysangelschairman 2 8514 0 0 /news/thebigkickoffwalkerhandssevenplayerstheirashforddebuts-exclusive 1 3614 0 0 /archive-2006-2014/135 4 18846 0 0 /news/tonbridgeangels3-2craywanderers-wemadehardworkofitadmitswarrilow 2 15948 0 1 /news/burmangivennobleboostforseasonopener 1 4133 0 0 /news/werebasicallystartingagainadmitsvickersbossbennett 1 4185 1 0 /news/551bc5e26212f 3 10502 0 1 /assets/select2/tests/options/width.html 1 277 0 0 /news/bromley100319 3 12156 0 0 /news/chathamtown2-0wingatefinchley-barnetthasbeenthefindoftheseasonsaysbinks 2 10418 1 0 /news/551a97b1cd639 1 4634 0 0 /news/551a931da0a2b 1 3832 0 0 /news/brombarr240418 4 32862 0 0 /news/tonbridgeangels0-1suttonunited-theresstilleverythingtoplayforsaystommywarrilow 1 5476 0 0 /news/wardwantstoremainintopfive-exclusiveinterview 1 3701 0 0 /news/wecanstillmakeplay-offssayslovell 1 3975 0 0 /news/promotedthamesmeadprepareforlifeinrymanonenorth-exclusive 2 8571 0 0 /news/craywanderers2-1maidstoneunited-ilookatmyplayersandweshouldntbeinthismess-nott 1 8708 0 0 /news/ebbsfleetunited4-1graysathletic-daishheapspraiseonlocalteenagestrikersakindeandmoore 2 14748 1 0 /news/harrowcup1021004.html 2 0 0 0 /news/vcdathletic010120 3 10313 0 0 /news/wemuststartourleaguecampaignwellsayscugley-exclusive 1 4670 0 0 /news/sittcor190116 3 9015 0 0 /news/metropolitanpolice2-1folkestoneinvicta 2 10239 0 1 /archive-2006-2014/180 5 21847 1 0 /news/cumberbatchwemustfinishoffthejob-exclusiveinterview 3 12223 0 0 /news/egham100905.html 2 0 0 0 /news/551bc99ad3083 2 9458 0 0 /news/551a95b396d83 4 14682 0 0 /news/551bc99b2b39c 1 3344 0 0 /news/551a925092c09 2 8425 0 0 /news/wiskerhasthepotentialtobethebestintheleaguesaysseager 2 9517 0 0 /news/hernebay200320 3 15866 0 0 /news/gorere-signsforhishome-townclub 1 3091 0 0 /news/wevehadagoodstartbutwerenotgettingcarriedawaysaysphoenixsportsbosssteveoboyle 2 9284 0 0 /news/551a97b218dc2 1 4521 0 0 /news/seagerkeepshisunbeatensidesfeetontheground 2 6926 0 0 /archive-2006-2014/30 5 25326 1 0 /news/margate230217 4 16069 0 0 /news/millwallunveilianhollowayastheirnewboss 1 4283 0 0 /news/29thnov04.html 1 0 0 0 /news/whitstable040420 3 10861 0 0 /assets/fileman/Uploads/Images/ 5 1608 0 0 /news/phoefave121119 6 62064 0 0 /news/hopefullyjodybrowncancomeinandhitthegroundrunningsayswellingdefenderlouifazakerley 2 9116 0 0 /news/foresthillpark220219 3 12886 1 1 /news/favehern110220 2 23574 0 0 /news/margate241117 2 7460 0 0 /news/551a931e60867 3 10488 0 0 /news/theresnoreasonwhybeckenhamtowncantrealisetheirfullpotentialsayscoachdarrenanslow 3 12187 0 0 /news/551a979a8fc4c 2 22831 1 1 /news/erithandbelvedere270919 3 10440 0 0 /news/pattersonaimingforlengthytrophyrun 1 4935 0 0 /news/tonbridgeangels3-3lowestofttown-iffeelslikealossadmitstommywarrilow 1 5938 0 0 /news/wejustneedtoprogressyearonyearsayscorinthianbossmattlonghurst 5 25025 0 0 /news/elmstead050815 3 21222 0 0 /news/conference/margate/19thfeb04.html 1 0 0 0 /news/hernebayskipperlukeharveytellshisteammatesgiveuseverythingandbeourhero 1 5520 0 1 /news/9thsept03.html 1 0 0 0 /news/hessenthalertellshisclassysidetokeepthemomentumgoing 1 4645 0 0 /news/bromley080818 4 21654 0 0 /news/551a956cd23c9 1 4113 0 0 /news/rymanonesouthplay-offfinalgivemeonebigfinaleffort-sayscugley 3 16092 0 0 /news/551bc5df4189b 1 3270 0 0 /news/soccershortswellbepushingforpromotionnextyearsaysramsgateskipperdeanhill 5 68310 1 1 /news/1stsept03.html 1 0 0 0 /isthmian-league/15 7 36710 0 0 /news/whitstabletown140619 4 13781 0 0 /news/551a99e447b4e 1 3484 0 0 /news/thepressureisallonmaidstone-theresnopressureonourladssaysfolkestonebossneilcugley 2 7950 0 0 /news/whitwhyt170115 5 46112 1 1 /margate-2003-2006/3 4 11909 0 0 /news/drmartens/eastern/erith&belvedere/flackwell021004.html 1 0 0 0 /news/551a9c0e6062a 1 3295 0 0 /news/ramsgate011216A 1 4736 0 0 /news/rustroch280318 2 6086 0 0 /news/rivalslockhornsformoreimportantleagueclash-exclusiveinterviews 3 12686 0 0 /news/imlookingtotakethedereswheretheyshouldbeinsistsbrownexclusiveinterviews 5 49362 0 0 /news/ramsgate180119 4 15962 0 1 /news/dartfordfancustardaimstoimpress-exclusive 1 4986 0 0 /news/551a96dc27370 4 20414 0 0 /news/551a979a3157c 1 5039 0 0 /news/folkestoneinvicta1-0worthing 2 8402 0 0 /news/cugleyhasfolkestoneatheartsayslindsey 2 12772 0 0 /news/greenwich170619 3 11427 0 0 /news/ashfordtown2-1kingstonian 2 17000 1 1 /news/dorkingwanderers270820 3 9434 0 1 /news/folkestoneinvicta1-1hythetown-takingchanceshasbeenourproblemadmitsscottporter 4 39220 0 0 /news/551bc99d99cd2 3 18216 2 2 /news/1stdec03.html 1 0 0 0 /news/drmartens/eastern/folkestone/folkvfishlgecup111103.html 1 0 0 0 /news/dealtown201115 3 12795 0 0 /news/kentleague/sladegreen/thamesmead161004.html 1 0 0 0 /news/doverathleticfacupsecondroundclashmadeall-ticket 1 4830 0 0 /news/themagicwandsaregoinguposborngoesoutonanall-timehigh 1 4200 0 0 /news/wedontwantarelegationbattletobepartofouragendasaysbromleybossmarkgoldberg 6 31646 0 0 /news/wevenowgottoupourgametowinpromotionsaysmaidstoneunitedbossjaysaunders 4 18917 0 0 /news/fatrophyspecialramsgatetositdownwithbromleytodiscussmaysfuture 1 4213 0 0 /news/551a967744148 1 6330 0 0 /news/holmgrav160917 3 10731 0 0 /news/chatvdart120404.html 1 0 0 0 /news/sladegreenlaunchnewwebsite 6 15916 0 0 /news/sportkent170918 4 39018 0 0 /news/newwellsbossmakesdoubleswoop 1 3413 0 0 /news/mileswemuststeponthegastoreachfinal-exclusiveinterview 1 3819 0 0 /news/551a9250b7f69 1 5925 0 0 /news/wellingunited2-3ebbsfleetunited-iwanttobesuccessfulatebbsfleetsaysjamieday 2 19966 0 0 /news/551a96db6d0f0 4 15405 0 0 /news/551bc5e14e2e4 1 3487 0 0 /news/551a9cf4e5b03 1 4475 0 0 /news/dartford030517 2 8943 0 0 /news/wewanttogoonebettersayscorinthianbossmattlonghurst 3 17918 0 0 /news/isthmianLeague170320 2 6808 0 0 /news/folkestoneinvicta1-0hillingdonborough-wemustimproveadmitscugley-exclusive 2 14026 1 0 /news/exeter130805.html 4 0 0 0 /news/soccershortsdoverathleticchairmanpaysforfansdayout 2 14290 0 0 /news/soccershortshollandsblairfeeltotallydevastatedafterlosingpromotionappealatthefa 4 31598 0 0 /news/ramsgate180320 3 11078 0 0 /news/IsthmianLeague110420 2 7092 0 0 /news/canterbury280119 4 13538 0 0 /news/harwoodruledoutforrestoftheyear 2 8588 0 0 /news/Stainfolk120418 1 10306 0 0 /news/erithshep111216 4 41893 1 1 /news/wewantcompetitionforplacessaysnewmargatecoachsmith 2 7568 0 0 /news/greenwich240417 1 8190 0 0 /news/hythe221015 3 13716 0 0 /bromley-2003-2006/2 3 9336 0 0 /news/fishhavethatsinkingfeeling 1 3833 0 0 /news/551bc5e8f3de0 3 11909 0 0 /news/rusthall281015 3 10689 0 0 /news/sevecroy200318 2 20366 0 0 /news/crayvalley150619 4 14205 0 0 /news/23rdfeb05.html 1 0 0 0 /news/favershamtownfrustratedwithfixtureschedule 1 4002 0 0 /news/dartford6-1enfieldtown-enfieldoutclassedbybreathtakingdarts 5 80700 4 3 /news/sackingmybestmateisthehardestdecisionthativeeverhadtomakeinmylife-garyhillman 5 21117 0 0 /news/551bc5deb4609 2 7488 0 0 /news/kentleagueclubsprepareforbigkick-off 5 21667 0 0 /news/craywands220319 3 13857 0 0 /news/rusthallsignwestcountrystar 4 10753 0 0 /news/ramswardsreturn010515 4 16118 0 0 /news/worthing231004.html 2 0 0 0 /news/soccershortstonbridgeangelsgivetommywarrilowfiveyearstogetintoconferencepremier 1 7430 0 0 /news/hernlonc010416 4 40926 0 0 /news/hendonwasthewrongmaninthefirstplacesayshayes 1 4852 0 0 /news/hythefolk271215 5 94506 0 2 /news/sevenoaks020817 1 4407 0 0 /news/glebe010920 3 11387 0 0 /news/carpenterverballyagreestore-signforwings-exclusive 1 2831 0 0 /news/551a931da78b4 1 3925 0 0 /news/bromchar120716 7 102441 3 2 /news/551bc99baebba 1 3565 0 0 /news/daishfacesuncertainfuture 2 8417 0 0 /news/beckbrid220917 3 14295 0 0 /news/thamesmead120317 2 12734 0 1 /news/angelsaimtobouncebackfollowingdisappointingtrophyexit 2 9648 0 1 /news/kentfootballunited120818 4 13226 0 0 /news/551a9c92ee208 2 8279 0 0 /news/kingstonian3-2craywanderers-imdisapointedtogooutsaysianjenkins 3 25841 0 0 /news/weretryingourutmosttogetpromotioninsistspennock-exclusive 1 5223 0 0 /news/chathamtownlockhornswithmedwayneighbourstomark130thanniversary 1 3467 0 0 /news/itstimetoendourblipsaysdoverathleticbossnickyforster 1 3856 0 0 /news/bromley290619 3 18189 0 0 /news/kentleague/tunbridgewells/camberley110904.html 1 0 0 0 /news/ashbymakesquainhisfirstsummersigning 2 5787 0 0 /news/salisbury140804.html 2 0 0 0 /news/doverathleticbossmartinhayesreleasesquartet 2 8424 0 0 /news/charity130417 2 7236 0 0 /assets/select2/select2.jquery.json 1 892 0 0 /news/humefindsawaytokeephisstrikeforcehappy 2 9232 0 0 /news/soccershortsfolkestonetomakeannouncementconcerningtheirfuture-tomorrow 1 7759 0 0 /news/551bc5dec806d 2 15210 0 0 /news/abbottruesbradbrookslong-terminjury 1 5102 0 0 /news/icannotreturntokentleaguefootballvowssampson 4 21984 0 0 /news/ashfordtown2-1eastbournetown-wegotluckyadmitslovell 2 10910 0 0 /news/rowlandreachesstonesmilestone 2 6228 0 0 /news/doverathletic2-4maidstoneunited 2 10644 0 0 /news/551bc5dd78053 2 10924 0 0 /news/sittingbourne0-1folkestoneinvicta-wehaventreallygotgoingyetsaysneilcugley 1 6010 0 0 /news/erithtownreadytostandanddeliver 1 3847 0 0 /news/551a97b14bcb5 1 4738 0 0 /news/greeniesfridaypreview-2 4 19056 0 0 /news/551a9cf51a8a6 2 12876 0 0 /news/jonesreturnisarayofsunshineforashford 1 3818 0 0 /news/jamiedaygivestrialiststhechancetoimpressagainsthernebay 1 3271 0 0 /news/wenormallydoverywellathomeinthekentderbiessaysramsgatebosstimdixon 3 12338 0 0 /news/kennsutt191220 13 171483 1 2 /news/burmanrelishesfirstfacupclashatprincespark 1 3817 0 0 /news/itwillbenicetobeunderdogsthisseasonsaysashfordunitedassistantmanagerjohnovard 5 19900 0 0 /news/holmesdale040419 2 6358 0 0 /news/sevenoaks311218 3 12063 0 0 /news/angelslooktocontinuegoodformagainsthendon 2 7298 0 0 /archive-2006-2014/16 3 15132 0 0 /news/iknowwhatsonthemaidstoneunitedgamesaystonbridgeangelsbosstommywarrilow 2 9210 0 0 /news/letsgetitrightonandoffthepitchsaysfarnie-exclusive 1 5265 0 0 /news/erithbel300815 4 16430 0 0 /news/kentleague/deal/Sampson8.html 1 0 0 0 /news/sutton190205.html 2 0 0 0 /news/551bc5dfa442b 1 3829 0 0 /news/croydonath250118 2 6836 0 0 /news/hollands180119 4 19026 0 0 /news/crayashf260217 1 11962 0 0 /news/beckgleb080920 5 56420 1 0 /archive-2006-2014/155 3 13729 0 0 /news/folkestoneinvicta2-0chathamtown-immanenoughtotakeitonthechinsaysobrien 3 23233 0 0 /news/551a97b20b42d 1 4349 0 0 /news/dartford3-1bromley-charliesheringhamtakeshisgoalscoringtallytosixinderbywin 3 27833 2 2 /news/22ndaug05.html 2 0 0 0 /news/wearegoingthroughabadpatchadmitssheppeyunitedbosskevinhake 3 10208 0 0 /news/erithbelv250915 4 14154 0 0 /news/6thaug04.html 2 0 0 0 /news/tunbridgewellsformlimitedcompany 1 3231 0 0 /news/win300incashatcorinthiansannualfive-a-sidetournament 1 3245 0 0 /news/kentleague/tunbridgewells/tunverith111003.html 1 0 0 0 /news/weneedtokeepagoodrungoingsaysthamesmeadtownbosskeithmcmahon 3 14042 0 0 /news/hastingsjobisultimatelymylastchancetobeinvolvedinfootballmanagementsaysjohnmaggs 5 21100 1 1 /news/colemancutsthemustard 2 8124 0 0 /news/thenexttwogamesarevitallyimportantsayslovell 2 7542 0 0 /news/wardillsupportstonesoverred-cardappeal 3 15529 0 0 /news/imsuretheleaguewillbeevenharderthanlastseasonwarnsdulwichhamletbossgavinrose 4 20057 0 0 /news/11thnov04.html 2 0 0 0 /news/ryman/bromley/8thoct04.html 1 0 0 0 /news/27thnov05.html 2 0 0 0 /news/wellingunited2-1dartford-ihavetomakechangeswarnsdartsbosstonyburman 1 6294 0 0 /news/canterbury300417 3 10465 1 0 /news/551a9798041bf 1 4200 0 0 /news/theweekahead-2 2 10076 0 0 /news/tunbridgewells190119 5 19626 0 0 /news/551a9c0e8221e 1 3647 0 0 /news/kcfarubberstampashfordunitedsaffiliation 1 3835 0 0 /news/doverathleticlaunchnewclubhouseappeal 2 12831 2 0 /news/southpark141119 5 17601 0 0 /news/wehopeournewgroundwillbeanassettofisherandourlocalcommunitysaysfisherchairman 2 9098 0 0 /news/551a9c92d0ab3 3 28531 1 1 /news/551bc5e3ebc36 2 9588 0 0 /news/551bc5e1abf56 2 8512 0 0 /news/othernews/27thjune03.html 2 0 0 0 /news/lovelliknowwhattoexpectfromborehamwoodtonightexclusive 3 10902 0 1 /news/x 1 2508 0 0 /news/weknowwhatwevedonewrongatstalbanssaystonbridgeangelsbosstommywarrilow 2 9905 0 1 /news/soccershorts060616 4 20186 0 1 /news/KentFAStatement200820/ 3 12527 3 3 /news/theresarealfeel-goodfactoraroundtheclubsaysashfordunitedownertonybetteridge 1 4161 0 0 /news/d-dayloomsforwellingunitedascoldsnapisexpectedtohitmidweekprogramme 1 4986 0 0 /news/fixturelistoctober2013 5 54882 0 0 /news/551bc99ce9a3d 1 4510 0 0 /news/soccershortsneilcugleytakeschargeoffolkestoneinvictaforthe900thtime 3 40082 0 0 /news/ebbsfleetunitedpartcompanywithbossstevebrown 3 10108 0 0 /news/starjimmybullardtorefereecharityclashatphoenixsports 6 79128 5 4 /news/othernews/ksc1stround.html 1 0 0 0 /news/bridon030816 4 17634 0 0 /news/doverathletic4-1ramsgate-hessenthalersecondhalfdisplaywasajoytowatch 7 45292 0 2 /news/worthing251005.html 2 0 0 0 /news/corinthian091020 4 17854 1 0 /news/hythetownbossunveilsthearrivalofcoachstevenolan 4 13793 0 0 /news/shorts270615 7 98826 2 2 /news/551a931df3571 3 14328 0 0 /news/ashfordtown1-2whyteleafe-lovellblamespitchforpoorhomerecord 3 23776 1 1 /news/mileoak291005.html 2 0 0 0 /news/vcdhandedawaydrawinlast16 2 6956 0 0 /news/burgesshilltown0-1whitstabletown-werodeourluckadmitsheroicfewell 1 6308 0 0 /news/dulwichhamletcanhurtyouonthebreakwayswarnsfolkestoneinvictabossneilcugley 2 8701 0 0 /news/myplayershavegottoshowtheirtalentsonthebigstagesaysdoverbossmartinhayes 1 4754 0 0 /news/oboyleconfidentgoingintovasetriptowick 2 6906 0 0 /assets/uploads/content/Greenwich_Borough_Travis_Gregory%20-%20Copy%201.html 1 48141 1 0 /news/wearegoingupinsistswhitstablechairman 1 3889 0 0 /news/thepressureisonmargatesaysthamesmeadtownbosskeithmcmahon 2 8269 0 0 /news/otford080517 2 9348 0 0 /archive-2006-2014/5 6 29754 0 0 /news/molesey2-0craywanderersaban75minswebringthebestoutofpowersaysfrancis-exclusive 2 12578 0 0 /news/hernebay071018 4 20474 0 0 /news/kentleague/deal/Sampson13.html 1 0 0 0 /archive-2006-2014/183 5 22507 0 0 /news/grievesimpressedwithtonbridgetalent 5 18917 1 1 /news/crayvalleybosspaulgrossunveilstommyosborneashisfirstsigning 4 16390 0 0 /news/waltwhit160316 8 108643 2 2 /news/551a9799661c8 1 5084 0 0 /news/werelookingforsomecharacterfromtheplayerssayschathamtownassistantmanagerkeithlevett 3 15138 1 0 /dartford-2003-2006/3 3 8934 0 0 /news/551bc5e221187 1 5797 0 0 /news/lordswood310818 1 3514 0 0 /news/mcshanewillnotletusdowninsistsdaish 2 7098 1 0 /news/nugentquitsvickersinwakeof55budgetcuts 2 8868 0 1 /news/thefacupthirdqualifyingrounddraw-1 3 11821 1 0 /news/wevegottolearnquicklyadmitscox-exclusive 1 4444 0 0 /news/welookforwardtocontinuingsupportfromalloursponsorssaysdoverchief 2 6847 0 0 /news/sittingbourne2-3whitstabletown-laneihavenoideawherethatstartcamefrom 2 12517 0 0 /news/551a925097ec7 2 7682 0 0 /news/glebesutton090216 4 47784 0 0 /news/drmartens/eastern/sittingbourne/bhtvsitt140204.html 1 0 0 0 /news/23rdaug03.html 2 0 0 0 /news/kennington010620 3 11297 0 0 /news/wardconfidentofupsettingin-formleadersdoverathletic 2 8329 0 0 /news/drmartens/eastern/ashford/12thsept03.html 1 0 0 0 /news/warrilowmakeshispromotionintentionsknown 2 8464 1 0 /news/doverathletic230619 3 10338 0 0 /news/maidstoneunited3-2ramsgate-stonescomebackfrustratesstrugglingrams 5 35902 2 1 /news/551a97b227531 1 4515 0 0 /news/stonesheropauldesperateforfameandglory 2 7898 1 0 /news/EFLStatement030420 5 17017 0 0 /news/dulwdart020319 3 28602 0 0 /news/thamfave190818 5 49455 0 0 /news/budgetcutsforcedaishtooffloadhisassistant 2 6609 0 0 /news/hollands270817 1 3491 0 0 /news/wellingunited1-4graysathletic-pennockimproudofmylads 1 7423 0 0 /news/wearekeentogrowourstudentfan-basesaysdulwichhamletchairmanjackpayne 3 12649 0 0 /news/millwallswoopforformerdartswinger 2 6894 0 0 /news/lewes101220 4 18004 2 1 /archive-2006-2014/204 2 9289 0 0 /news/ramsgate140917 1 4747 0 0 /news/sittingbourne0-2guernsey-wehaventgotenoughpointsyettostayintheleaguesaysnickdavis 3 23714 0 1 /news/bromley221015 3 13671 0 0 /news/fordwaryofbromleyreaction 2 7397 0 0 /news/crockenhill060815 3 11787 0 0 /news/bankholidayweekendresultsforthcomingfixtures 4 21752 1 0 /news/saturdayheadlines-ramsbeatlastseasonsrunnersup 4 41316 0 0 /news/welling241116 3 12645 0 0 /news/551bc99baaa23 1 3119 0 0 /news/soccershortsmargateappointyorathasdirectoroffootball 1 4201 0 0 /news/halseyexpectingfiercefavershamshieldclash 1 4359 1 0 /news/croydonathletic1-0folkestoneinvicta-isupposetheresafearoflosingmyjobsayscugley 1 6721 0 0 /news/wembleyheroesdaishasksthe25000fans-whenwillweseeyouagain 2 10189 0 0 /news/551bc5ddab59a 1 4045 0 0 /news/551bc5e6a0f13 3 16750 0 0 /news/clubsslashpricesforopeninghomefriendlies 5 16339 0 0 /news/editorsnote21112014 3 9773 0 0 /news/drmartens/eastern/sittingbourne/aveley290904.html 1 0 0 0 /news/gillingham150517 3 10196 0 0 /news/salisbury111204.html 2 0 0 0 /news/wevegottobeatourbestinalldepartmentssaysjoefrancis 3 15763 0 0 /news/daishgratefulforfinancialassistance 2 9844 0 0 /news/551a96dbae3a8 1 4879 0 0 /news/craylord010217 1 10176 0 0 /news/chathamtown3-1molesey 1 3689 1 0 /archive-2006-2014/88 1 5078 0 0 /news/afcchern030919 6 63254 0 0 /news/wewanttoreallycauseanupsetsaysdartfordbosstonyburman 1 4593 0 0 /news/phoenixsports4-1bearsted-itwasagreatwinfortheclubsayssteveoboyle 2 22538 0 0 /news/weregeareduptoplayconferencepremierfootballsaysdartfordbosstonyburman 2 8696 0 1 /news/551bc99b712b2 1 3907 0 0 /news/tommywarrilowsnapsuplong-termtargetcurtisujah 1 4655 0 0 /archive-2006-2014/232 2 8384 0 0 /news/inpossiblytwoyearstimewecouldbeaforcetobereckonedwith-corinthianbosstonysitford 1 5119 0 0 /news/551bc5e876ea0 2 6768 0 0 /news/drmartens/eastern/sittingbourne/leightonfat091004.html 1 0 0 0 /news/551a931db1c0d 1 4114 0 0 /news/kentleague/sevenoaks/sporting061104.html 1 0 0 0 /news/imconfidentthatwecanputafewthingsrightsayshernebaybosssamdenly 4 16648 0 0 /erith-belvedere-2003-2006 12 36637 0 0 /news/mynextjobistogetwingspromotedsaysford 2 7708 0 0 /news/wewillreturnbackhometomaidstoneinsistsbowden-brown 2 10150 0 0 /news/phoechar021116 1 9922 0 0 /news/istillthinkfifthspotisavailableforabouttenclubssaysramsgatebossjimward 2 9006 0 0 /news/walton&hersham081005.html 2 0 0 0 /news/wevegottogetouracttogetherathomesaysward 2 7968 0 0 /news/maidenheadunited0-0doverathletic-imhappywithapointsayshessenthaler 1 5713 0 0 /news/sevedart140718 4 39865 0 0 /news/huggingsleavesvcdtosignformargate 3 26580 0 1 /news/30thsept03.html 1 0 0 0 /news/lordswood270716 2 7451 0 0 /news/beatingtitlefavouriteseastleighwasabigresultforussaysdoverathleticbossnickyforster 1 4083 0 0 /news/551bc5e5d229f 1 3962 0 0 /news/551bc99d41ae7 1 6425 0 0 /news/wevegotnothingtoloseatwokingsaysdartfordbosstonyburman 1 4503 0 1 /news/westkentpairpaytributetofootballlegend 2 6908 0 0 /assets/ckeditor/plugins/colordialog/dialogs/ 1 373 0 0 /news/551bc5d9f398b 3 12526 0 0 /news/maidstone291018 4 15808 0 0 /news/drmartens/eastern/sittingbourne/leightontown110904A.html 1 0 0 0 /news/kentleague/lordswood/winchester280804.html 1 0 0 0 /news/wewanttogettothefinalsaysthamesmeadtownbosskeithmcmahon 3 14309 0 0 /news/551a979ac8b4f 1 4800 0 0 /news/craywanderers2-2ebbsfleetunited-jenkinstodiscussbetterfinancialpackageforhamici 2 17190 0 0 /news/25thjune05.html 1 0 0 0 /news/soccershortsitwasquiteaneasydecisiontojoinincrediblebrightonsaysjamesmarrs 4 27045 0 0 /news/craywanderers1-2suttonunited-weveprovedtoourknockerswedeservetostayup-jenkins 2 15162 0 0 /news/robertssuffersinjuryblow-exclusiveinterview 1 3975 0 0 /news/551a97984c542 2 7948 0 0 /news/fordblastsclubforlackofsupportaheadofbigfavaseclash-exclusiveinterview 2 9046 0 0 /news/margate030317 1 4902 0 0 /news/ebbsfleet290620 2 7730 0 0 /news/551a9718c4a25 4 16722 0 0 /national-league/ 1 4487 0 0 /news/lordswoodwillstartclimbingthetablevowsmetcalf 1 4748 0 0 /news/vcdvwhitstable120803.html 1 0 0 0 /news/glebbeck210818 1 8840 0 0 /news/vcdathletic2-3southendmanor-transitionalvickersonthehuntforexperience 2 42501 2 0 /news/resultsaugustseptember2013 5 67980 1 1 /news/crayvalley050216 4 17737 0 0 /news/therefereehadnoideawhatwasgoingonorwhathewasdoingblastsstrouts 1 4831 0 0 /news/1staug04.html 1 0 0 0 /news/favershamcoachingjobcomesatrighttimeformetcalf 2 6962 0 0 /news/bromley020805.html 1 0 0 0 /news/tonbridgeangels1-7charltonathletic-itsjustanembarrasingendtoourseasonadmitswarrilow 2 17074 0 0 /news/551bc99b6457c 1 4916 0 0 /news/9thaug04.html 1 0 0 0 /news/hythetownbossscottporterunveilsryanrooksigning 2 23748 1 1 /news/dartford200905.html 1 0 0 0 /news/kentfootballunited161118 4 18722 0 0 /news/craywanderers2-1worthing-itwasimportanttobeatthelandofthegiantsadmitskempster 2 13780 0 0 /news/lyddtown020416 3 12366 0 0 /news/barking160805.html 1 0 0 0 /news/551bc5df7813f 1 4581 0 0 /news/barkmarg261019 3 32612 0 0 /news/551a979a3909a 1 5898 0 0 /news/kentyouthleaguetointroduceapremierleaguenextseason 1 4145 0 0 /archive-2006-2014/261 6 25969 0 0 /news/patientcugleynetslong-termtargetblackman 2 8386 0 0 /news/othernews/britishenergykentcountyleaguetables280304.html 1 0 0 0 /news/tonbridge040516 4 14935 0 0 /news/hendon2-0craywanderers-jenkinsnotconcernedwithpoortimekeeping 2 12181 0 0 /news/sporkenn221119 5 59467 0 0 /news/weneedtogenerateabitmoremoneytostayup-jenkins 1 5706 0 0 /news/croydon180915 4 13085 0 0 /news/thetophalfofthetablewillbeasuccessforussayscorinthianbosstonysitford 1 4138 0 0 /news/weneedtheweathertobekindtoussayscraywanderersbosskeithbird 1 4688 0 0 /news/sittvbanb130304.html 2 0 0 0 /news/551bc5e0b752e 1 3992 0 0 /news/crayvalley3-1barkingside-itsalwaysnicetogetabigteamsayspaulgross 5 40422 0 0 /news/551a97b19cb95 1 6324 0 0 /archive-2006-2014/252 3 12902 0 0 /news/551a96776e428 1 4360 0 0 /news/bromley0-4charltonathletic-werestillfinalisingoursquadsaysbromleysmurrayjones 2 14341 0 0 /news/551a9250709bc 4 17598 0 0 /news/kentleague/sladegreen/sladevwhitstable111003.html 1 0 0 0 /news/favershamtown1-2chipstead-wejusthavetoregroupforchristmassaysrayturner 1 5291 0 0 /news/crayvalley4-0woodstocksports-theleaguetableisabitembarrasingsaysleehockey 1 9356 0 0 /news/littlewarnsthattigershaveimprovedthisseason 1 9365 0 0 /news/bromyeov071120 7 67935 0 0 /news/551a97b11f014 1 4108 0 0 /news/ashford230705.html 1 0 0 0 /news/9thmay04.html 2 0 0 0 /news/phoenix160518 1 4251 0 0 /news/folkestone200619 4 14413 0 0 /news/tonbridgeladies060715 4 21726 0 0 /news/551a9677e160a 3 18216 0 0 /news/bromleywrexham08082015 7 87593 1 0 /news/histvfolk100404.html 2 0 0 0 /news/hayesyeading2-4doverathletic-atthisstageicantbemorehappywiththem-nickyforster 3 22850 0 0 /news/551bc5e16ba9e 2 7756 0 0 /news/meridianvp0-1sevenacresidcup-weneedtoimprovebigtimesaysleehill 3 26711 0 1 /news/ramshalsey150415 3 13946 0 0 /news/doverathletic0-3woking-dontwriteusoffyetsaysdoverathleticbossnickyforster 1 5815 0 0 /news/551a95b37b16f 1 3022 0 0 /news/551a9250c39a2 4 17658 0 0 /news/bromley7-1tonbridgeangels-idlikeafirstteamsquadofexacademyplayerssaysstevebaker 3 47997 1 1 /news/mittenexpectedtoreturnforgatesmelbournedebut 4 17414 0 0 /Home/Bind/binding 1 3457 0 0 /news/thecrowdshavebeendisappointingthisyearadmitsramsgatebosstimdixon 3 14852 0 0 /news/beckerit031018 5 41822 1 1 /news/sevenacresidcup2-3hollandsblair-thirdisnotgoodenoughforussayspaulpiggott 1 8761 0 0 /news/mydesiretosucceedhasneverchangedsaysnewly-appointedramsgatebossjustinluchford 2 13022 0 0 /archive-2006-2014/79 1 4873 0 0 /news/whitstabletownfaceraceagainsttimetogetthebelmontreadyintimeforhawksflyingvisit 1 5252 0 0 /news/deresgettheirkitson 1 3962 0 0 /news/icantmakeanychangesadmitsfrustratedlovell-exclusive 2 9833 0 0 /news/551bc99b81fbe 1 5925 0 0 /news/kentleague/cray/22ndaug04.html 1 0 0 0 /news/thamesmead050205.html 2 0 0 0 /news/drmartens/eastern/dartford/1staug04.html 1 0 0 0 /news/burmanactstobringacouplequalityplayerstodartford-exclusive 2 7783 0 0 /news/551a931e23706 1 3136 0 0 /news/suttonathletic3-5hollandsblair-theboysarestillgivingmeeverythingsayspaulpiggott 2 21888 0 0 /news/gillingham240120 3 12298 1 0 /news/tonvsitt060304.html 2 0 0 0 /news/othernews/SECFLTABS020204.html 1 0 0 0 /news/craywands100319 6 36042 1 1 /news/bromley281118 4 21755 0 0 /news/afccroydonathletic240818 1 3862 0 0 /news/soccershortsroystonspoordisplayslinkedtoswineflu 2 14698 0 1 /news/holmtwells021215 3 33561 0 0 /news/tunbridgewells1-0dunstonuts-itfeelsspecialtoknockouttheholderssaysmartinlarkin 4 57902 0 1 /news/soccershortstonybetteridgetakescontrolofcrisisclubashfordtown 2 18045 0 0 /news/vcdathletic5-1beckenhamtown-wedidntshowupinthesecondhalfadmitsshockedjasonclews 1 9274 0 0 /news/551a97b0bc1ea 3 13035 0 0 /news/wellingtown231216 3 10246 0 0 /news/maidstone020817 1 3417 0 0 /news/551a979891706 4 19082 0 0 /news/margatebosschriskinnearunveilsdeanpooleyashisfirstsummersigning 1 11970 0 0 /news/ifwehaveagoodnovemberwhoknowswhatwecanachievesaysfolkestonebossneilcugley 1 4701 0 0 /news/lordswood281217 2 7036 0 0 /news/dover060805.html 1 0 0 0 /news/hollkspo220120 4 38288 0 1 /news/atophalffinishwouldbeacceptablesaysnewrusthallbosspaulmcdonagh 1 4587 0 0 /news/tabletoppingdartsbosswarnsagainstcomplacency 4 14908 0 0 /news/14thnov03.html 2 0 0 0 /news/551a9b4822f9a 4 16310 0 0 /news/elmsspor170118 3 28335 0 0 /news/resultsmarch2018 3 31989 0 0 /news/fleetcanadianstarwellgetbackontrackforplay-offs 2 8706 0 0 /news/wewanttomakecrockenhillaforcetobereckonedwithvowsadams-exclusive 3 40402 2 2 /news/erithtown050216 4 15434 0 0 /news/drmartens/eastern/tonbridge/tonbridge.html 2 0 0 0 /news/fisher080319 4 14197 0 0 /news/551bc5e856ce0 3 14336 0 0 /news/551a99e48d876 1 3473 0 0 /news/dartschairmanlooksforwardtobumperpayday 1 4659 0 0 /news/erithtudor070617 2 8614 0 0 /news/kentleague/tunbridgewells/tunbridgewells.html 1 0 0 0 /news/charltonathleticvisitchathamfortilleystestimonial-exclusiveinterview 2 9198 0 0 /news/welltopplethegiantsofftheirperch-mcmahon 1 4159 0 0 /news/hernebay0-1flackwellheathaet-weshowedwhatwerecapableofsayshalsey 1 6553 0 0 /news/551bc5e1a1fec 2 12302 0 0 /news/tunbridgewells1lordswood1-farnieimresignedtolosingwhitehouseexclusiveinterview 1 5999 0 0 /news/kirstydowle121219 5 20317 0 0 /news/ithinkwevebeenunluckyinsomeofthegamesadmitsdartfordbosstonyburman 5 20927 1 0 /news/whitereadytoswoopintransfermarket 1 3301 0 0 /dartford-2003-2006/5 3 8418 0 0 /news/tonmckimm090515 4 17721 0 0 /news/551a95b45037b 1 4439 0 0 /news/tingley030504.html 1 0 0 0 /news/bromley250321a 1 4491 0 0 /news/tonbridge230917 3 10781 0 0 /news/newsigningswillimproveussaysmcmahon 2 8223 0 0 /news/chathamchairmanurgesgillsfanstobringafriendfortrophytie-exclusive 1 4012 0 0 /news/eastkentcollegelaunchkentcountyleagueteam 6 19982 1 0 /news/charltonathletic230120 3 11405 0 0 /news/7thnov03.html 2 0 0 0 /news/welldealwitheverythingthatisthrownatussayscugley 1 4793 0 0 /news/folkestoneinvicta1margate1 1 4452 0 0 /news/551a9718ece0f 4 20881 0 0 /news/iwilllearnunderdaishsayscollins 2 7987 0 1 /news/16thapr04.html 1 0 0 0 /news/551bc5dcc1cc0 1 5568 0 0 /kent-county-league/6 5 36064 1 1 /news/weveachievedwhatwesetouttodothisyearsayserithbelvederebossmickycollins 3 15968 0 0 /news/551a979b01c01 2 10328 0 0 /news/weveverymuchconcentratingonwhatwevegottodosaysbromleystrikeradambirchall 3 13597 0 0 /news/551a99e36ba04 1 4130 0 0 /news/resultwellingunited1thetaxman0 1 7597 0 0 /news/trottaddstohissquad 1 3050 0 0 /national-league/18 2 9770 0 0 /news/fleetchairmanissuesrallyingcryforcountywidesupport-exclusive 1 5867 0 0 /news/drmartens/eastern/folkestone/burnvfolk140204.html 1 0 0 0 /news/bromvnorthleighfac300803.html 2 0 0 0 /news/551bc5dcbd041 2 9040 0 0 /news/crystalpalace230517 1 3874 0 0 /news/langtonsearchingforthatelusiveleaguewin 1 3662 0 0 /news/fiskplaysdownhythestitlechances-exclusive 1 4220 0 0 /news/fastatement90118 3 13421 0 0 /news/greenways020819 3 9992 0 0 /news/soccershortsfacuphistorymakerarrivesinkent 1 7587 0 0 /news/wemayhavetocutthebudgetwarnsday 1 4043 0 0 /news/sevenglebe170216 4 46895 0 0 /news/ramsgaterelishvisitfrommargate-exclusiveinterviews 3 15716 0 0 /news/551a9c919a7ba 2 8184 0 0 /news/hythchal260920 6 60270 0 0 /news/romfordvbromfr120803.html 1 0 0 0 /news/sevenoaksfacesterntestagainstthefleet-exclusiveinterview 3 11622 0 0 /news/greenwich280218 2 9614 0 0 /news/sittvburn081103.html 2 0 0 0 /news/tunwells041215 3 12648 0 0 /news/wellgiveiteverythingthatwevegotsayslyddtownbossdavesmith 2 9876 0 0 /news/margate030517 2 6352 0 0 /news/551bc5dad05ed 2 9306 0 0 /news/hernebay020120 3 11356 0 0 /news/enfield191105.html 2 0 0 0 /news/vcdathletic0-1horsham-thebetterteamlosttodayadmitsvickersbossrickybennett 1 8565 0 0 /news/margatestatement181220 4 22795 1 1 /assets/uploads/teams/ 15 110737 1 3 /news/thepressuresbackontheplayerstogetaresultfortheclubsaystonbridgebossstevemckimm 3 13330 0 0 /news/troubledfishergranted21dayreprieve 2 6776 0 0 /news/commentbringthebigthreebackintothekentseniorcup 2 7646 0 0 /news/faversham100818 3 11235 0 0 /news/21stjuly03.html 2 0 0 0 /news/wingsbossjamiedayrelishingarsenalvisit 1 3574 0 0 /news/wecanttakeoureyeoftheleagueafterlastyearsaysbromleycoachneilsmith 3 15608 0 0 /news/551bc5e1143ed 1 3386 0 0 /news/iwouldntswapanyofmyplayerswiththeirssaysabbott 1 4638 0 0 /news/551a9798db589 2 9164 1 0 /news/wemustnotmessaboutinourplay-offquestsaysburman-exclusiveinterview 1 4261 0 0 /news/sittingbourne1-5whitstabletown-wedidntseethiscomingadmitssittingbournebossmattwyatt 5 54371 0 0 /news/23rddec04.html 2 0 0 0 /news/551bc5df4372b 1 4865 0 0 /news/illgetdoverbacktowheretheyshouldbevowshessenthaler 1 5090 0 0 /news/551bc5e2c2938 1 3499 0 0 /news/551a9c0f37001 1 6667 0 0 /news/ouraspirationsaretodoverywellsaysdoverathleticbosschriskinnear 6 29959 0 0 /news/heybridge220205.html 2 0 0 0 /news/championsivesetmysidemoretargetstoreachsaysburman 2 9306 0 0 /news/bromleyminshull210515 4 15780 0 0 /news/wardhailsthereturnoftwyman 1 3986 0 0 /news/wedidnthavethesquadtodealwithinjurieslastseasonsaysmaidstoneunitedbossjaysaunders 3 13904 0 0 /news/clubownerjerrydolkewillbackusallthewaysaysbromleycoachneilsmith 2 12625 0 0 /news/weneedtorememberhowfarwehavecomesaysfoley 1 4585 0 0 /news/sevenoaks260305.html 1 0 0 0 /news/chathamtown1-0ashfordtowngoodgerslatewinnerleavesashfordshell-shocked 2 9796 0 0 /news/kentfootballunitedbosssammacneilunveilshissummersignings 1 4105 0 0 /news/illjustbelookingtoprogresstheclubfurtherforwardsaysmillersbosspaulgross 6 39114 1 1 /eastern-2003-2006 13 39303 1 1 /news/margate1-0ramsgate-hocktonwinsoneoverollietokeepplay-offhopesalive 1 6426 0 0 /news/cray131205.html 1 0 0 0 /news/fcelmstead070220 3 11617 0 0 /news/margate010218 1 3850 0 0 /news/deresappointbrownastheirnewmanager 4 12886 0 0 /vcd-2003-2006 11 32958 0 0 /news/551a97b15c54b 1 5095 0 0 /news/hollands100319 5 18835 0 0 /news/erithtownunveiljamescollinsastheirnewboss 3 10796 0 0 /news/imstillnotquitesurehowchipsteadbeatustwicelastseasonadmitsneilcugley 3 12760 0 0 /news/tonbridgeangelsacceptofferforlegge 1 3728 0 0 /news/551a9c931a3fc 1 5717 0 0 /news/folkvchat211003.html 2 0 0 0 /news/tobialabi130715 4 24889 0 0 /news/drmartens/eastern/dartford/6thoct03.html 1 0 0 0 /news/effortwillkeepustheresaystabletoppingdolby 4 22092 0 0 /news/gillsratcliffe230415 3 12020 0 0 /news/tostayintheleaguewillbeamassiveachievementsaysthamesmeadtownbosskeithmcmahon 5 26280 1 0 /news/bromalde281117 4 35041 0 0 /archive-2006-2014/126 2 8956 0 0 /news/easttonb280416 4 35958 0 0 /news/551a95b3a68e9 2 6602 0 0 /news/551bc5e138f93 1 4255 0 0 /assets/fileman/php/security.inc.php 1 0 0 0 /news/kentseniorcupfuturekentmanagerswantgillinghamfinal 1 7893 0 0 /news/551bc5dced61e 1 4513 0 0 /news/hollands030617 1 3971 0 0 /news/january2010results 1 5561 0 0 /news/dulwichhamlet0-1folkestoneinvicta-cugleydrydenhasagreedsettlementandplaysforfree 2 13075 0 0 /news/craywanderers2-1leatherhead-francisjoyatlast-gaspwinner 1 6183 0 0 /news/dealtown080819 4 13697 0 0 /news/snodland171116 3 11559 0 0 /news/erithtown020516 4 13602 0 0 /news/erithtown4-1hythetown-dockersfight-backleavesfiskspeachless 2 14201 0 0 /news/dartford2-2tootingmitchamunited 1 6245 0 0 /news/sadnessoverthedeathofkentfootballer 3 9302 0 0 /news/wellingtown220919 3 13575 0 0 /news/551a99e510dad 1 4096 0 0 /news/551a9cf5ad264 1 3930 0 0 /news/wereahardteamtobeatsaysthamesmeadtownbosskeithmcmahon 1 3893 0 1 /news/crayvalley201017 1 3858 0 0 /news/erithbelvedere1hernebay2 2 7699 0 0 /news/itsarebuildingjobatcorinthianthisyearsaysjamescollins 3 11970 0 0 /news/table-toppingchathamtownbosskevinwatsonwantstogetsomepointsatilford 1 4573 0 0 /news/551a931dae8a1 1 2967 0 0 /news/cosgroveiwontfailgettingderestowheretheyshouldbe-exclusive 1 4861 0 0 /news/february2007fixtures 2 11350 0 0 /news/kentleague/sladegreen/1stdec03.html 1 0 0 0 /news/phoegleb190717 1 11347 0 0 /news/troubledfolkestoneinvictaprepareforadministration 1 3076 0 0 /news/arestonesfansthemostdevotedinkent 2 7202 0 0 /news/551bc5e23379d 2 7938 0 0 /news/wecertainlyoweramsgateonesaysfolkestoneinvictabossneilcugley 3 15188 0 0 /news/tunbridgewells2-0vcdathletic-weredreamingaboutwembleysayswellsbossmartinlarkin 1 9589 0 0 /news/551a9c917e747 1 3147 0 0 /news/rusthallunveilpaulmcdonaghastheirnewmanager 2 6494 0 0 /news/settledstrikeradmitshesenoyinghisfootballagain 6 34428 5 5 /news/wemusttakeadvantageofbeingathome-hares 2 7388 0 1 /news/spenbrom140318 4 37053 0 0 /news/ifwegetintotheplay-offsitwillbeunbelievablesaysthamesmeadtownbosskeithmcmahon 3 15001 0 0 /news/551bc5dfb3b91 1 3334 0 0 /news/NationalLeague150121 2 6933 0 0 /news/foleybringsnugenttooakwood 2 8982 1 1 /news/kingstonian040904.html 2 0 0 0 /news/551bc5e0195ee 2 7950 0 0 /news/hytheheroeswereallwillingjustthisoncetospendthefridaynightin-skipperdavecook 1 6165 0 0 /whitstable-2003-2006/ 1 3010 0 0 /news/ournewstrikerwillcauseproblemsinsistsdaish 6 17590 1 0 /news/ashfordtown2-1chathamtown-wevegotourjustrewardsbystayingintheleague-lovell 2 14047 0 0 /news/vcdathletic1-0dealtown-winchcombecelebrates300thappearancebybaggingleaguetitle 2 9635 0 0 /news/porterandcox030316 4 18169 0 0 /news/rochesterunited190820 5 16437 1 0 /news/noonewantstoseecrockenhillgooutofbusinesssaysmanagercraigclark 2 9398 0 0 /news/faversham110620 2 6562 0 0 /news/wehaventwonanythingyetadmitswhitstablechairman 1 3944 0 0 /news/bromley200117 4 16961 0 0 /news/canterbury100818 2 7358 0 0 /news/kentleague/ramsgate/ramsgatevdeal071003.html 1 0 0 0 /news/dartwell191015 3 27159 0 0 /news/tunwells290116 4 14613 0 0 /news/sittingbourne0aveley4 2 8713 0 0 /news/croydonathletic1-2maidstoneunited-werejusttryingtobuildalittlebrickinthewall-ford 2 13973 1 0 /news/weknowwhatwehavetodosaystonbridgeangelsdefendersonnymiles 3 16740 0 0 /news/hollgleb040320 3 18821 0 0 /news/FAStatement260320 5 15152 0 0 /news/croyfish101018 5 52247 0 0 /news/facupspecialwemustdothebusinessatbourneparksaysmartin 1 4964 0 0 /news/nuneatontownunveilliamdaishastheirnewboss 3 13978 0 0 /news/lordswood0-3hythetown-peopleareraisingtheirgamesagainstussayshythebossscottporter 2 10594 0 0 /news/newlightstoshineonsouthwoodstadiumwithinsixweeks-exclusiveinterview 5 19167 0 0 /news/brombrai30102018 3 29994 0 0 /news/551a96dbb8ade 2 6814 0 0 /news/bengal140804.html 2 0 0 0 /news/551bc99c627d0 1 5687 0 0 /news/eritrust020918 6 60679 1 1 /news/sevenoaks150218 2 8456 0 0 /news/maidstone240619 3 10368 0 0 /news/551a96dbe1bd1 1 3667 0 0 /news/551bc99d5f53e 1 4510 0 0 /news/14thnov05G.html 3 0 0 0 /news/hichamakhazzan030717 1 4624 0 0 /archive-2006-2014/87 1 4917 0 0 /news/maidstone280818 3 11421 0 0 /news/8thdec05.html 1 0 0 0 /news/ifeelweregoingintherightdirectionsaysradbourne 2 10520 0 0 /news/551a97b125e86 1 4571 0 0 /news/morekentleagueclubswillgoamateurascrowdsdontwarrantwagebillswarnsfisherboss 1 4580 0 0 /news/tudopeck010519 6 64976 0 0 /news/551a97992f193 2 17504 0 0 /news/551bc5e90582c 3 12515 0 0 /news/19thnov04.html 2 0 0 0 /news/erithbelvedere0-2maidstoneunited 1 3916 0 0 /news/551a95b43c0ae 1 3783 0 0 /news/vcdathletic0-1erithbelvedereabandoned48minsrefereespoiltourdayragederes 3 16382 0 0 /news/551a97988ebdd 4 18717 0 0 /news/5thjan06.html 2 0 0 0 /news/uxbridge291005.html 1 0 0 0 /news/hessenthalergiveshesitantstrikerdrydencontractdeadline 1 3686 0 0 /news/othernews/fat1stnov.html 1 0 0 0 /news/garlandblastsbengalblackout-exclusiveinterviews 7 73647 1 3 /news/15thjuly03.html 1 0 0 0 /news/crowborough201017 1 3843 0 0 /news/cugleytheclubisbuzzingagain 1 5382 0 0 /news/551a9799e46f7 1 4864 0 0 /news/fatrophyspecialashbyrelishinghisfirsttrophytie 2 7774 0 0 /news/551bc5e8c7bf5 3 17546 0 0 /news/ryman/bromley/beck220703.html 2 0 0 0 /news/wearegoingtobeinfinefettleforpre-seasonsayscrowboroughjoint-managerseanmuggeridge 4 14277 0 0 /news/551a97b1ae035 1 4888 0 0 /news/langtonwilldrivetheclubforwardsaysforbes-exclusiveinterview 1 4037 0 0 /news/hernebay1-3wellingunited-weneedbiggatestokeepmysquadtogethersaysday 2 13775 0 1 /news/letswincupshowdownforthefanssaysfarnie-exclusiveinterview 2 9902 0 0 /news/metpolice291204.html 1 0 0 0 /news/arsenalcelebscometosittingbourne 1 3013 0 0 /news/warrilowpens18-monthcontracttostaywithangels 1 4355 0 0 /news/chathamtown2-0whitstabletown-iwanttopsixinapril-obrien 2 11743 0 0 /news/551bc5e117117 1 5144 0 0 /news/chathamtown0-2sittingbourne-obrienwerenotinfreefallitsanabsolutedownpour 1 5197 0 0 /news/wejustfrozeonthebigstageadmitscopley 1 4699 0 0 /news/551a956c59fab 2 6504 0 1 /news/551bc5e362361 1 4574 0 0 /news/sevenoaks130217 1 3998 0 0 /news/551bc5daf1c60 2 10416 0 0 /news/wewanttokeepplayersontheirtoesduringpre-seasonsayserithbelvederebossmartinford 6 29132 0 0 /news/dartford011119 2 6398 0 0 /news/551a956bacfd7 2 7132 0 0 /news/othernews/coneyhall220904.html 1 0 0 0 /news/itsimportantthatwekeepconcentratingsaysmaidstoneunitedbossjaysaunders 3 10451 0 0 /news/MolevBrom010104.html 1 0 0 0 /news/scthamesmead230519 2 7626 0 0 /news/551a9c92635f6 3 13700 0 0 /news/eastphoe291016 3 69593 1 0 /news/tonbridgeangels4-1ashfordtownmiddlesexsecondplacedangelsgettheirjustrewards 2 12799 0 1 /news/drmartens/eastern/sittingbourne/banburyvsitt111003.html 1 0 0 0 /kent-invicta-league/19 2 9634 0 0 /news/facupspecialeveryonehastobeontheirgame-cronin 1 3906 0 0 /news/erithbelvedere2-0whitstabletown 1 4259 0 0 /news/greenwich230717 1 4124 0 0 /news/551a97b096a6d 1 3636 0 0 /news/chathamdraftingoalkeepingcoachforyoungsters 2 6466 0 0 /news/551bc5e8aab02 3 10457 0 0 /news/greentoot061216 2 18754 0 0 /news/dartsrelishingbiggames 2 6864 0 0 /news/jonesexpectsbumpercrowdfordulwichhamletvisit 2 7922 0 0 /assets/fileman/lang/ru.json 1 5072 0 0 /news/551bc5e5a5ae8 1 4462 0 0 /archive-2006-2014/173 3 13283 1 0 /news/wewonthaveabigsquadlikelastyearsaysmaidstoneunitedbossjaysaunders 5 24295 0 0 /assets/select2/tests/data/ 5 2868 0 0 /news/maidstoneunited4beckenhamtown3aet 3 13682 1 0 /news/weneedtobeatourbesttogetanythingoutofdaventrytiesaysramsgatebosstimdixon 2 7033 0 0 /news/dartford1-2bromley-mastermindgarethwilliamswasthedifferencebetweenus-markgoldberg 2 17390 0 0 /news/bromvgraysfr090803.html 1 0 0 0 /news/craywands010518 1 5079 0 0 /news/othernews/AEI111004.html 1 0 0 0 /news/6thjuly05.html 2 0 0 0 /news/beckenham270817 1 3929 0 0 /news/dartford1-4forestgreenrovers-imjustabsolutelyguttedforlouiswellssaystonyburman 4 31538 1 1 /news/gillinghamsignchathamprospect 1 3425 0 0 /news/maidstoneunitedshowinterestinnortonsportsstrikerandyirvine 1 5054 0 0 /news/30thnov05.html 2 0 0 0 /news/walthamforest231004.html 2 0 0 0 /news/ihaventgotaget-out-of-jailcardadmitscraywandererschairmangaryhillman 3 11756 0 1 /isthmian-league/34 13 64600 0 0 /news/551a97b175270 1 5784 0 0 /news/wegavethemtoomuchrespectadmitsharris-exclusive 2 11278 0 0 /news/thebigfreeze-lastupdated1200 1 3778 0 0 /news/hollands080516 4 16414 0 0 /news/551a979adb766 1 4759 0 0 /news/thamesmead170716 1 4384 0 0 /news/wereallpushingintherightdirectionsaysmaidstoneunitedacademymanagerjackparkinson 6 28328 0 1 /news/crownalexndrapulloutofkentinvictaleague 3 12074 1 0 /news/tunbridgewells240920 4 15892 0 0 /news/werestillinwithachanceoftheplay-offssaysramsgatebosstimdixon 3 15304 0 0 /news/fisher241005.html 2 0 0 0 /news/daishslamshillforbeingupcloseandpersonal 1 4216 0 0 /news/1stjuly05A.html 4 0 0 0 /news/7thjune05.html 2 0 0 0 /news/beckenham300819 3 10347 0 0 /news/wivenhoe290105.html 1 0 0 0 /news/erithbel040817 1 4109 0 0 /news/551a979a5d630 1 15728 0 0 /news/ashford241118 3 9855 0 0 /news/merksp080117 3 14280 0 0 /news/sittingbourneadapttolifeintherymanleague-exclusiveinterview 3 10826 0 0 /news/wehavetokeepmidfieldgeneraljamesscowcroftquietsaysmargatebossiainoconnell 1 3667 0 0 /news/crowborough020817 1 3873 0 0 /news/season2013-2014faplacefourkentclubsinrymanleaguedivisiononenorth 3 18541 0 0 /news/sittingbourne050216 4 16582 0 0 /news/wehavetomatchdartfordineverydepartmentsaysbromleycoachneilsmith 1 5563 0 0 /news/tunbridgewells071204.html 1 0 0 0 /news/backingthefleettowembleyglorywereinagreatposition-daish 1 4976 0 0 /news/551bc5e83df2b 2 9142 0 0 /news/551a9cf55939d 2 8170 0 0 /news/wellwhite151016 3 26505 0 0 /news/ijustneedtobegivenachancesomewheresaysbillywalton 2 7810 0 0 /news/dulkin200317 1 9074 0 0 /news/bromley190618 3 10746 0 0 /news/ihavenoideawhatthefutureholdsforgreenwichboroughsaysholmesdalechairmanmarkharris 3 21843 1 1 /news/551bc5e891adb 2 7216 0 0 /news/551a96781bf99 3 12669 0 0 /news/chathamtown4-0cheshunt-wevehadagoodstart-butitsonlyastartsayskeithlevett 6 36224 5 5 /news/newleaguetokickoffinaugust2010 2 6276 0 0 /news/wehavetofollowinhythetownsfootstepssayshernebaybosssimonhalsey 1 5016 0 0 /news/chipstead180517 4 25801 1 1 /news/hallsathletic290720 2 7734 0 0 /news/merielth120116 7 132351 3 2 /news/glebbeck250120 5 60245 0 0 /news/drmartens/eastern/sittingbourne/fisher160804.html 1 0 0 0 /news/metrogas221020 5 23340 1 1 /news/myjobistogetplayersupformust-winderbydualwithcraysaysnott 2 8218 0 1 /news/lovellseeksreinforcementstocombatcriplinginjurycrisis-exclusive 1 4486 0 0 /news/dayaddslong-termtargetstohissquad 1 3568 0 0 /news/crayvalleyunveilmidfieldgoalthreataaronjeffreyassecondsummersigning 4 13450 0 0 /news/harlowtown1sittingbourne0sat29thapril2006 1 4876 0 0 /news/chathamlookforcapitalgains-exclusiveinterview 3 12116 0 0 /news/tonbridgeangels1-0hastingsunited-mainhasnotreachedhispeakwarnsdolby-exclusive 5 78886 2 1 /news/dartford2-1basingstoketown-wewanttotakethisclubashighaswecangosaystonyburman 1 6642 0 0 /news/beckenhamtown4erithtown0 1 3999 0 0 /news/erithtown261004.html 1 0 0 0 /archive-2006-2014/257 6 26263 0 0 /news/fordcallsuponlocalsupporttoseethemthrough-exclusiveinterview 4 19400 0 0 /news/isthmianleaguestatement101220 2 19973 1 1 /news/fatrophyspecialseageraskswillbrackleytakeusseriously 2 8978 0 0 /news/551a99e3695d8 1 3030 0 0 /news/daishwehavearesponsibilitytolookafterourplayers 6 24670 0 0 /news/iwillnotgoovermyplayingbudgetinsistswarrilow 1 5304 0 0 /news/551bc99c4b2a4 2 10960 1 0 /news/myinjurywasaverytoughexperiencesaysbromleystrikerwarrenmcbean 6 19057 0 0 /kent-invicta-league/15 2 10310 0 0 /news/horshamymca0-2folkestoneinvicta 1 4948 0 0 /assets/fileman/php/renamedir.php 1 45 0 0 /news/letsfinishtheseasononahigh-notesayslovell-exclusiveinterview 1 4584 0 0 /news/bromley020221 5 25407 1 1 /news/soccershortsihavethestrongestteamindartfordsrecenthistorysaysburman 2 18022 0 0 /news/hawkinge030516 2 8138 0 0 /news/joneswantspartisanhomesupporttocreatefacupgiantkilling 2 9902 0 0 /news/erithbelv191115 3 12486 0 0 /news/workontraininggroundpaysdividendsforin-formashford 1 4080 1 0 /news/chalwhit280919 3 27592 0 0 /ladies-football 27 120393 1 3 /news/8thjuneA.html 2 0 0 0 /news/weshouldbemindfulofchathamsstrengths-butwedontfearthemsaysmunday 2 7520 0 0 /news/groombridgeplaceisatthegreen 1 3611 0 0 /news/551a931e4add1 1 3598 0 0 /news/were100behindthemanagersaysfolkestonedirector 2 8468 0 0 /news/24thjune05.html 2 0 0 0 /news/anteraisedforsecondkeeperwars-exclusive 2 7915 0 0 /news/cugleywemuststartfindingthebackofthenet 1 4393 0 0 /news/ryman/bromley/10thoct03.html 1 0 0 0 /news/chesbrom271118 3 27909 0 0 /news/harrowborough0-1tonbridgeangels-theoddswereagainstustonightsaysstevemckimm 3 24781 0 0 /news/ashford230218 2 7990 0 0 /news/stayingtopisthehardestpartadmitsfrost-exclusive 2 8823 1 0 /news/tunwells070216 4 17374 0 0 /news/10thnov04.html 2 0 0 0 /news/charlton171217 1 4123 0 0 /news/551a99e3317e2 2 9048 0 0 /news/topfiveistheaimsaysrusthallmanagergarysharman 1 3832 0 0 /news/crayveritht111115 4 40940 1 1 /news/hopefullywecanhelpjamiedayandthesquadtogettothenextlevelsayssupporterschief 1 3372 0 0 /news/wewillnotbeacasulatyatharefield-hume 2 7443 0 0 /news/robbinsconfirmscroydondeparture 1 3349 0 0 /news/resultsaprmay2019 4 40238 0 1 /news/SuttonUnited120705.html 2 0 0 0 /news/greendart080316 4 35558 0 0 /news/doverathletic2-0wellingunited-dovermarchontowardsholygrail 2 8800 1 0 /news/551bc5e8d5940 4 13482 0 0 /news/6thoct05.html 1 0 0 0 /news/itsnotallwhiteonthenight-latestprincesparkpics 3 12686 0 0 /news/livecoveragestainestown2-1ramsgate-penaltydecisioncostsramsplaceinplay-offfinal 1 7994 0 0 /news/551a9799d8bc2 1 5153 0 0 /news/2ndjan05.html 2 0 0 0 /news/551a96dc06dfa 1 5115 0 0 /news/glebe020919 6 18864 0 1 /news/craybaff050119 4 39254 0 0 /news/sittvbash061203.html 2 0 0 0 /news/mauricedunktakesoverassittingbournechairman 6 23821 0 0 /news/stadiumdreambecomesarealityforthamesmeadtown 1 4047 0 0 /news/millwall031019 5 18469 0 0 /news/hythetown230620 3 9641 0 0 /news/beckschairmantheresnothingtobefrightenedoff 1 3949 0 0 /news/551bc5e4176a9 2 10498 0 0 /news/wardpleasedwithramsopeningmatchfitnesslevels-exclusive 1 3220 0 0 /news/551bc5e15eff1 1 4117 0 0 /news/15thjune05.html 2 0 0 0 /news/kentfaaward201115 4 17582 0 0 /news/551a967886b6d 3 14697 0 0 /news/snodlandtown010819 3 12742 0 0 /news/sportvslade181003.html 2 0 0 0 /news/binkssignspottertoaddsomemagictohischathamside 1 3290 0 0 /news/crockenhill030217 3 12588 0 0 /news/whitstabletown1-3afcsudbury-iwasembarrassedbytheperformanceadmitsjimward 3 26124 1 1 /news/greenvcd111016 2 20304 0 1 /news/hernebay161004.html 1 0 0 0 /news/dartsletkidsinforfreeforprincesparksfourthanniversary 1 3657 0 0 /news/folkestoneinvictaunveilsteveharpersigning 5 21445 0 0 /news/nineteengamesunbeatenandcraybossjenkinssaysdontcountmysideoutoftitlerace 1 4645 0 1 /news/ryman/bromley/bromvdartfordfac.html 1 0 0 0 /news/thetargetissimple-tofinishhigherthanlastyearsayscrayvalleybossstevechapman 1 4203 0 0 /news/wejusthavetomakesurewedeliveronthedaysayschathamtownstrikerandyconstable 5 17376 0 0 /news/wehavetobeinapositiontogoupsayslyddtownbossdavesmith 4 21504 1 0 /news/tozeroptsforthamesmeadmove 1 3273 0 0 /news/clubsinvitedtoregistertheirinterestinnewstep6league 2 6517 1 0 /news/551a9c0f329cf 1 4800 0 0 /news/holllydd070215 3 31667 0 0 /news/erithtown160705.html 1 0 0 0 /news/folkestoneinvicta051120 2 7782 0 0 /news/maidstoneunited2-2tonbridgeangels-wattsisnotamodelprofessional-hume 3 26042 2 1 /news/551bc5dfb0d97 1 4418 0 0 /news/erithbel010516 4 18210 0 0 /news/dartford070719 3 13818 0 0 /news/551a92511617a 3 17237 0 1 /news/weneedeveryonepullinginthesamedirectionsaysbromleycoachneilsmith 3 15149 0 0 /news/burmanpartscompanywithinfluentialskipper 2 8568 0 0 /news/tunwells140917 1 3678 0 0 /news/burmanpraisessquadprofessionalism 2 9118 0 0 /news/margate230620 3 11045 0 0 /news/foresthillpark201218 2 7696 0 0 /news/wearetryingtodoasmuchaswepossiblycantoturnitaroundsayspaulblade 5 22806 0 0 /news/551bc99aae600 1 4260 0 0 /news/ebbsfleetunited0-0yorkcity-ourfixturebacklogisridiculouscomplainsdaish 1 6669 0 0 /news/dulwpeter08072015 4 52619 1 1 /news/wevebanishedallthoughtsonrelegationsayswhitstablechief-exclusive 1 4501 0 0 /news/551a956bf4215 1 3556 0 0 /news/lovellrelishingtastyfestivefixtures-exclusive 1 4207 0 0 /news/FACupDraw211019 3 10153 0 0 /news/7thjune05A.html 1 0 0 0 /news/1stjuly05.html 2 0 0 0 /news/FACupDates130820 3 11293 0 0 /news/drmartens/eastern/erith&belvedere/10thsept04.html 1 0 0 0 /news/sevenoakstown1-1beckenhamtown-wevejustbeenrobbedoffthreepointsclaimsdarrenanslow 1 8113 1 0 /news/551a95b401621 4 17737 0 0 /news/bromley241019 3 12365 0 0 /news/england110718 4 21222 0 0 /news/tonbphoe031115 6 75189 2 1 /news/vickersgroundreadyforaugustfriendlies 1 3261 0 1 /news/NLSStatement120221 6 27430 1 1 /news/soccershortswarrilowforcedtoriskstarsforleaguecuptie-exclusive 2 12395 0 0 /news/tunbridgewells300819 3 11223 0 0 /news/ifwecanfinishinthetopthreeorfourthisyearillbeabsolutelyoverthemoonsayslonghurst 5 22605 0 0 /news/bromley130715 4 21305 0 0 /news/551a9677cfe22 1 3421 0 0 /news/wehavetotryandgetthroughforthefacupfinancessaysfolkestoneinvictabossneilcugley 2 9910 1 0 /news/lewishamborough3-4fleetleisure-weveprovedafewpeoplewrongsaysfleetbossleerichmond 4 42466 0 0 /news/FAStatement180520 3 12878 0 0 /news/greecor250417 2 19946 0 0 /news/551a979843881 2 7514 0 0 /news/thamesmeadtownrecordtheirhighestwinasakentleagueclub 4 42240 0 0 /news/thamnorw240117 1 9384 0 0 /news/maidstoneunited4-2aveley-iwantustobehardtobeatathome-hume 1 5887 0 0 /news/drmartens/eastern/folkestone/hampton140904.html 1 0 0 0 /news/551bc5da32fa8 3 15602 0 0 /news/kentleague/sladegreen/29thnov04.html 1 0 0 0 /news/21stjune05.html 1 0 0 0 /news/folkdork220815 4 52790 1 0 /news/matchreportssladegreenpickupsevenyellowsandtworedsinlocalderby 1 9247 0 0 /news/spicegivenchancetoreclaimfirstteamshirt 2 8079 0 0 /news/itsgoodthatweseemedtobrokenthehomejinxoflastseasonsaysbromleybossmarkgoldberg 5 23460 0 0 /archive-2006-2014/170 4 18098 0 0 /news/fishercrayval100815 4 39813 0 1 /news/kentleague/maidstone/maidvfolk171203.html 1 0 0 0 /news/erithtownfoodbank301119 2 6908 0 0 /news/551bc5e6b69e1 3 16460 0 0 /news/crayvalley270217 1 3922 0 0 /news/eritcray180817 4 19661 0 0 /news/iwillwalkawayifwedontmakeplay-offsnextseasonannouncesward 2 10369 1 0 /news/faappealleavestheclubinlimboadmitsfoley 1 6469 0 0 /news/ifyouwanttoachievesomethingandyouworkhardenoughyoulldoitsaysmargateboss 2 9792 0 0 /news/sittingbournesupportersdeserveagoodsidesaysjoint-managerjimward 1 4296 0 0 /news/starscomeoutforabbottsbenefitmatch 1 2864 0 0 /news/551bc5e59fa27 1 4404 0 0 /news/bromley2-1suttonunited-wegaveourfanswhattheywereaftertodaysaysmarkgoldberg 6 116045 0 2 /news/dovercalltheshotsitsjustoneofthosefantasticdaysandyourejustgladtobeapartofit 1 6095 0 0 /news/iwillnotstanddownsaysdefiantunder-firewhitstabletownbossjustinluchford 2 10724 0 0 /news/tonightsteam-news 1 5180 0 0 /news/tonbury210315 3 25994 0 0 /news/erith131104.html 1 0 0 0 /news/wehaveeverychanceofexceedingourpreviousbestpositionsayswhitstabletownchairman 3 13002 0 0 /news/craystagebenefitmatchfornon-leaguelegend 1 3830 0 0 /news/dartfordcouncilitsgoodtoshare 6 27023 0 0 /news/theseareexcitingtimesforthamesmeadinsistsmcmahon 1 4125 0 0 /news/551bc5e2e328d 1 3805 0 0 /news/weresittinginanicepositionsaysdoverbossmartinhayes 1 4320 0 0 /news/dartford1-0ebbsfleetunited-wevegivenitourbestshotover180minutessaysstevebrown 2 18428 0 0 /news/faversham180619 4 14445 0 0 /news/551a97b23619c 6 71466 4 4 /news/fisher140219 4 15745 0 0 /news/hopefullywecangetonemorewintosealtitlesayswellingunitedbossjamieday 3 14630 0 0 /news/animmediatereturntoconferencesouthwouldbegreatsaystonbriddgeangelsbossstevemckimm 4 18474 0 0 /news/imnotbittersayscordiceashissalterslanereigncomestoanend 2 10960 1 0 /news/tonbridge290805.html 2 0 0 0 /news/tonbridgeangels220321 6 30352 1 1 /news/wehavetobeleivethatwecanwinplay-offssaysthamesmeadtownbosskeithmcmahon 2 8438 0 0 /news/phoenixsports3-0ashfordunited-frostshouldhavegoneadmitsphoenixbossscottsaunders 2 16674 1 1 /news/afccroydon031117 2 6714 0 0 /news/551a96db7bd30 1 3347 0 0 /news/ankleinjuryforcessimpsontoretire 1 3656 0 0 /news/soccershortssladegreenkeeptheirfeetonthegrounddespitetengoalromp-exclusive 1 9822 0 0 /news/facarlsbergtrophysecondrounddraw 1 3254 0 0 /news/thebigkickoffiwanttowinthingsthisseasonsayscloke 1 3696 0 0 /news/beckenhamtown2-3craywanderers-ivegotfartoomanyplayersattheminutesaysianjenkins 5 53160 0 0 /news/kentleague/cray/croydon210804.html 1 0 0 0 /news/sevenlydd290116 4 15714 0 0 /news/bromley1-0valeofwhitehorse-myplayersrosetotheoccasionsaysproudjackparkinson 1 7543 0 1 /news/551bc5e255749 2 7892 0 0 /news/doverathleticbeginsearchfornewsponsors 2 6734 0 0 /news/551bc5dd9c45b 1 3994 0 0 /news/551bc5dce8825 1 3367 0 0 /news/livecoveragetonbridgeangels4-0hendon-angelsplay-offpushisrightonq 1 7671 0 0 /news/kingstonian5-2craywanderers-theyweremuchmuchstrongerthanusonthedaysaysianjenkins 1 7650 0 0 /news/whitstablechairmanapplaudsteameffort 1 4676 0 0 /assets/ckeditor/plugins/imagepaste/docs/ 1 397 0 0 /news/crayvalley2-3southpark-itcouldhavegoneeitherwaysayscrayvalleybossstevechapman 2 16193 0 0 /news/angryjennerfightforthecluborgetout 3 11464 0 0 /news/551a97b2587a6 1 4318 0 0 /news/resultsjanuary2013 3 25727 0 0 /news/dealtown020516 4 12614 0 0 /news/folkvbash300304.html 2 0 0 0 /news/soccershortsfatherandsontakechargeofbexleyborough 1 7603 0 0 /news/ramsgatehasalwaysbeenknownasaclubofwinnerssayschairmanlawson 1 3740 0 0 /news/bromleyvlewes190803.html 1 0 0 0 /news/tenapplyforvacantdoverjob 1 4416 0 0 /news/551a9c0e6281d 1 3962 0 0 /news/englandfrance151115 4 18126 0 0 /news/hopefullywecannowturnanewleafasjanuaryapproachessaysramsgatebossdeanhill 2 7622 0 0 /news/imtakingmargatecuptieseriouslysaysabbott 1 3923 0 0 /news/erithbelvedere1-2tonbridgeangels-iwantmoregoalsdemandswarrilow 2 13204 0 0 /news/margateonthebrinkofheartbreak 2 7644 0 0 /news/NationalLeague020720 2 6238 0 0 /news/tonbridgeangels2-1maidstoneunited-tonbridgewinuglywestkentbattle 1 6643 0 0 /news/wehavenothitformyetandthereismoretocomesaysdoverathleticbossnickyforster 3 13898 0 0 /news/3rdsept04.html 1 0 0 0 /news/551a9c92232fd 2 14424 0 0 /news/551bc5de0acdd 1 4641 0 0 /news/bromley030816 3 14655 0 0 /news/lewes140717 5 18262 0 1 /news/rothwell200805.html 2 0 1 0 /cray-2003-2006/2 4 12401 0 0 /index.php 12 109092 4 11 /news/kentleague/sladegreen/lordswood111204.html 1 0 0 0 /news/tonbridgeangels2-2hastingsunited-refereeshouldbeofficiatingapubside-fumeswarrilow 1 7867 0 0 /archive-2006-2014/237 3 12909 0 0 /news/ramsgate250519 4 13666 0 0 /national-league/26 2 9679 0 0 /news/favershamtown0crockenhill0 1 5005 0 0 /news/bromvhamp251003.html 1 0 0 0 /news/werestilltryingtofindtheperfectformulasaysdoverathleticbosschriskinnear 5 19777 0 0 /news/bromleyinvestors100415 6 22628 2 1 /news/bromley100519 3 10290 0 0 /news/hythetown3-4lordswood-itwasembarrassingfrommypointofviewfumesscottporter 1 8144 0 0 /national-league/32 2 9404 0 0 /news/dartford201104.html 2 0 0 0 /news/kentleague/tunbridgewells/burytown111204.html 1 0 0 0 /news/TonbMcKimm080415 3 10340 0 0 /news/versatilehamiltonwantstosettleinoneplace 1 3702 0 0 /news/551bc5df0eabd 2 9496 0 0 /news/551a99e49cf5d 3 9696 0 0 /news/tonbridge250416 4 17446 0 0 /news/holmesdale110319 4 12564 0 0 /news/woking1-0dartford-itsabitterpilltoswallowadmitsdartfordbosstonyburman 1 7852 0 0 /news/folkestoneinvicta0fisherathletic1 2 9024 0 0 /news/dartsputkeepersthroughtheirpacesinaidofbritishheartfoundation 1 5227 0 1 /news/551bc5df952a3 1 4398 0 0 /news/braintree091004.html 2 0 0 0 /news/551a9c923cd13 4 41156 0 0 /news/soccershortskentclubsstartmakingearlysignings 2 13837 1 0 /assets/fileman/lang/fr.json 1 3950 0 0 /news/theroadtowembleyfacarlsbergvasefourthrounddraw 1 3563 0 0 /news/lordswood171116 3 12077 0 0 /news/billericaytown3-0tonbridgeangelsariswemustturnthecorner-exclusiveinterviews 3 19232 0 0 /news/551a9c0e44cf7 1 3640 0 0 /news/iwillnotrisklong-termfutureoftheclubinsistsangelschief 2 6828 0 0 /news/cubopeck280820 9 94023 1 2 /news/welling141216 4 14497 0 0 /news/thamesmead110416 4 16057 0 0 /news/551bc5e2645ce 1 4364 0 0 /maidstone-2003-2006 12 35930 0 0 /news/glebelt181116 3 35625 0 0 /news/imconfidentwewillgetbetterandbettersayscrockenhillbosscraigclark 2 6492 0 0 /news/favershamprepareforthebigone 3 15136 0 0 /news/cugleylambssendingoffwasaterribledecision 1 5424 0 0 /assets/ckeditor/skins/icy_orange/ 5 3139 0 0 /news/ryman/bromley/22nddec03.html 1 0 0 0 /news/maidstoneunited2-1corinthian-casuals-thiswasgreameandrewsbestgamefortheclub-saunders 1 5290 0 0 /news/jonesplotsfacupgiantkilling 1 4836 0 1 /news/551a931eb7eb4 1 4359 0 0 /news/ihaventthrownthetowelinorleftasinkingshipsaysjoefrancis 5 23827 0 0 /news/bromley060120 2 8430 0 0 /news/holmesdale1-2dulwichhamlet-lotsofpositivestotakeoutofthegamesaysrossmitchell 8 50802 5 6 /news/bringinginthreenewplayersisamotivationaltoolforotherstoclimbthetablesaysmarklane 2 9058 0 0 /news/maidstoneunited3-0chipstead-wevenotbeenatourbestadmitstable-toppingjaysaunders 3 17957 0 0 /news/ifwedontperformthenwellgetbeatwarnswellingunitedbossjamieday 3 18132 0 0 /news/smithitsgoodtotalktolocalschoolkidsaboutthefleet 3 11437 0 0 /news/551a97b0f416e 3 15555 0 0 /news/551a99e37ac42 1 4052 0 0 /news/12thoct05.html 3 0 0 0 /news/theroadtowembleyletsfinishoffthejob 1 6242 0 0 /news/walkersmakingsteadyprogressaheadofbigkentderby 2 13692 0 0 /news/matatasignsforhisthirdkentclub 3 9725 0 0 /news/gravesendnorthfleet2canveyisland0 2 10706 0 0 /news/holmstan091019 6 64604 0 0 /assets/smartmenus/demo/bootstrap-navbar-fixed-bottom.html 1 2575 0 0 /news/551bc5dc7dfd4 2 12900 0 0 /assets/ckeditor/plugins/image/ 5 1867 0 0 /news/kentleague/sladegreen/sladevbeck011103.html 1 0 0 0 /news/dockerssufferpenaltyheartacheagainstwells-wholosethreeplayers 3 11455 0 0 /news/thechairmanwouldkillmeifididnttakethefacupseriouslysaysvcdbosstonyrussell 4 21512 0 0 /news/drmartens/eastern/dartford/22ndoct04.html 1 0 0 0 /news/enfieldtown011005.html 1 0 0 0 /news/lewishamboroughunveilbillypiperastheirnewmanager 1 4013 0 0 /news/oldbholm120717 3 32591 0 0 /news/stevenstakescontroloftunbridgewells 2 5460 0 0 /news/erithbelvedere2-2folkestoneinvicta-alfiemaydeservesalltheplauditssaysmattlonghurst 6 123686 1 1 /news/bromleystand190518 3 15990 0 1 /news/electrictiessesignscontractforstones 2 7518 0 0 /news/shearersignsforfavershamtown 1 4416 0 0 /news/sevenoakstown0-6tunbridgewells-wewerethemastersofourowndownfalladmitssimonjones 2 25782 0 0 /news/craycars091016 2 19630 0 0 /news/fisher190205.html 1 0 0 0 /news/stonebridgeshowdowndartswanttofollowinthefleetsfootsteps-exclusiveinterviews 2 17476 0 0 /news/551a931e04599 2 7182 0 0 /news/bromholl150516 5 75544 1 1 /news/26thsept05.html 1 0 0 0 /news/hernebay300616 1 3181 0 0 /news/thamesmead290116 5 37102 2 1 /news/551bc5e6bbd98 3 12170 0 0 /news/ashfordtown2-3hastingsunited-wemuststartgettingwinsinsistsadlington-exclusive 4 57230 1 2 /news/metcalfweshowedthehearttowinourfirstgame 1 4290 0 0 /news/sevenoaks140118 2 8335 0 0 /news/wewanttogetoutofthisdivisionsayskentfootballunitedbosssammacneil 3 13611 0 0 /news/11thsept04.html 2 0 0 0 /news/551a9250145be 2 9304 0 0 /news/551a95b3ebd3c 4 16674 0 0 /news/551bc99a79c58 1 3657 0 0 /news/drmartens/eastern/folkestone/26thjune03.html 2 0 0 0 /news/horsham3-1maidstoneunited-humeleftfumingoverworthlessperformance 1 4903 1 0 /news/youcantaffordtomissyourchancessaysashfordunitedbosspaulchambers 2 7728 0 0 /news/newchathambossmilesaimsformidtable 6 23281 0 0 /news/daishcelebratesoneyearatfleetwithvictory 3 9986 0 0 /news/kfu111215 4 17770 1 0 /news/ramsunveilroystonsigning 2 6190 0 0 /news/everyoneattheclubisonamassivehighatthemomentsaysphoenixjoint-bosssteveoboyle 3 12430 0 0 /news/ivegonetoaclubthatibelieivewillbechallengingforhonoursagainsaysandyconstable 6 34832 0 0 /news/thelightsgooutatebbsfleetunited 1 4424 0 0 /news/551bc5e11e889 1 2948 0 0 /news/weknowwerenotgoingtowinitadmitsabbott 1 3373 0 0 /news/cupholdersramsgatehandedhomekentderby 2 7124 0 0 /news/myplayerswanttofinishthejobtheyvestartedsayshernebaybosssimonhalsey 1 5816 0 0 /news/kentleague/cray/6thdec04.html 1 0 0 0 /news/551bc5df8e0d0 1 3860 0 0 /news/551a92509b3cc 2 6908 0 0 /news/conference/gravesend/28thaug03.html 1 0 0 0 /news/chatholl090219 5 60288 0 0 /news/burmanpleasedwithhisstrengthindeptth 2 10406 0 0 /news/lisneytellsbig-spendingcroydonathleticdonotunder-estimateus 1 5273 0 0 /news/margate180320 2 5824 0 0 /news/kingstonian2-0craywanderers-itwillkillmeifwedontgoup-jenkins 2 13222 0 0 /news/craywanderers1-2doverathletic-webeleivewecanwinthetitlesaysnolan-exclusives 1 6778 0 1 /news/chathamtown2-2tootingmitchamunited 2 7320 0 0 /news/drmartens/eastern/tonbridge/16thaug03.html 1 0 0 0 /national-league/13 2 10057 0 0 /news/FAVaseFATrophystatement210320 3 9277 0 0 /news/dulwichhamlet0-2sittingbourne-no-onewillwanttoplayusinplay-offssaysabbott 2 11092 0 0 /news/6thoct04.html 2 0 0 0 /news/weveplayedthebestfootballandbeenthebestsideallseasonsaysvickerschampionbenpayne 3 15387 0 0 /news/itsimportantwegiveeverythingtogetintotheplay-offssaysdoverathleticskippershanehuke 1 4266 0 0 /news/hastings191219 3 11797 0 0 /news/glebepalmer200515 4 21990 0 1 /news/getbehindtheteamdoverchairmantellsfans 4 21666 0 0 /news/itspointsontheboardthatmatter-wehavetowinourgamesinhandsaysalexobrien 1 4308 0 0 /news/ourrecordbreakingleaguepositionisdowntolaurenthamicisgoalssaysjenkins 1 4832 0 0 /news/kentleague/deal/15thaug03.html 1 0 0 0 /news/oboylewantsmorehardgraftfromhisdockers 1 3909 0 0 /news/weregoingforatrebletoosaysmcmahon-exclusiveinterview 1 3785 0 0 /news/fisherreturntotheirrootsforfansmeeting 2 7338 1 0 /news/551bc5e1f010b 2 8544 0 0 /news/kentleague/maidstone/16feb04.html 1 0 0 0 /news/ryman/bromley/23rdjune03.html 2 0 0 0 /news/551bc5dd3a4a1 3 11999 0 0 /news/facupspecialfirstqualifyingroundpreviews 2 6601 0 0 /news/bromley171119 3 18677 0 0 /news/themovetowoodstockwillbreathenewlifeintotheclubsayssittingbournechairmanandyspice 2 14310 0 0 /news/551a956bc33ac 1 4053 0 0 /news/551a96dbd27ab 2 6341 0 0 /news/551a9c91a5c1b 2 9257 0 0 /news/welling211217 3 10713 0 0 /news/wecouldfoldinayearifwedonthaveanyfinanceswarnsthamesmeadtownmanagerkeithmcmahon 1 5321 0 0 /news/bromley2-4woking-wehavetoconsiderouroptionssaysbromleybossmarkgoldberg 1 7071 0 0 /news/whitstable140318 2 7347 0 1 /news/ebbsfleet301215 4 14006 0 0 /news/carruthersreturnstoashfordtown 2 6520 0 0 /news/hampttonb171219 3 19105 0 0 /news/barton261105.html 1 0 0 0 /news/tunbridgewells1-5thamesmeadtown 2 10912 0 0 /news/bearsted240818 1 3575 0 0 /maidstone-2003-2006/2 3 8994 0 0 /news/tapletoppingangelsdefybookiesodds-exclusiveinterviews 4 21932 0 0 /news/losingmaidstoneunitedwillbefinancialblow 2 7078 0 0 /news/kentleague/VCD/19thnov04.html 1 0 0 0 /news/ashfordunited260618 4 13633 0 0 /assets/ckeditor/plugins/smiley/ 5 1891 0 0 /news/wewanttogetthehabitofwinninggamessaysebbsfleetunitedbossliamdaish 1 4567 0 0 /news/hollandsblair041215 4 23431 1 0 /news/ryman/bromley/bromvegh021203.html 1 0 0 0 /news/551bc5e80424b 1 3496 0 0 /news/tunwhigh240115 4 56664 1 1 /news/daishhasdoneasterlingjobatfleetsaysrivalevans 2 7202 0 0 /news/18thsept03.html 2 0 0 0 /news/dealcanterbury280217 1 3580 0 0 /news/worcesetercity2-1greenwichborough-itwouldhavebeengreattobeinthehatsayspaulblade 2 17196 0 0 /news/conferencesealtwo-yeardealwithbtsporttoscreenlivepremiergames 6 31801 0 1 /news/hopefullywecangetourseasonbackontrackandturnmaidstoneoversaysscottporter 3 13771 0 0 /news/dartford0-1forestgreenrovers 2 11024 0 0 /news/hythetownunveiltrevorkennettastheirnewchairman 6 44205 3 2 /news/gravesham230517 3 12636 0 0 /archive-2006-2014/143 4 18887 0 0 /news/margatestarwaynewilsonputsthethanetcommunityfirst 3 20961 2 2 /news/tonbridge190318 1 3384 0 0 /news/551bc99d35a02 1 4839 0 0 /assets/fileman/php/thumb.php 1 45 0 0 /news/dartford160618 3 9393 0 0 /news/551a9677b6165 1 3318 0 0 /news/551bc5dc8e414 2 8448 0 0 /news/othernews/youthleaguefixtures230104.html 1 0 0 0 /news/ksports171116 4 15313 0 0 /news/play-offfinalitsnogoodbeinginthefinalfinishingsecondsaystommysampson 2 10867 0 1 /news/eltham291216 4 17612 0 0 /margate-2003-2006 12 36373 0 1 /news/wellingunited1-1teambath-fordruesbadweek 1 5598 0 0 /news/angelsappointblewdenasnewreserveteamboss 2 7037 0 0 /news/nortonsports1-2hernebay-itsgoingtobeahardslogwarnshernebaybosssimonhalsey 2 16247 1 0 /southern-counties-east-football-league/29 7 32264 0 0 /news/kennington260720 2 6980 0 0 /news/glebe070220 2 7338 0 0 /news/551a956cceacd 1 4433 0 0 /archive-2006-2014/168 4 17844 0 0 /news/551bc5df4e785 1 3749 0 0 /news/scallyplaysdowngillsembargo 4 11978 0 0 /news/551a931dbac22 2 7226 0 0 /news/greenlord160815 4 42822 0 0 /news/20thsept04.html 2 0 0 0 /news/beckerithbel101015 4 68227 1 1 /news/aldershot280904.html 1 0 0 0 /news/beckfish240216 4 38767 0 0 /news/wejustneedtotryandcompletethejobwevestartedsaysphoenixjoint-bosstonybeckingham 2 14806 0 0 /news/vcd260305.html 1 0 0 0 /news/worcester081005.html 2 0 0 0 /news/crayvalley230516 4 14017 0 0 /news/crowborough270420 5 15773 0 0 /news/ramsgate0-1leatherhead-wedontwanttobemidtablealso-ranssaysramsgatebosstimdixon 5 51205 0 0 /news/farleypleasedwithhiscomeback-exclusive 1 4342 0 0 /national-league/2 7 45372 2 1 /news/lewglekfu101215 4 17026 0 0 /news/otford290318 2 7948 0 0 /news/folkestone290805.html 1 0 0 0 /news/kessellsignsfordartsfollowingtonightstrainingsession 2 7806 1 1 /news/8thaug03.html 1 0 0 0 /news/kentleague/cray/1stnov03.html 1 0 0 0 /news/sittingbourne0a0chipstead-pairturndownmoveawayfrombournepark 2 8101 0 0 /news/551a979ab1b9c 1 5624 0 0 /news/rymanleaguetransfernewsbarnesonthemoveagain-cugleyreaches500thgamemilestone 3 16316 1 0 /assets/select2/docs/_layouts/home.html 1 592 0 0 /news/carlrookhasdroppeddownalevelasheseesourdesiresayswhitstabletownchairmangaryjohnson 6 23485 0 0 /news/rusttunw040716 5 30405 1 1 /news/551bc5df1d866 1 4782 0 0 /news/doverchairmanurgesfanstoraisethevolume 1 3953 0 0 /news/551a96777d843 1 3650 0 0 /news/thereisachancehereforcanterburytohavearealproudassetsayschairmantimclark 3 13040 0 0 /news/551bc5e4ac4e7 1 3377 0 0 /news/conference/gravesend/gravesend.html 2 0 0 0 /news/bearsted210417 3 12799 1 1 /news/551a96776660e 1 4466 0 0 /news/meadbosskeithmcmahonunveilsthesigningofstrikerstuartking 1 4203 0 1 /news/heybridgeswifts0-0dartford-burmanbeginssearchforcodyreplacement 2 10548 0 0 /news/tommysampsonmessagesofsupport 1 4880 0 1 /news/ashford091104.html 2 0 0 0 /news/551bc5db832bf 4 13734 0 0 /news/551a97b16fcf4 1 5017 0 0 /news/weregoingforthatfinalspotsaysburton-exclusive 1 3747 0 0 /news/551a92500eb40 4 18882 0 0 /news/promotionisalwaysgoingtobethetargetofthisclubinthisleaguesaysdoverbossmartinhayes 1 4260 0 0 /news/sittingbourne260918 3 13362 0 0 /news/phoenixsports3-3dealtown7-8pensitsachancetogetournameonthemapsaysdarrenanslow 3 33906 0 0 /news/newsigningsbringfreshhopeforfolkestone-exclusiveinterviews 2 11090 0 1 /news/carrolldropsbromleyabombshell 1 3163 0 0 /news/kentnon-leaguesoccerfeaturesheavilyinnewsportsmagazine 1 4593 0 0 /news/kennshor111020 9 84565 0 0 /news/5thdec05.html 2 0 0 0 /news/wfinchley120305.html 1 0 0 0 /news/26thoct03.html 1 0 0 0 /news/saturdaysreportsmarshallimhappyatwhitstable 3 35495 1 0 /news/sindensmoveisnotmoneymotivatedinsistsluchford 2 9505 0 1 /news/bromfarn170315 4 34510 0 0 /news/premiershiprefereeattendsthanetmeeting 2 8298 0 0 /news/graysunveilkedwellsigning 2 6176 0 0 /news/551a979810a62 2 8679 0 0 /news/kentleague/lordswood/31stoct04.html 1 0 0 0 /news/hodgsonshownthedoor 2 5982 0 0 /news/youneedagoodhomerecordandtogethernesssaysthamesmeadtownbosskeithmcmahon 2 8864 0 0 /news/tonbridgeangelssignlewishamilton 1 5631 0 0 /news/kentleague/hernebay/24thsept03.html 1 0 0 0 /archive-2006-2014/210 2 9172 0 0 /archive-2006-2014/62 2 10052 0 0 /news/snodlandtown251118 7 24773 5 0 /news/mcpheerelishesplainmoorreturn 2 8878 0 0 /news/dulwich010116 3 10515 0 0 /news/551bc5e69bafe 6 62644 2 3 /news/glebe201116 3 12639 0 0 /news/bearsted150920 5 21818 2 2 /news/facupteamnewslovelldespondentoverbrowningloss 1 4377 0 0 /news/itstakenusafewmonthstogetintoourstrideadmitsfisherbossbillywalton 2 9306 0 0 /news/kentleague/tunbridgewells/whitstable140804.html 1 0 0 0 /news/thameshorn211215 4 39796 0 0 /news/16thjan05.html 1 0 0 0 /archive-2006-2014/84 1 5045 0 0 /news/551bc5e68abcf 3 13826 0 0 /news/bromley160817 1 6149 0 0 /news/thebigkickoffmyaimispromotionsaysburman-exclusive 1 4553 0 0 /news/doverathletic141120 3 10649 0 0 /news/stansfeld131220 4 22232 0 0 /news/vcdathletic0-2maidstoneunited-tonyrusselliexpectthemtogiveeverythingforthisclub 3 29906 0 0 /news/punjab011017 3 10941 0 0 /news/551a96db5f2e4 2 8881 0 0 /news/ontheairwavesourequaliserdidnotcrossthelineadmitsburman 2 12396 0 0 /news/551a956c3f311 1 4676 0 0 /news/doverathleticsignchelseaaceonloan 1 4211 0 0 /news/beckenham281217 2 7872 1 0 /archive-2006-2014/124 4 17981 0 0 /news/imhereforthelong-termsaysburman-exclusiveinterview 2 8537 0 1 /news/hopefullywecandoourselvesjusticeatwokingsayswellingunitedplayer-managerjamieday 1 4424 0 0 /news/EbbsKiernan010415 4 13946 0 0 /news/taxmanclampsdownonkentleagueclubs 2 8570 0 0 /news/551bc99a777ad 1 3955 0 0 /news/wearereadyforthefightinsistsbirthdayboycugley 2 10096 0 0 /news/thefacupsecondrounddrawrevised 2 6264 0 0 /news/tonbridgeangels2-1ashfordtown-allmaniscommittedtoashfordinsiststhorogood-exclusive 5 31240 0 0 /news/craybear270319 4 40042 0 0 /news/thefacupisalwaysadifficultcompetitionwarnssemi-finalistpaulmccarthy 1 5955 0 1 /news/drmartens/eastern/dartford/dartford.html 2 0 0 0 /news/farnborough070318 2 8502 0 0 /news/ithinkthisisanexcitingtimeforholmesdalesaysbosspaulproctor 2 7620 0 0 /assets/ckeditor/plugins/clipboard/dialogs/ 1 377 0 0 /news/mangotsfield081005.html 1 0 0 0 /news/maidstone130618 3 11433 0 0 /news/weneedtocontinuethegoodworksayshernebaybosssamdenly 1 4058 0 0 /news/551a95b3b9f84 2 7674 0 0 /news/ihavedecidedtotakeastepbackfrommanagementtofocusonoff-the-pitchmatterssaysleehill 1 3514 0 0 /news/icanmakethegradeinsiststrialistbonneywell-exclusiveinterview 4 19060 0 0 /news/eandblonghurst160515 4 16601 0 0 /news/maidstone260620 2 6410 0 0 /news/othernews/24thJan04A.html 1 0 0 0 /news/phoevcd011215 3 36513 0 0 /news/hythe220105.html 2 0 0 0 /news/hythetownmidfielderronniedolanofferedtrialatwellingunited 6 19958 0 0 /news/whitstable280320 3 13310 0 0 /news/othernews/1staug04goals.html 1 0 0 0 /index/api/config 2 9240 0 1 /news/folkestoneinvicta1-1chathamtown-thewindspoiltthegameadmitrivals 1 5944 0 0 /news/551a97991cb1b 2 11034 0 0 /news/thanettussleisagreatoccasionforthefanssaysward-exclusive 1 4508 0 0 /news/wereworkinghardtoimproveourhomeformsaysdoverathleticbossnickyforster 1 5100 0 0 /news/ashvbromleyfac130903.html 2 0 0 0 /news/championsobrienpaystributetodartstravellingfans 1 5181 0 0 /news/drmartens/eastern/ashford/30thDec2003.html 1 0 0 0 /news/neilbell110318 4 12405 0 0 /news/tonbrigeangels2-0chathamtown-werenotplayingwellenoughadmitswarrilow 2 11836 0 0 /news/551bc5e71f5aa 2 8648 0 0 /news/tonightsfixtures27thfebruary2006 4 12530 0 0 /news/afchornchurch1-1wellingunited 3 15203 0 0 /news/manchester270517 3 12877 1 0 /news/gregoryupbeatuponhisreturnhome 2 8198 1 1 /news/551bc5dae876c 2 8364 0 0 /news/londonfa081015 7 71190 2 2 /news/ifeelthatihavegivenitagoodshotsaysex-bearstedbosstonycornwell 4 16880 0 0 /news/burtonsfuturehangsinthebalance 1 5236 0 0 /news/wejustthoughtweneededtochangeitupslightlysayssittingbournejoint-bossnickdavis 1 3976 0 0 /news/ashford220218 1 4009 0 0 /news/crayvcorin230316 4 42270 0 0 /news/sctstan150917 4 35658 0 0 /news/KentFAStatement101220 7 38682 1 1 /news/551bc5dd72363 2 8092 0 0 /news/sittingbourne1-0doverathletic-youhavetofightforyourplaceback-hessandabbott 2 12784 0 0 /news/tonbridgeangels2-1maidstoneunited-wewanttokeeptheseasonalivesayswarrilow 1 7340 0 0 /news/sittingbournechairmanpaystributetooutgoingreserveteamboss 2 6713 0 0 /news/greenwich140804.html 1 0 0 0 /news/stayingfitwillmakeabigdifferencesayscugley 1 4613 0 0 /news/551bc99babdde 1 4749 0 0 /news/551bc5e45b3a9 1 3739 0 0 /news/greendeal160415 3 28982 0 1 /news/daishpraiseshisminnows-matchreportsfromourtopgames 2 23426 0 1 /news/thamesmead011204.html 1 0 0 0 /news/shorts020615 4 25122 0 0 /news/everythingseemstobegoingtherightwaysayslordswoodbossjasonlillis 3 12546 0 0 /news/cpalace221216 4 15346 0 1 /news/ashfordsigntwotostaveoffrelegation 2 7768 1 1 /news/erithtown2-1beckenhamtown-thedesiretowinwasntquitetheresaystonyrussell 3 26774 0 0 /news/tonbridgejuniordian200715 4 16997 0 0 /news/fixtureback-logisatallordersaysfleetbossdaish 1 4814 0 0 /news/kentleague/maidstone/maidvlord271203.html 1 0 0 0 /news/facupspecialpennockweneedyoursupporttosendusthrough 1 4377 0 0 /news/551a9bafd452b 4 21488 0 1 /news/fixtures17-18thfebruary2006 3 11913 0 0 /news/crawley301205.html 4 0 0 0 /news/bromley161017 2 8452 0 0 /news/iamconfidentwecanbuildonsuccesssaysnewbosslevett 1 3612 0 0 /news/kentleague/VCD/4thsept03.html 1 0 0 0 /news/1stoct04.html 1 0 0 0 /news/werecontinuingtoworkhardonaddingtothesquadsayswellingunitedbossjamieday 5 24395 0 0 /news/551bc99a8be18 1 3282 0 0 /news/551a956cd87a1 1 5699 0 0 /news/tonbridge070916 2 9254 1 0 /news/kentleague/deal/Sampson2.html 1 0 0 0 /news/holmesdalefernandes280715 4 14286 0 0 /news/sevenoaks291005.html 1 0 0 0 /news/reports 2 23728 1 0 /news/warrilowwemustgetbacktobasicsandclimbtheleaguetable 2 8002 0 0 /news/551bc99b1a4ee 1 4623 0 0 /news/margeast020917 4 38590 0 0 /news/wemustmatchwhitstablesenthusiasmtoliftcupsaysford 2 7240 0 0 /news/craywanderers1-2metropolitanpolice-jenkinstellshisplayerstolettheirhairdown 1 6357 0 0 /news/weprobablyneedthreeorfourverygoodplayerstomountachallengesaysoboyle 2 7756 0 0 /news/iwanttogetachairmantoputsomemoneyintotheclubsaysbeckenhamtownbossjasonhuntley 4 19928 0 0 /news/sampsonannounceshisretirementfromfootballmanagement 1 3651 0 0 /news/hernebay1-0larkhallathletic-wecantletthevaseslipthroughourfingerssayssimonhalsey 2 16525 0 0 /news/greenwichborough2-3whyteleafe-wearerefusingtolosesayswhyteleafebossjohnfowler 3 29144 1 1 /news/551a96db91064 5 29835 1 1 /news/folkestoneinvictaunveilchriselliottsigning 6 24024 0 0 /news/kentleague/cray/AFCWimbeldon041204.html 1 0 0 0 /news/weareheadingintherightdirectionsaysseager 2 9014 0 0 /news/vickersleftinthedark 1 14705 1 1 /news/thisisundoubtedlytheworstplayershortageihaveenduredin4yearsofmanagementadmitsfoley 1 4041 0 0 /news/maidstoneunited2-0hernebay-ithoughtweweredisapointingtodayadmitsjaysaunders 3 28558 1 0 /news/ryman/bromley/bromvstai041103.html 1 0 0 0 /news/551a9c931f85f 2 11411 0 0 /news/lyddtown1-1hollandsblair-imconvincnedtheresgoingtobetwistsandturnssayssmith 2 18418 0 0 /news/551bc5dc98f3b 2 8070 0 0 /assets/fileman/lang/en.json 1 3173 0 0 /news/corlord290917 4 40576 2 2 /news/glebebrom200716 4 40318 0 0 /news/brombris191119 4 38100 0 0 /news/551bc5dc3dc02 1 4388 0 0 /news/wevecomeonleapsandboundsduringmysixyearsincharge-suttonathleticbossguyeldridge 2 9010 1 1 /news/dartford6-1suttonunited-everyoneinthestadiumwaspleasedwiththatsaystonyburman 1 6020 0 0 /news/29thsept04.html 1 0 0 0 /news/crayhast210816 2 18187 0 0 /news/drmartens/eastern/sittingbourne/12thsept04.html 1 0 0 0 /news/greenwich260518 4 13072 1 0 /news/othernews/YLFIX280104.html 1 0 0 0 /news/margate4-5folkestoneinvicta-cugleyhasfaithinyoungstersforgreatescape 1 6796 0 0 /news/robbinsgetshiscroydoncareerofftoawinningstart 1 3830 0 0 /news/greenwich220917 3 9944 0 0 /news/erithbelvedere3-2vcdathletic-wedliketoemulatewhathernebaydidsaysmickycollins 3 29351 0 0 /news/hytheunveildentasnewfirstteamcoach 2 8162 0 0 /news/bridon021015 3 11379 0 0 /news/eltham280816 3 12120 0 0 /news/dealtownsearchforfriendlyonsaturday 2 5438 0 0 /news/wetweathercausesfixturehavoc 2 7470 0 0 /news/erithbelvedere0-4hernebay-wecouldntbewherewearewithout20playerssayssimonhalsey 1 6714 0 0 /news/beckenham220105.html 1 0 0 0 /assets/images/jquery-ui/ 8 5097 0 0 /erith-town-2003-2006 13 38989 0 0 /news/imdelightedthatjakeandkurtishaveagreedtostayforthenewseasonsaysjamieday 3 11027 0 0 /news/lordswood150305.html 1 0 0 0 /news/foresthillpark260518 3 9657 0 0 /news/dartkidd040115 3 24563 0 0 /news/bromley030118 3 15135 0 0 /news/dartford170620 2 7114 0 0 /news/551a9c9170f6d 1 3456 0 0 /news/phoenixsports091118 4 18598 0 0 /news/charltonlegends240516 4 14204 1 1 /news/powellmakesconferencehistory 1 3265 0 0 /news/maidstone150519 4 16037 0 0 /news/goalkeeperjackdelosetforhernebayreturn 4 14381 1 0 /news/551a925050d11 6 39543 1 2 /news/tonbridgeangels1-5gravesendnorthfleet 4 51548 0 2 /southern-counties-east-football-league/6 4 34187 1 1 /news/razorpowellwillcutitatmaidstoneinsistswalker 5 17640 0 0 /news/drmartens/eastern/erith&belvedere/arlesey201104.html 1 0 0 0 /news/hernebay230320 2 8622 0 0 /news/maidstone220118 3 13221 0 0 /news/soccershorts040716 3 21434 0 0 /news/corbytown2chathamtown0 3 10979 0 0 /news/whitstabletownbeginsearchforreserveteamcoach 1 3199 0 0 /news/timesarehardbutwellcopewithitsaysfolkestoneinvictabossneilcugley 2 8326 0 0 /news/sevenoakstown171119 3 21080 0 0 /news/erithbelvedere4-2thamesmeadtown-managerofthemonthcursestrikesmcmahon 1 4692 0 0 /news/eastkentcollegebossescelebratebeingtopoftheclass 4 22234 0 0 /assets/fonts/academy/academy_engraved-webfont.eot 1 33407 0 0 /news/551bc5e63ee03 1 6003 0 0 /news/staplehurst260520 2 7090 0 0 /kent-invicta-league/2 7 50052 1 2 /news/isthmianleague180919 5 22512 0 0 /news/folkestoneurgentlyneedcashinjectionfollowingcupexit 1 4256 0 0 /news/551bc5da57f61 3 12629 0 0 /assets/images/site/banners/Thumbs.db 1 23040 0 0 /news/weknowwhatwevegotinourchangingroomsaystunbridgewellsbossmartinlarkin 1 3734 0 0 /news/ebbsfleetunited0-1histon-daishrantatten-cardtrickreferee 1 6362 0 0 /assets/uploads/content/Bradley_Goldberg_scores_winner_a 1 29564 0 0 /news/canterbury080116 4 14262 0 0 /news/quartetwalkoutoftunbridgewellsfollowingfarniesacking-exclusive 1 4303 1 0 /news/ifweplayaswecanweoughttogettheresultthatwewantsaysneilcugley 1 4179 0 0 /news/bromley0-1chelmsfordcity-wehadourchanceanddidnttakeitadmitsbromleysmarkgoldberg 3 23057 0 0 /news/551bc5dc3545b 1 3341 0 0 /news/gessstunningstrikehelpswhitstablebeatbedfont 5 17680 0 0 /news/doversigntheirknightinshiningarmour 1 4712 0 0 /news/clarkesuffershorrificinjury 2 6652 0 0 /news/551a96dbc4a19 1 3153 0 0 /news/12thdec05.html 2 0 0 0 /news/credittotheboystheyweresuperbsayshythetownbossscottporter 3 12904 0 0 /news/yourcompanycansponsorthiswebsiteforjust3000 1 2779 1 0 /news/humehailssupermario 4 15464 0 0 /news/gravesendnorthfleet2doverathletic0exclusiveinterviews 4 22049 0 0 /news/wereallitchingtogetbackinactionathomesaysfolkestoneinvictabossneilcugley 2 12486 0 0 /news/551bc5e16f03d 1 4702 0 0 /news/falanaurgestonbridgefaithfulweneedyoursupportexclusiveinterview 1 3992 0 0 /news/wellingunited0-1eastbourneborough-welackedbelief-admitsdisappointedday 1 5826 0 0 /news/fisher1-2holmesdale-wewanttofinishtheseasononahighsaysrossmitchell 2 14714 0 0 /news/bromley161218 4 18470 0 0 /news/milesrelishesnewrole-exclusiveinterview 6 25448 0 0 /news/chatham090217 1 4423 0 0 /news/drmartens/eastern/sittingbourne/sittvchar170704.html 1 0 0 0 /news/kentleague/thamesmead/cray070804.html 1 0 0 0 /news/werenotgoingtomakethenumbersupinsistslangton 1 4491 0 0 /archive-2006-2014/213 2 8946 0 0 /news/crowborough010116 3 10956 0 0 /news/folkestonesquadbeginstotakeshape 2 8122 0 1 /news/greenwich221217 1 3927 0 0 /news/551bc5dd2c9a9 1 4235 0 0 /news/kentleague/cray/crayvsudb210204.html 1 0 0 0 /news/ifeelitsadisgracehowtheclubhavebeentreatedbybromleycouncilsaysgaryhillman 3 21072 1 1 /news/ourfantasticsupportersdeservetofinishtheseasonathomeonahighsaysbromleycoachsmith 1 6022 0 0 /news/551a9baff02a1 3 10359 0 0 /news/tonbridgeangels0-1ramsgate-dolbycomplainsaboutmorepoorrefereeing-exclusiveinterview 1 6115 0 0 /assets/ckeditor/plugins/scayt/LICENSE.md 1 1476 0 0 /news/erithandbelvedere300519 3 14457 0 0 /news/wearesorrytobelosingjameseverittsaysfolkestoneinvictachairmanmarkjenner 2 7316 0 0 /news/kentleague/maidstone/25thaug03.html 1 0 0 0 /news/drmartens/eastern/tonbridge/22ndsept04.html 1 0 0 0 /news/lewishamborough1-2sevenacresidcup-thishasbeenmymostfrustratingtime-osullivan 2 18356 0 0 /news/551bc5e86a518 3 10298 0 0 /news/margate221105.html 1 0 0 0 /news/elmswell260417 3 36719 0 0 /news/ramsgate011119 2 7334 0 0 /news/wewanttotargetfifth-placesaysdoverathleticbossnickyforster 1 3716 0 0 /news/cugleyfindsshort-termkessellreplacement 2 6194 0 0 /news/551bc5dba1802 3 13219 0 0 /news/bromashot160816 3 28893 0 0 /news/551a9677b31f4 3 11826 0 0 /news/hernebay1-2erithbelvedere-hopefullywevedoneourselvesjusticesayscollins 2 15188 0 0 /news/drmartens/eastern/folkestone/leyton240804.html 1 0 0 0 /news/tonbridgeangelsvice-chairmanquitsduetohealthscare 1 3835 0 0 /news/theplayershavegottogooutthereanddoitsayshollandsblairbosspaulpiggott 5 20800 0 0 /news/fleetladiesitisourintentiontocontinuetoriseashighaspossible 1 3906 0 0 /news/phoesoh080417 1 10069 0 0 /news/lindseyreturnstofolkestoneascoach 1 5481 0 0 /news/mooreimpressesinmidfieldasfleetbounceback 1 3438 0 0 /news/itsvitalwemaketherightdecisionsaysdoverathleticchairman 1 3061 0 0 /news/werereallyfiredupandlookingforwardtotheseasonsayscraywanderersbosskeithbird 4 19845 0 0 /news/weveturnedthecornersayskentfootballunitedbosssammacneil 3 13967 0 0 /news/kentleague/sevenoaks/15thjuly03.html 2 0 0 0 /news/ramsgate2fleettown0includingtodaysresults 5 30015 2 1 /news/craytoot220217 1 10304 0 0 /news/whitebringsindagenhamstrikertogivedoverthecuttingedge 1 6574 0 0 /news/drmartens/eastern/folkestone/braintree271104.html 1 0 0 0 /news/ashfordtown1-3tonbridgeangels-martindemandsacontractaftertwogoalssendsangelsthrough 2 10172 0 0 /news/cugleydisappointedwithlatepostponementbynegativereferee-exclusive 1 4348 1 0 /news/kentleague/cray/20thaug04A.html 1 0 0 0 /news/greenwichborough1-0redhill-wereputtingtheclubonthemapsayspaulblade 3 24242 1 0 /news/wellcomebackevenstrongernextseasonsaysramsgatechiefrichardlawson 1 5497 0 0 /news/wellchar200917 2 16940 1 0 /news/foresthill060917 4 14317 0 0 /news/551a979925585 2 11322 0 0 /news/551a95b3d83f8 4 17506 1 0 /news/soccershortsihadnothingwhenifirstarrivedatholmesdalerevealsdavies 1 10989 0 0 /news/551bc99d9534b 1 5800 0 0 /news/afccbear100917 1 9798 0 0 /news/551a96777fd63 4 25562 0 0 /news/ryman/bromley/18thjuly03.html 2 0 0 0 /news/ryman/bromley/bromvmetr151103.html 1 0 0 0 /news/ebbsfleetunited0-1stevenageborough-theygavemeeverythingsayscrestfallendaish 1 7015 0 0 /news/551a97b1d7b03 1 5277 0 0 /news/ifwecaneliminatethepersonalmistakeswewillturnitaroundsaysgreenwichboroughboss 1 4047 0 0 /news/farnborough070420 2 8290 0 0 /news/erithwhyt230817 2 21054 1 1 /news/551bc5ddb6fe1 1 3420 0 0 /news/crayvalleypm1-0chathamtown-ivegottogetagreatteamtogethersaysstevechapman 5 44710 0 0 /news/erithdartfordtown0-4phoenixsports-wewerentgoodenoughtonightadmitsembarrassedabbott 1 7259 0 0 /news/lewisham091118 4 15030 0 1 /news/imlookingforwardtogoingbacktoashfordsaysjohncumberbatch 5 27610 0 0 /news/whitstable01101 4 18480 0 1 /news/hythe230915 3 11622 0 0 /news/fisher1-2beckenhamtown-wehaveaplayertodiefor-insistspowell 7 175648 5 4 /news/crayvalley280419 3 17385 0 0 /news/theendofthelineforsladegreen 1 5273 0 0 /news/wevegotagoodblendofyouthandexperienceinthesidesaysmaidstoneunitedbossjaysaunders 4 15157 0 1 /news/wevetriedeverythingtokeepbealessayswarrilow-exclusive 1 4623 0 0 /news/crayvbeck220116 4 11617 0 0 /assets/select2/tests/a11y/selection.html 1 395 0 0 /news/fisherbeck271216 2 21533 0 0 /news/551bc5dda6299 1 4537 0 0 /news/iurgethesupporterstocomeandsupportusoverthisdifficultspellsaysstonesbosspeternott 1 5163 1 0 /news/threepositionsupforgrabsatpromotedvcdathletic 5 15495 0 0 /archive-2006-2014/140 3 13905 0 0 /news/bromley5-0graysathletic-wevegotonehellofadifficulttieinthenextroundsaysgoldberg 4 33014 0 1 /news/wewanttobeinthekentinvictaleaguesaysmiltonfulstonbossaaronperry 3 19507 0 0 /news/whithast031219 4 35732 0 0 /news/wevehadlongenoughinthekentleagueadmitsfoley 1 3573 0 0 /news/wellbuildourfoundationsaroundmcdonnellsaysgoldberg 3 10858 1 2 /news/beckcroyath04112015 3 36936 0 0 /news/wefeelaxingbobpeetersistherightdecisionfortheclubsayscharltonchief 4 16740 0 0 /news/walkerwantshegleytostay 1 3318 0 0 /news/whenwerebackhomeitwillbeabigfishsaysfisherbossbillywalton 2 8473 0 0 /news/rusttonb080518 2 23090 0 0 /news/vcd160717 1 3941 0 0 /news/wemustrisetotheoccasion-exclusiveinterview 1 4081 0 0 /news/ryman/bromley/croydonvbrom160803.html 1 0 0 0 /news/26thaug04.html 1 0 0 0 /news/551a9c0f016e1 4 16013 0 0 /news/551bc5df2175f 1 3812 0 0 /news/greenwichborough1-2hythetown-itwasaveryprofessionalperformanceadmitsscottporter 2 14950 0 0 /news/kentishfootballaresoproudofthefleetletsmakeitawembleydoublesaysmccarthy 1 3885 0 0 /news/551a9677506ac 3 15993 0 0 /news/weneedeveryonepullingtogethersayswarrilow 1 4468 0 0 /news/craywands241218 4 19122 0 0 /news/facupshowdownathytheisofftheradarinsistsproudluchford 2 9156 0 0 /news/22ndapr05.html 2 0 0 0 /news/hessenthalerunveilssigningofenglandgoalkeeper 1 4153 0 0 /news/doverathleticunveilcollinandlovellsignings 1 4723 0 0 /news/tonbridge030217 1 3750 0 0 /news/woodstocksports0-4corinthian-imhopingwecanpullsomethingoutofthebagsaysbentaylor 1 8520 0 0 /news/theweekahead-5 2 7770 0 0 /news/ebbsfleet010116 4 18454 0 0 /news/harlowtown2-0chathamtown-youneedtoscorewhenyoureontopsayskevinwatson 1 8510 0 0 /news/jeffreyunveilskentyouthleaguerepsquad 5 38595 2 3 /archive-2006-2014/2 8 54578 1 1 /news/551a97b09f8b0 3 11172 0 0 /news/conference/gravesend/19thfeb04.html 1 0 0 0 /news/hfsphaml290820 5 47072 1 1 /archive-2006-2014/294 6 20992 0 1 /news/davecookneedstoworkhardtorecapturetheformheshowedinhisfirstspellheresaystimdixon 2 7088 0 0 /news/551bc5e5cbb0a 1 3849 0 0 /news/iwanttobeinvolvedwithaseriousambitiousclubsayschristuley 6 21944 0 0 /southern-counties-east-football-league/31 5 24579 0 0 /news/lilliswantsrymanfootballathernebayexclusiveinterview 1 4591 0 0 /news/551a9c9190d61 2 8936 0 0 /news/itsasadstateoffaffairsifwerenotpushingtowardstheplay-offssaysobrien 1 5567 1 0 /news/blyspartans1-1hollandsblair-itsgoingtobeverytoughtowinthisleaguesaysmatthume 2 30904 1 1 /news/fisher071105.html 2 0 0 0 /news/iwillcontinueasfirstteammanagersayslewishamboroughchairmanraysimpson 1 3975 0 0 /news/myplayersbeleiveinthemselvesnowsayssuttonathleticbossjamescollins 2 8272 0 0 /news/allantaitwillenjoyhisfootballheresaysfolkestoneinvictabossneilcugley 3 28328 2 1 /news/folkestoneinvicta2-3billericaytown 1 4448 0 0 /news/beinginthefatrophylasteightisagreatachievementsaysdartfordbosstonyburman 2 10482 0 0 /news/26thjan05.html 3 0 0 0 /southern-counties-east-football-league/49 2 8836 0 0 /news/551bc99cc460c 5 54851 1 3 /news/isaidtothechairmaniwillwintheleagueforhimsaysgreenwichboroughbossianjenkins 2 10700 0 0 /news/rochester260418 2 8182 0 0 /news/551a9c930bf75 1 4517 0 0 /news/drmartens/eastern/dartford/26thjune03.html 3 0 0 0 /news/histvsitt151103.html 2 0 0 0 /news/tunbridgewells1-2rusthall-impleasedmyboysdidthebusinesssaysproudronaldson 1 7787 0 0 /isthmian-league/24 5 24551 0 0 /assets/fonts/glyphicons-halflings-regular.woff 1 23320 0 0 /news/klickitout290516 4 19214 0 0 /news/drmartens/premier/dover/4thaug03.html 2 0 0 0 /news/rymanonesouthchampionshumepraisesallofhiselevencaptains-exclusiveinterview 1 4443 0 0 /news/551a9c91c755c 1 4754 0 0 /news/551a97b055a93 1 3060 0 0 /news/kentleague/whitstable/9thjuly03.html 2 0 0 0 /news/551a9718e63c3 3 14631 0 0 /news/551bc5df28bb8 1 5535 0 0 /news/elmstead230916 3 10938 0 0 /news/wevegotanopportunitytoholdontosecondplacesaysfavershamtownbossrayturner 2 7590 0 0 /news/martinscoopsbecksawards 1 3022 0 0 /news/silverwareismostdefinatelyontheagendasayssevenacresidcupbosschristuley 1 4353 0 0 /news/tophalfiswhatimlookingatsaysrusthallbosspaulmcdonagh 1 3837 0 0 /news/vcdbish190718 3 24348 0 0 /news/hastings130905.html 2 0 0 0 /news/simondavis 3 9044 0 0 /news/abingdon231004.html 2 0 0 0 /news/seagerremainsupbeatdespitebudgetcut-backs 2 9131 0 0 /news/othernews/FixOct2004.html 1 0 0 0 /news/ramsreportbackfitandraringtogo 1 4235 0 0 /news/crowborough290117 1 4715 0 0 /news/crowborough130619 4 14194 0 0 /news/kentleague/lordswood/erith131104.html 1 0 0 0 /news/championsdoverathletic6-0suttonunited-hessexpressrompstoleaguetitleinstyle 2 11781 0 0 /news/trottsatisfiedwithopeningwarm-up 1 3201 0 0 /news/ihavenoideawhenillbebacksayssampson 1 3828 0 0 /news/stonesshowdownisnotamust-wingameinsistswarrilow-exclusive 1 5111 0 0 /news/welling040118 3 13683 0 0 /news/craywands19042016 5 27647 1 1 /news/fleetpresentsummerschoolspectaculars 6 20294 0 0 /news/borehamwood2sittingbourne0 4 19493 0 0 /news/551bc5e4e0286 2 7140 0 0 /news/chathamtown2-3metropolitanpolice-wehaventreallyhadanyluckthisyearsayspaulfoley 1 6116 0 0 /news/551a979b1349f 2 10236 0 0 /news/hernebay280219 3 13755 0 0 /assets/ckeditor/LICENSE.md 1 68193 0 0 /news/23rdjune04.html 1 0 0 0 /news/porter30takesthereignsatreachfields 1 3755 0 0 /news/torqbrom100115 3 26834 0 0 /news/chatham241116 1 3523 0 0 /news/soccershortsstrugglingstonesdeferplayerswages 1 10604 0 0 /news/bromtorq160416 4 36642 0 0 /news/soccershorts230616 4 22746 0 0 /news/sunderlandfanraisesfundsforthefamiliesofnewcastlefanskilledinukraineplanetragedy 4 15526 0 0 /news/kissieboue241217 7 70646 5 4 /news/dartssealgroundsharedealwithlions 2 7545 0 1 /news/thamesmead140816 2 7494 0 0 /news/hollands160518 2 6619 0 0 /news/10thsept04.html 1 0 0 0 /news/glebe280119 3 9570 0 0 /news/NationalLeague211020 5 19550 1 1 /news/sittingbourne2-2crowboroughathletic-abbottwemuststopgivingsillygoalsaway 2 12882 0 0 /news/facarlsbergvasefourthrounddraw 2 6818 0 0 /news/551bc5db6ce4e 2 6673 0 0 /news/lordswood220218 2 7644 0 0 /news/phoenixsports300819 3 11055 0 1 /news/ashfordunitedacceptkentleaguepromotion 6 18985 0 0 /news/drmartens/eastern/erith&belvedere/7thjuly04.html 1 0 0 0 /news/bromley270717 1 6396 0 0 /news/crayvalley050516 4 14718 0 0 /news/551a9797f061a 2 8759 0 0 /news/hythesitt271115 3 14376 0 0 /news/wemustturnoverbillericayinsistsfuriouscraychairman 1 5417 0 0 /news/lovellkeenonglydereturn 1 3399 0 0 /news/551bc5df7ef78 1 4513 0 0 /news/stonesco-ownercountscostofwintryconditions 1 3911 0 0 /news/sampsonvowstoleadredhillintotherymanleague-exclusive 1 4974 0 0 /news/favershamtowntraveltochampionsleaguehopefuls 6 23613 0 0 /news/551a979898cea 4 19118 0 0 /news/cray271017 2 8274 0 0 /news/afccroydonathletic100818 1 3975 0 0 /news/erithtown2-0lordswood-noteamhasbeenbetterthanussaysdockersbosstonyrussell 2 14288 0 1 /news/551a9c9324815 2 12218 1 0 /news/leightontown110904A.html 2 0 0 0 /news/1staug05.html 2 0 0 0 /news/551a931db4ea7 1 3473 0 0 /news/iwanttogiveouryouthplayersanopportunityofimpressingfirstteamcoachessaysandyweeks 6 29210 0 0 /news/13thjune05.html 1 0 0 0 /news/FAstatement220920 2 8494 0 0 /news/pre-seasonresults 2 11690 0 0 /news/551bc5de4a5ba 2 7874 0 0 /news/idontthinkwererelyingonfacupmoneysayswellingunitedbossjamieday 1 3889 0 0 /news/551bc5e3d988b 2 10101 0 0 /news/9thaug05.html 1 0 0 0 /news/28thsept03.html 1 0 0 0 /news/ashford200517 1 3902 0 0 /news/cray260205.html 1 0 0 0 /news/corifish230219 5 58152 0 0 /news/dontexpecttoseeanyfamiliarfacesatfavershamsaysdoverathleticbossmartinhayes 1 4144 0 0 /news/stonesgivenonelastchance 1 3502 1 0 /news/gillingham040117 10 104604 5 5 /news/werealotmoreaheadofscheduleofourlong-termplansaystunbridgewellsbossmartinlarkin 1 4871 0 0 /news/wellingunitedmustfind60000inonlyfourteendaystosurvive 1 4605 0 0 /news/seniorsworldcup090616 7 59341 1 3 /news/drmartens/eastern/folkestone/6thaug04.html 1 0 0 0 /news/phoeash110415 4 74988 0 0 /news/sevehayw070120 6 34526 0 0 /news/favershamyoungstersadoptprofessionalapproach 2 8864 0 1 /news/facarlsbergtrophysecondrounddrawebbsfleettraveltodroylsden 1 3782 0 0 /news/551a92507b784 2 7845 0 0 /news/chatspartcompanywithobrienandwatts 1 3332 0 0 /news/croycroy071216 2 21872 0 0 /news/ashfordtown0-1croydonathletic 2 7871 1 0 /news/crowborough020417 1 4576 0 0 /news/faversham010617 2 7931 0 0 /news/1stmay05.html 1 0 0 0 /news/tunbridgewellsappointworldcupstarasdirectoroffootball-exclusive 5 18005 1 0 /news/othernews/gotravelkentleaguetables220204.html 1 0 0 0 /drmartens/premier/welling/4thjan05.html 1 2532 1 1 /news/thenationalleague.org.uk/national-league-statement-outcome-of-club-charges-65398 2 0 1 0 /news/kentleague/sevenoaks/hythe231004.html 1 0 0 0 /news/foleystrengthenshisvickerssquad 1 4456 0 0 /news/beckenham260120 2 8192 0 0 /news/invictafacealongandrockyroadaheadwarnsjenner 1 3812 0 1 /archive-2006-2014/70 2 9870 0 0 /news/dartford4-2bromley-weknewbromleyweregoingtohaveagosaysdartfordbosstonyburman 2 20180 0 0 /news/westandaverygoodchanceagainstchelmsfordinsistsburman 1 4207 0 0 /news/warrilowagoodqualitygametoplaytobounceback 2 8905 0 0 /news/soccershortscorinthianunveilcoachmattlonghurstastheirnewmanager 2 20094 0 0 /news/theclubwanttowinthefatrophyandithinkwecansaysdoverathleticmidfielderliambellamy 1 4798 0 0 /assets/select2/docs/dist/ 5 1593 0 0 /news/551a96dc3a9bc 4 23394 0 0 /news/551a9c0ea02da 3 13569 0 0 /news/whitstable151005.html 1 0 0 0 /news/fixturessaturday19thaugust2006 4 17068 0 0 /news/burmanupbeatdespitedisappointingopeningweek 1 3547 0 0 /news/bridtunb190918 4 40606 0 0 /news/werenotgoingtomakethenumbersupintheleaguesaysholmesdalecoachrossmitchell 4 17792 0 0 /news/wingate280804.html 2 0 0 0 /news/16thsept05.html 1 0 0 0 /news/moneydoesntalwaysbringhappinesssaysloyalstonesstrikershaunwelford 2 9250 0 0 /news/dulwich161116 1 3529 0 0 /news/canterbury260118 3 10290 0 0 /news/551bc99b12bcd 2 11798 0 0 /news/doverathletic1-1tootingmitchamunited-wehavetosettlefortheplay-offssayswalker 2 13572 0 0 /news/favershamtown1-0sevenoakstown-werenearlyoverthatlinesaysluchford 1 5702 0 0 /news/dulwichhamlet101220 2 7014 0 0 /news/wererelishingplayingtwogamesaweeksaysward 1 4715 0 0 /news/halseyoptstomovetohernebay 2 9013 1 0 /news/resultsmarch2009 2 10416 0 0 /news/551bc5e670a85 1 3167 0 0 /news/greenwichboroughchosentokick-offitvsportsfacupcoverage 2 7855 0 0 /news/toaskforconsistencyeveryweektakestimeorexperiencesayssittingbournebossnickdavis 3 11594 0 0 /news/pennockiwanttomovewingsforwardintotheconferenceexclusiveinterview 1 4102 0 0 /news/greenwich060718 3 9783 0 0 /news/myplayerswanttheirnamesinthepaperssaysdartfordbosstonyburman 2 9403 0 0 /news/folkestoneinvicta3-1worthing-johanterhorstshouldbeatafootballleagueclubsayscugley 2 16658 0 0 /news/eritherith261117 4 38886 0 0 /news/kingstonian3-0ashfordtown-lovellksthree-goalvictorywasflattering 2 13216 0 1 /news/vcdathletic1-2needhammarket-wewerementallygoneandlackedcharactersaystonyrussell 2 15679 0 0 /news/551bc99a7e299 1 4265 0 0 /news/holmgreen120815 4 51474 0 0 /news/othernews/AEI041004.html 1 0 0 0 /news/kentleague/greenwich/12thsept04.html 1 0 0 0 /news/drmartens/eastern/tonbridge/17thdec03.html 1 0 0 0 /news/nortonsportsbossbentayloraimingfortopeightfinish 2 8274 0 0 /news/wellingunited3-1bromley-warrenmcbeanisstayingatbromleysaysbarrymoore 3 22001 1 1 /news/12thjuly05.html 2 0 1 0 /news/heroroylarner070617 3 12226 0 0 /news/CONIFAWorldCupBhandal280518 3 14087 0 0 /news/ivebeeninfootballalongtimeandiveneverseenaleaguewonorlostongoalssayshalsey 1 6328 0 0 /news/hollands100219 4 16582 0 0 /news/551bc5e800da8 1 4391 0 0 /news/551a97b239509 1 3993 0 0 /news/551bc99a972de 2 7572 1 1 /news/551a9798e2459 2 10664 0 0 /news/folkestoneinvicta0-1wellingunited 1 5061 0 0 /news/551a92509a1a1 2 6292 0 0 /news/erithbelvedere3-3hollandsblairaet-1-3pens-thiswasnotourcupfinalsayspiggott 2 15177 0 0 /news/wehavetokeepgoingandkeepamongtheplay-offmixsaysramsgatebosstimdixon 3 14537 0 0 /news/erithandbelvedere090620 3 12366 0 0 /news/whitstable041204.html 2 0 0 0 /news/shorts110615 3 20677 0 0 /news/aylesbury221005.html 2 0 0 0 /news/folkestoneinvictafearpointsdeduction 2 8941 0 0 /news/theplayersneedtoembracethedaybutnotlettheoccasiongetthebetterofthemsayssamdenly 2 7648 0 0 /news/ifwestayupinourfirstseasonitwillbeafantasticachievementsayswellingbossjamieday 1 3985 0 0 /news/braintreetown3bromley1 3 12350 0 0 /news/craywanderers0-2billericaytown-dontperformandyoullbedroppedwarnsjenkins 2 14214 0 0 /news/kentleague/hythe/sevenoaks140804.html 1 0 0 0 /news/phoenixsports080319 3 11718 0 0 /news/charlsouth300816 3 25995 0 0 /news/wellchel050519 3 28905 0 0 /news/princesparkspecialexplosiveentrancemademyhairsonthebackofmyneckstandup 2 8244 0 0 /news/soccershorts260619 3 17688 0 0 /news/551bc5e684f12 1 3340 0 0 /news/ebbsfleetunited3-2leytonorient-daishreadytoofferdeals 2 12166 0 0 /news/erithtown090516 4 12169 0 0 /news/beckcrow021019 3 32562 0 0 /news/551bc5e740fd7 2 12445 0 0 /news/championshipmanagerrymanleaguecup-tripletroubleforkentsremainingthreesides 1 3235 0 1 /news/hendon051205.html 2 0 0 0 /news/kentleague/tunbridgewells/21stjuly04.html 1 0 0 0 /news/25thjuly05G.html 4 0 0 0 /news/maidstoneunited1-1ebbsfleetunited-ialwayslooktodobetterthanlastseasonsaysliamdaish 1 5473 0 0 /news/coneyhall2-2universityofkent-managersshouldsnapupourplayerssaystomparkinson 1 8179 0 0 /news/livecoveragetootingmitchamunited1-0chathamtown 1 5147 0 0 /news/canterbury290419 4 19552 0 0 /news/stansfeld260615 4 19277 0 0 /news/wereshowingsignsoffatigueadmitshessenthaler 2 8660 0 0 /news/sykestributes.html 2 0 0 0 /news/tonbridgeangels0-0bromley-myplayersgavemeheartdesireanddeterminationsaysstevemckimm 3 27624 0 0 /news/jenkinsmarkshistenthanniversaryinchargeofcraywanderers 1 5897 0 0 /archive-2006-2014/139 5 23382 0 0 /news/drmartens/eastern/fisher/16thnov04.html 1 0 0 0 /news/kentleague/greenwich/3rdsept04.html 1 0 0 0 /news/ijustthinkthebigthinginthislevelisconsistencysayswellingskipperjackparkinson 1 4160 0 0 /news/fixtureswc13thfebruary2006 3 10531 0 0 /news/werekeepingourfeetonthegroundsayssmissen-exclusive 1 3667 0 0 /news/fcelmstead080319 2 7584 0 0 /news/kentleague/hythe/13thaug04.html 1 0 0 0 /news/wellingtown200117 3 10099 0 0 /news/kentishfootballstatement 2 7233 1 0 /news/wevegottheexperiencetohandlethebigmatchoccasionsayswellsbossmartinlarkin 2 9110 0 0 /news/robbinstargetskentleaguereturn-exclusiveinterview 1 3993 0 0 /kent-invicta-league/7 5 39358 1 1 /news/glebkenn051220 8 121734 1 1 /news/margate171218 3 10998 0 0 /news/wewillgivesomeoneagoodhidingwarnsmaidstoneunitedbossjaysaunders 2 8608 0 0 /news/doverathletic1-2borehamwood-wecangoaverylongwaysayshessenthaler 2 12928 0 0 /news/boroughsignsouthafricanpremierleaguestar-exclusiveinterview 4 16544 0 0 /news/551bc5de4ea39 1 4491 0 0 /news/wardhaswordsofcomfortformunday 1 5078 1 0 /news/5thfeb05.html 1 0 0 0 /news/greenwich131104.html 2 0 0 0 /news/drmartens/eastern/sittingbourne/greatwakering161104.html 1 0 0 0 /news/fisher4-3beckenhamtown-itsjustfairytalestuffsaysproudfisherbossbillywalton 2 18290 0 0 /news/tuckertoapplydespiteassistancerejected-exclusiveinterview 3 11102 0 0 /news/551a9799754df 1 4511 0 0 /news/tonbridge130417 1 4146 0 0 /archive-2006-2014/39 1 4909 0 0 /news/erithtown1-0hythetown-twomanycooksspoilthebroth 1 4853 0 0 /news/werebeingpunishedforourmistakessayshernebaybosssimonhalsey 1 5190 0 0 /news/bromley181204.html 2 0 0 0 /news/hessenthalercallstimeatgills 4 13826 0 0 /news/drmartens/premier/welling/30thjune03.html 2 0 1 0 /news/551bc5e057262 2 13190 0 0 /news/weareverydisappointedthatthingsdidntworkoutforpeternottsayswhitstablevice-chairman 2 9299 1 1 /news/deal061104.html 2 0 0 0 /news/wellgetbetterastheseasongoesonsaysvcdathleticbosstonyrussell 5 21550 0 0 /news/551a956caf380 1 5917 0 0 /news/kentproxi3-5georgehowardkentleaguexi-afantasticdayforgeorgehowardsaysmickycollins 4 44654 0 0 /news/sittingbournejobcameattherighttimeformesaysabbott-exclusive 1 5268 0 0 /news/dulwmarg281115 3 33246 0 0 /news/takalooreturnstoramsgate 6 23618 1 1 /news/drmartens/eastern/ashford/4thaug03.html 2 0 0 0 /news/iamreallyexcitedaboutwhatthefutureholdsformeathernebaysaysgoalkeeperjackdelo 10 34262 2 2 /news/cugleyletsdoourselvesjusticeandknockoutrams 3 11135 0 0 /news/fcelmstead200917 4 14020 0 0 /news/bromley3-0tonbridgeangels-wecangofarinthefatrophywiththissquadsaysmarkgoldberg 3 27812 0 0 /news/wellingunitedbossjamiedaymakesdoubleswoop 5 18150 0 0 /news/phoenix090218 1 3413 0 0 /kentleague-2003-2006 12 41895 1 1 /news/weneedtoconcentratealloureffortsonachievingincreasedincomesaysfolkestonesjimpellatt 3 13190 0 0 /news/wemustnottakeourfootofthepedalsayswarrilow 2 12445 0 0 /news/corinthian011017 1 4053 0 0 /news/wewouldloveagoodturnoutfromthepuntersforourcupfinalsaysgillinghambossjamesmarrs 4 17166 0 0 /news/drmartens/eastern/tonbridge/10thsept04.html 1 0 0 0 /news/hythetownunveilthesigningofphilstevensonfromlocalrivalsfolkestoneinvicta 3 10572 0 0 /news/idliketotakeerithtownuptotherymanleaguesaysmarktompkins 2 9348 0 0 /news/drmartens/eastern/ashford/Hernebay231004.html 1 0 0 0 /news/bridonropes220219 2 6784 0 0 /news/551bc5de2098e 1 3141 0 0 /news/551bc5dfd8ba2 1 6546 0 0 /news/itwouldbefantasticifwecanwintheleaguesayswellingunitedskipperjackparkinson 1 5007 0 0 /news/hernebay231004.html 1 0 0 0 /news/hytheharvey120515 4 14621 0 0 /news/drmartens/eastern/chatham/10thnov03.html 1 0 0 0 /news/dorkbeck110916 2 18296 0 0 /news/sevenoaks180816 2 7782 0 0 /news/weareallfullycommittedtothecauseinsistspatterson 2 12945 0 0 /news/burmanlosingsleepwithredbussyndrome 3 12730 0 0 /news/barton131104.html 2 0 0 0 /news/othernews/30thsept03.html 1 0 0 0 /news/minshullcharlton120515 4 17130 0 0 /news/folkestoneraisesecondshareissuetohelpachieveconferencestatus 5 17766 0 0 /news/kentleague/sladegreen/beckvslad070204.html 1 0 0 0 /news/joneshasbeenawonderfulservanttotheclubsayslovell 2 9055 0 0 /news/phoenix260418 3 12240 0 0 /news/resultsdecember2019 3 26057 0 0 /news/vcd191115 3 13026 0 0 /news/wemustplugthegapssayscugley 1 5412 0 0 /news/margate010720 3 10361 0 0 /news/itsafantasticfeelingtobeuptherewithwrexhamsaysdartfordbosstonyburman 2 9205 0 0 /news/kentleague/lordswood/hillingdon231004.html 1 0 0 0 /news/hernevafcwimfav181003.html 1 0 0 0 /national-league/36 5 25939 1 1 /news/itsourchancetoimpresssaysangelsyouthteamboss-exclusiveinterviews 3 14731 0 0 /news/kfu030317 4 14358 0 0 /news/youcantbeatthatwembleywinningfeelingsaysseager-exclusive 2 11778 0 0 /national-league/22 3 13693 0 0 /news/ourlandlordistheonlypersonholdingcrockenhillbacksayschairmanstevecullen 6 30194 4 4 /news/kingstonian1-0chathamtown 2 7178 0 1 /news/warrilowrelishinghornetsreunion-exclusive 1 5056 0 0 /news/bridon210417 4 14685 0 0 /news/wewillcomebackstrongerinsistsupbeatschulz 2 8670 0 0 /news/fisher260216 4 16978 0 0 /news/551a97b0ebb8d 3 13929 0 0 /news/holmkent190920 6 74630 0 0 /news/gillingham290615 4 14478 0 0 /news/crayhail160918 4 34710 0 0 /news/miles100515 4 14074 0 0 /news/eritbrid240419 5 55135 1 1 /news/ashford020518 1 3618 0 0 /news/stansfeld060617 4 20952 0 0 /news/leytonorient3-0bromley-imdisappointedthatwedidntscoresaysbromleybossmarkgoldberg 3 25574 0 2 /news/longhurstpartscompanywithderesafterjusteighteendays 2 9448 0 1 /news/kentleague/whitstable/21stjuly03.html 2 0 0 0 /news/vcdathletic280119 4 14138 0 0 /news/wholesalemanagerialchangesatbromleyexclusive 4 24825 0 0 /news/dover271204.html 2 0 0 0 /news/iwanttogetasfaraswecaninthefacupsayswellingunitedbossjamieday 5 21241 0 0 /news/england290816 2 7093 0 0 /news/fixturelist 1 4498 0 0 /news/saturdaysmatchreports 4 49170 1 1 /news/hythetownplanaheadfordoversmouth-wateringcupvisit 1 3488 0 0 /news/551a979a2516e 1 4858 0 0 /news/551a99e364030 1 4766 0 0 /news/youjustwanttogetthemtothehighestpositionthattheycouldpossiblygettosaysrayturner 3 16262 0 0 /news/resultsaugust2018 4 32914 0 0 /news/551a9677c2d53 1 4486 0 0 /news/kentleague/thamesmead/16thsept04.html 1 0 0 0 /news/551bc5ded1923 2 11490 0 0 /news/551bc5db7da8c 2 6118 0 0 /news/551bc99bc7163 1 6167 0 0 /news/didcotvsladefac060903.html 2 0 0 0 /news/ryman/bromley/18thsept03.html 1 0 0 0 /gravesend-2003-2006/3 4 11881 0 0 /news/invictaunveilbiggestsponsorshipdeal-andlosetheirstripes 2 6931 0 1 /news/aveley101004.html 2 0 0 0 /news/weveprobablygotthebestteamspiritclaimserithbelvederebosschriscosgrove 2 9672 0 0 /news/551a9c932eef2 2 8613 0 0 /news/19thsept04.html 2 0 0 0 /news/foleybringssixplayerswithhimtochatham 1 4094 0 0 /news/551bc5dd19d7f 1 2736 0 0 /news/scefl250416 4 13105 0 0 /news/croydonvbrom160803.html 1 0 0 0 /news/kingstonian201205.html 1 0 0 0 /news/sitting090915 3 11601 0 0 /news/551bc5e42efd7 3 8683 0 0 /news/kentleaguelatestseagercollectshissecondaward 1 5569 0 0 /news/werelookingtogetintotheplay-offsorwinleaguesaysthamesmeadtownbosskeithmcmahon 4 22389 0 0 /news/551a9250bc63e 4 13841 1 0 /news/whitstabletown2-3eastbournetown-battlingqualitieswillhelpusbeatdropsaysseager 2 11942 1 1 /news/youneedtobeatyourbesteverytimeyouplaysayswoodstockassistantchriscooper 3 11132 0 0 /news/phoevcd301218 4 41374 0 0 /news/sheppey120617 3 11403 0 1 /news/corinthian031216 2 7882 1 0 /news/551a99e44e724 1 4702 0 0 /news/26thoct05G.html 4 0 0 0 /news/craywands201218 3 12714 0 0 /news/wellsblastmindlessmoronsafterattackcauses10kofdamage 2 7808 0 0 /news/tommywarrilowquitsaftertonbridgeangelssufferthedrop 3 13098 0 0 /news/crayvalley170617 2 7148 0 0 /news/551a9250bf7d0 1 3444 0 0 /news/551a967861f48 1 6184 0 0 /news/lordswoodfc.co.uk 2 0 0 0 /news/reserveswillbegivenachancesaysnott 2 8139 0 0 /news/dorkfav260416 5 42786 0 0 /news/refereefittodrivehomedespitehealthscare 2 6716 0 0 /news/formerenglandstarsinvestinourbeautifulgame 2 10688 0 0 /news/strikerboostforgillsaheadofvillaclash 1 3754 0 0 /news/theresstillalotmoretocomefromuswarnsholmesdalebosshughes 3 15470 1 1 /news/peoplewillhavetodealwiththefrustrationsofbeingdroppedsaysdoverathleticbosshayes 1 3835 0 0 /news/tonbridgeangels0-1maidstoneunited-wevegotsomedifficultdecisionstomake-jaysaunders 5 45660 0 0 /news/sittingbourne070716 1 4208 0 0 /news/wingatefinchley2chathamtown0sat29thapril2006 1 3665 0 0 /news/weholdnogrudgessayswarrilow 1 4673 0 0 /news/upbeathumefanciesacupgiantkilling 1 5992 0 0 /news/fordwellgiveitourbestshotforthewholeofkent 3 14147 0 0 /news/bromley010218 3 16884 0 0 /news/everyeffortwillbeputintoreachplay-offssaysward 1 4398 0 0 /news/lukedaleywillbeagoodadditiontooursquadsaysdartfordbosstonyburman 4 14133 0 0 /news/cumberbatchweknowwhatourproblemsare-exclusiveinterview 1 4129 0 0 /news/crowling040817 2 17162 1 0 /news/brombore171120 9 76185 0 1 /news/ilford291005.html 2 0 0 0 /news/winninggamesistheprioritysaystunbridgewellsbossmartinlarkin 1 5539 0 1 /news/551bc99c6afc3 3 34194 1 2 /bromley-2003-2006/5 3 9408 0 0 /news/kspolord060219 5 39852 0 0 /news/under21youthleaguesettoexpandnextseason 2 7627 0 0 /news/551a9798cada1 2 9259 0 0 /news/trophyticketsforhighnoonshowdownupforgrabs 1 3260 0 0 /news/thereisenoughtalentinthanetforustomixitinsoutherncountieseastleague-liammorris 5 28157 0 0 /news/wewontgointherethinkingwevejustdonewelltogettheresaysvcdbosstonyrussell 4 20098 0 0 /news/hawkingeotford181019 4 15228 0 0 /news/recentresultsforthcomingfixtures30thaugust-9thseptember 4 23004 0 0 /news/wingsaddstrikertosquadandstagetrophyfinal 3 9994 0 0 /news/sittvchat281003.html 2 0 0 0 /news/wellbren090419 5 39855 0 0 /news/resultsjan2017 3 40145 0 0 /news/551bc99e0036a 1 5733 0 0 /news/551a9cf538cf3 2 10296 0 0 /news/ksports250719 7 25972 0 0 /news/greenwich090218 1 4435 0 0 /archive-2006-2014/159 5 22197 0 0 /news/stansmetrogas090515 3 34493 0 0 /news/chatham030520 3 9679 0 0 /news/FAVasenews071220 7 41671 0 0 /news/bashvsitt010504.html 3 0 0 1 /news/551a9250b6811 2 6917 0 0 /news/alongsidethefacupthefatrophyisrightuptheresaysmaidstoneunitedbossjaysaunders 2 10426 0 0 /news/ramsaddyoungkeepertotheirsquad 3 8698 0 0 /news/31stjuly04.html 2 0 0 0 /news/551a9c9168eb7 2 9456 0 0 /archive-2006-2014/206 2 9458 0 0 /news/dulwichhamlet280420 3 11985 0 0 /news/wemustsetoursightshigher-beckingham 1 3894 0 0 /news/dartfordbosstonyburmanunveilsjonwalliscapture 4 76628 3 3 /news/garethsouthgate200320 3 12029 0 0 /news/afccroydon230218 2 7014 0 0 /news/tonbridge210417 1 3971 0 0 /news/6thmay05.html 1 0 0 0 /news/wemuststartperforming-daish 2 7494 0 0 /news/551bc5de17b4d 1 3981 0 0 /news/bromley120318 4 14054 0 0 /news/551bc5e48fe89 1 3882 0 0 /news/tonbridgeangels130221 6 31017 1 1 /news/soccershorts120619 3 20070 0 0 /news/bromwok041016 3 28650 0 0 /news/drmartens/eastern/folkestone/chatvfolk200304.html 1 0 0 0 /news/craywands030118 1 4618 0 0 /news/ivegotabitofafavaseexpectationtoliveuptosaysvcdathleticbossrickybennett 1 3782 0 0 /news/wellhavearightgoatcraywanderersandhopetheyhaveanoffdaysayserithtownbossrussell 1 5686 0 0 /news/soccershortswehaventreallybeenatourbestadmitstable-toppingvickersbossrickybennett 1 74071 1 1 /news/itsnotallaboutmeinsistsawardwinningmanager 1 3674 0 0 /news/craywanderers1-2afchornchurch-wewasntupforitadmitsianjenkins 1 7622 0 0 /news/kentleaguecupfinalgeorgecastsasidehismedals-exclusive 1 4114 0 0 /news/tomparkerhasbeenacredittowhitstabletownsayschairmanjoebrownett 1 3752 1 0 /news/sittingbourne0-1ramsgate-weregoingintherightdirectionsayssittingbournebossjimward 2 18368 0 0 /news/tunwellscroyath010116 3 12060 0 0 /news/551bc5e22d411 2 9534 0 0 /news/soccershorts050617 3 18062 0 0 /news/erithtownelms161015 3 28890 0 0 /news/onthenightthatsudburycrackunderpressureburmansayswemustnotthrowitawaynow 1 4655 0 0 /news/thelocalcommunitywantthewandstocomehomeinsistscraychairmanhillman 2 11919 0 0 /news/sevenoaks071204.html 1 0 0 0 /news/551bc5de6288b 3 12581 0 0 /news/wehaveamassivechanceofknockingouthistonsayshume 1 4027 0 0 /news/18thnov05.html 1 0 0 0 /news/westcant111117 4 35740 0 0 /news/formbooksgooutofthewindowinderbygamessaysdoverathleticbossmartinhayes 1 4811 0 0 /news/corinthian070920 2 8522 0 0 /news/hendon1-2whitstabletown-thisisthebestsquadwhitstablehaseverseensaysnickysouthall 1 9289 0 0 /news/maidstone091117 3 32718 0 1 /news/551bc5e652e93 2 7888 0 0 /news/fisherconsiderfridaynightfootballtobringinthecrowds 3 10969 0 0 /news/erithbelvedere2-5thamesmeadtownmeadsclassleavesrivalmanagerslostforwords 2 12958 0 0 /news/drmartens/eastern/folkestone/wealdstone110904.html 1 0 0 0 /news/zerotoherosmithrepaysjonesfaith 2 8732 0 0 /news/20thnov05.html 3 0 0 0 /news/mayorbacksboroughspromotionbid 1 3867 0 0 /news/rustgleb220317 4 45498 0 0 /news/ryman/bromley/9thfeb04.html 1 0 0 0 /news/othernews/6thoct03.html 1 0 0 0 /news/kingstonian281105.html 1 0 0 0 /news/kentsidesavoidfirstroundofchampionshipmanagercup 1 3243 1 0 /news/harmsworthexplainstramsdeparture 4 13072 0 0 /news/ramsgate260620 3 10586 0 0 /news/lordvramsfav181003.html 1 0 0 0 /news/stroutsiwantedtofinishmycareerwithstones 1 3964 0 0 /news/bromley280519 4 14726 0 0 /news/bromley300715 4 17929 0 0 /news/wevegotverylittletoloseagainsthungerfordtownsaysfolkestoneinvictabossneilcugley 2 7624 0 0 /news/championshessenthalersalutesheroesondoverathleticsspecialday 1 3919 0 0 /news/551bc5e70931a 2 13922 0 0 /news/abbottrevealssecretbehindimpressiveawayform 2 8632 0 0 /news/551bc5e050a16 3 12335 0 0 /news/bromwoki240919 3 27365 0 0 /news/551bc5e6093af 1 4091 0 0 /news/tonbur170117 1 8227 0 0 /news/bromley031018 3 16974 0 0 /news/delightedbridonropeschairmanunveilsgarylisneyastheirnewboss 4 15561 0 0 /news/breakingnewsstoneswelcomenewdirector 1 3888 0 0 /news/ireallydothinkwecanbeatthemsaysdoverathleticbosschriskinnear 1 5659 0 0 /news/551a9678427aa 3 10128 0 0 /news/iwillbepushingclarkmastersallthewayvowsscottchalmers-stevens 5 19830 0 0 /assets/select2/src/scss/ 5 2240 0 0 /assets/smartmenus/addons/keyboard/ 5 1968 0 0 /news/holmcray281015 3 30873 0 0 /news/551a9677f406c 2 19112 1 1 /news/fisher040720 4 12190 0 1 /news/homelands020217 1 5183 0 0 /news/8thmar05A.html 2 0 0 0 /news/sevenoakstownfightoffcompetitiontosignprolificstrikerrichmondkissi 1 3145 0 0 /news/theroadtowembleyhernebayfancytheirchancesofcausingacupshock-exclusive 1 4555 0 0 /news/fleetwoodtownpulloutallthestopstoplayfatrophytie 1 4177 0 0 /news/ksports030417 4 15202 0 0 /news/ramsgate301117 2 8012 0 0 /news/551a95b44d16e 1 4192 0 0 /news/fadoubleheader080515 4 14586 0 0 /news/551a95b404901 5 42772 1 1 /news/itsuptomyplayerstoplaythemselvesintomycupfinalplanssaysjones 2 9904 0 0 /kent-invicta-league/27 2 9349 0 0 /news/13thjuly04.html 1 0 0 0 /news/talentedstrikercassiuscanonlygetbetterwarnsoboyle 1 4665 0 0 /news/crayvalley240320 2 10728 0 0 /news/iwanttofightforhonourssayswhitstabletownbossnickysouthall 3 14867 0 0 /news/551a9bafe1af2 4 20725 0 0 /news/thefacupalwaysmakesmytummyrumbleinexcitementrevealslordswoodbossjasonlillis 1 4256 1 0 /archive-2006-2014/273 2 8003 0 0 /news/sevehyth040220 2 20030 0 0 /news/iwanttohelpbuildastrongfootballclubsaysnewly-appointedbromleygreenbossjohnovard 1 4594 0 0 /news/maidstone010720 3 9732 0 0 /news/burgesshilltown3-2whitstabletown-seagerharpsonaboutpoordefending-exclusive 2 25234 1 1 /news/iwillhelpbenjudgeinanywaypossibletogethimamovehedeservessaystommywarrilow 3 13459 0 0 /national-league/16 2 10054 0 0 /news/strikepairingiskeytoourcupsuccesssaysabbott 1 3885 0 0 /news/kentclubscomplainaboutclashwithenglandinternational 1 6640 0 0 /news/thecenturyclub 1 2910 0 0 /news/whitstabletown1-2vcdathletic 2 10474 0 0 /news/551a9c922a512 3 15089 0 0 /news/drmartens/eastern/folkestone/harrowcupreplay051004.html 1 0 0 0 /news/bromwell140117 4 43297 0 0 /news/scrcor041216 2 20692 0 0 /news/551bc5dc2fa36 2 10240 0 0 /news/craighollowaystandsdownasmargatejoint-managerwithaheavyheart 2 9002 0 0 /news/corinthian200117 2 8561 0 0 /news/scefldeclinetocommentonthefutureofthreeofitsmemberclubs 4 18202 0 0 /news/kentleague/cray/27thaug03.html 1 0 0 0 /news/playersmustbeupforderby-obrien 1 4517 0 0 /news/551bc5e1e65fe 2 8928 0 0 /news/bartramdraftedintowingssquad 3 8836 0 0 /news/angelsoncoursetobouncebackatfirstattempt 2 8189 0 0 /news/four-teamkendocuptopayfittingtributetothelatekenthurgood 4 14046 0 0 /news/imexpectingatoughgameagainstrochestersaysvickersbossrickybennett 2 7344 0 0 /news/managersleftfrustratedasatrociousconditionsbatterengland 1 4489 0 0 /news/sharman300515 3 12146 0 0 /news/idlovetoseebromleywintheleaguebutiwouldntputanymoneyonitsayshaydenbird 1 4554 0 0 /news/iveneverbeeninvolvedinsomethingasdramaticasthatsayswhitstabletownjoint-bossjimward 3 14861 0 1 /news/bromley200915 4 22845 0 0 /news/551a99e3581f2 1 4597 0 0 /news/kentleague/maidstone/23thjan04.html 1 0 0 0 /news/whyshouldiwanttoresign-hessenthaler 2 7446 1 0 /news/doverathleticyoungstershitthebigtimeandpasswithflyingcolours 1 3872 0 1 /news/cugleysearchesforattackmindedplayers 1 4796 0 0 /news/matchreportshernebayearnreplayafterheoricsathayesyeading 1 8249 0 1 /news/waltonhersham3-1folkestoneinvicta 1 4553 0 0 /news/kentleague/lordswood/29thnov04.html 1 0 0 0 /news/wewillbedoingourlevelbesttoprogressupthetableinsistsmunday 1 3770 0 0 /news/erithbelvedere3-2greenwichborough-imnotpleasedwiththeperformancesaysmickycollins 4 32659 0 0 /news/hollands301117 2 7378 0 0 /news/551a9677d7690 1 3735 0 0 /news/551bc99b08100 1 3324 0 0 /news/wemustapproachtop-of-the-tableclashwiththesamementalityastheothergamessayswatson 2 8224 0 0 /news/wellingunited270919 3 10567 0 0 /news/wellingunited070619 6 22207 0 0 /news/551bc5e120bd0 1 3337 0 0 /news/551a9cf57040c 2 9378 0 0 /news/drmartens/eastern/tonbridge/23rdnov03.html 1 0 0 0 /news/12thjune04.html 2 0 0 0 /news/551a9bafee835 3 10098 0 0 /news/551bc5dfe8e9b 1 4146 0 0 /news/flanaganscoopsfourfolkestoneawards 1 16086 1 1 /news/hugolangton090618 4 21625 0 1 /news/thefacupisacompetitionwewanttostayinforaslongaswepossiblycansaysmartinford 4 22916 0 0 /news/wehavedoneremarkablywellinourfirstseasonsaysfcelmsteadbossfabiorossi 4 16418 0 0 /ashford-2003-2006/2 4 12165 0 0 /news/dulwichhamlet1-1maidstoneunited-theresgoingtobealotmoretwistsandturns-jaysaunders 3 29115 1 0 /news/change.org/p/award-roy-larner-the-george-cross 3 0 0 0 /news/onethingthatistopofmylististoenjoymyfootballsaysjasonlillis 1 4067 0 0 /news/fisherappointpowellascoach 1 3977 0 0 /southern-counties-east-football-league/47 2 9038 0 0 /news/wevegottoputourdisappointmentbehindusvowssmith 2 8084 0 0 /news/551a9c0e54116 1 3559 0 0 /news/whitstable080617 2 6591 0 0 /news/tonbridgeangelsclampdownonanti-socialbehaviour-exclusive 2 11302 0 0 /news/horsham2ramsgate1-wardimpleasedforhorshambutwellgoupwithyou 1 16862 1 1 /news/vcdathletic3-3erithbelvedere 1 3828 0 0 /news/westhamunited2-5tottenhamhotspur 2 11496 0 0 /news/guernseyisalovelyplacetogotothistimeofyearsayswhitstabletownbossnickysouthall 4 14700 0 0 /lordswood-2003-2006/3 3 8268 0 0 /news/itsimportantformetocreategenuinecompetitionforplacessaysfavershamtownbossrayturner 6 24757 0 0 /news/sittingbourne1-0tootingmitchamunited 2 9305 0 0 /news/newsigningswillmakeusmorecompetitivesayscugley 2 8386 0 0 /news/doverathleticchairmanjimparmenterissuesfansrallyingcry 2 7554 0 0 /news/canterbury101117 4 13964 0 0 /news/dartford080517 2 7536 0 0 /news/beckcroy03032020 5 56045 0 1 /news/drmartens/premier/dover/6thdec04.html 1 0 0 0 /news/folkestone260618 4 15065 1 0 /news/tonbridgeangels220620 4 12656 0 0 /news/551bc5e3f2796 2 8306 0 0 /news/croycray121218 4 29874 0 0 /news/551bc5ddec3bf 1 3014 0 0 /news/brentwoodtown2-2dartford-werereadyforsuffolkshowdowninsistsburman 2 10238 0 0 /news/lottoptsformovetodulwichhamlet 3 10462 1 0 /news/551bc5e835352 2 9920 0 0 /news/drmartens/eastern/tonbridge/31stJan04.html 1 0 0 0 /news/imreallychuffedtobemadehonoraryvice-presidentofthekcfasaystommysampson 1 3756 0 0 /news/parkjohn070519 2 15444 0 0 /news/hawkinsexperiencewillbeinvaluablesaysdaish 6 19896 1 0 /news/wellingtown130117 3 9997 0 0 /news/erithbelvedere0-1maidstoneunited 2 6346 0 0 /news/crowborough270117A 2 8720 0 0 /news/soccershortscraywanderersfacesheffieldinoldestclubbattle 1 7957 0 0 /news/apmcontrast180915 3 10962 0 0 /news/theclubcannotcontinuewithoutpeopletorunitwarnsfolkestoneinvictadirectormarkjenner 1 4417 0 0 /news/19thsept03.html 1 0 0 0 /news/craywanderers2-0whitstabletown-seagermyteamhaveweightoftheworldontheirshoulders 3 19418 0 1 /news/drmartens/eastern/ashford/horsham271104.html 1 0 0 0 /news/dontshutthegateappealletspulltogethertohelponeofourown/ 9 148590 9 0 /assets/select2/bower.json 1 364 0 0 /news/551bc5e8e1737 3 13456 0 0 /news/surreyfastatement180320 3 9371 0 0 /news/tunbridgewells0-2dartford-farniesomeplayersarentgoodenough-exclusive 5 21386 0 0 /news/551bc99c89930 1 6517 0 0 /news/hegleyleavesstonestobecomeavicker 2 7515 0 0 /news/551bc5e59acf1 1 4455 0 0 /news/551a931d9b486 1 3879 0 0 /news/ryman/bromley/bromvtoot230903.html 1 0 0 0 /news/kentleague/whitstable/3rdoct04.html 1 0 0 0 /news/551a9797c563c 2 6282 0 0 /news/x-1 2 5021 0 0 /news/bromleyisnotaneasyplacetogowarnstonbridgeangelsbossstevemckimm 3 18875 0 0 /news/toomanyplayersareplayingonreputationsandhavenotgottheheartfumesnott 1 3573 0 0 /news/youvegottoenjoyeverysingleminuteofthemsaysfolkestoneinvictabossneilcugley 3 17319 0 0 /news/dulwichhamlet1-4millwall-ivegotnoproblemswithmillwallsapproachatallsaysgavinrose 4 39152 0 0 /news/kentleague/VCD/27thfeb04.html 1 0 0 0 /news/wewontputtheclubatriskbytryingtoliveaboveitsmeanssaysdulwichhamletbossgavinrose 4 14886 0 0 /news/resignationsatkentleaguegreenwichborough-garlandappointedcaretakermanager 5 20639 0 0 /news/551bc5e13f2d5 1 5268 0 0 /news/551bc5dd4376c 3 13927 0 0 /news/vcdathletic0-2erithtown-itwasnotprettybutwegotthejobdoneadmitstonyrussell 2 13128 0 0 /news/hernebay150720 3 10882 0 0 /news/kentleague/sladegreen/readingreplay310804.html 1 0 0 0 /news/folkvash261203.html 2 0 0 0 /archive-2003-2006 14 49018 2 2 /news/favershamtownbossrayturnerplaysthewaitinggametoaddthreenewfacesto37-mansquad 4 14561 0 0 /news/theresnotmanyteamsthatcancompetewithusinthisleaguesaysnickyforster 3 12622 0 0 /news/27thnov04.html 2 0 0 0 /news/11thnov05.html 2 0 0 0 /news/craywands301117 2 7956 0 1 /news/ramsraise801foryoungroadaccidentvictim 3 10898 0 0 /isthmian-league/47 5 61529 3 2 /news/soccershortsjoetaylorleavessittingbournetosignforfarnborough 4 20857 0 0 /news/ryman/bromley/13thjuly04.html 1 0 0 0 /archive-2006-2014/226 3 12692 1 1 /news/margate010617 2 8076 0 0 /news/551a9c9272e33 3 18814 0 1 /news/4thjune05.html 1 0 0 0 /assets/images/social/ 7 2999 0 0 /news/sevenoaks111116 2 7868 0 0 /news/wellgivelarkhallathleticplentyofrespectsayshernebaybosssimonhalsey 1 4639 0 0 /news/551a97b069bd2 1 3605 0 0 /news/managerslockdownviews011120 3 14539 0 0 /news/weneedtogetbacktowinningwayssaysthamesmeadtownbosskeithmcmahon 1 5032 0 0 /news/ramsgate170519 4 14401 0 0 /news/551a9c915279e 4 14790 0 0 /news/mckimmhailsmargatescharacter 1 3431 0 0 /news/wedontfearanybodyatthemomentsaysdoverathleticbossnickyforster 1 4361 0 0 /news/milesswoopsforformerfavershamskipperholder 1 4175 0 0 /news/doverathleticannounceticketdetailsforhistoricfacuptieathuddersfieldtown 1 4046 0 0 /news/drmartens/eastern/sittingbourne/3rdfeb04.html 1 0 0 0 /news/fobgfc.org 2 0 0 0 /news/doverathletic150620 2 6624 0 0 /news/thamesmead020815 3 15741 0 0 /news/tonbridge060805.html 2 0 0 0 /news/millwall210517 3 10791 0 0 /news/fleetgirlsreadytotamelions-exclusive 1 6647 1 0 /news/burmancupcompetitionsareimportanttous-exclusiveinterview 1 4482 0 0 /news/sportchat040319 4 46107 0 0 /news/551bc5e524b8f 2 9414 0 0 /news/sundaysfixturelist-lastupdated1045 4 16984 0 0 /news/ithoughtwedturnthecorneradmitsfisherbossstevefirkins 1 5064 0 0 /news/vcdathletic1tunbridgewells1exclusiveinterviews 3 15335 0 0 /news/sittingbourne3-2chipstead-abbottsetshat-trickherobrady20-goaltarget 2 11428 0 0 /news/iwantamanagerwhoinveststimetodevelopgoodyoungplayerssayslewishamsraysimpson 4 18058 0 0 /news/cugleyslamswhyteleafeoverpostponement 2 10293 0 0 http://kentishfootball.co.uk/news/soccershortshernebaychairmancondemnsnortonsalehousetactics 1 45765 1 1 /news/551bc5da242e6 2 7902 0 0 /news/soccershortsashforddecidetoscraptheirreserveside 1 5648 1 0 /news/wehaventgotalotofmoneytospendonastrikersayserithbelvederebosschriscosgrove 2 8780 0 0 /news/tunbridgewells0-3thamesmeadtown 2 7982 0 0 /news/otfordhawkinge231020 4 25217 1 1 /news/imlookingforatophalffinish-iftheplayersworkhardsaysrusthallbosspaulmcdonagh 1 4185 0 0 /assets/ckeditor/plugins/magicline/images/ 1 403 0 0 /news/551bc5e07186b 2 10098 0 0 /news/stoneschairmanconsideringhisoptions 1 4020 0 0 /news/ouraspirationsaretoobviouslywintheleaguesaysramsgatebossjimward 1 4972 0 0 /news/crayholl030217 1 4580 0 0 /assets/qz-print/qz-print_jnlp.jnlp 1 1938 0 0 /news/wellingunitedapproachfootballconferencetogetcripplingtransferembargolifted 1 6004 0 0 /news/erithbelvedere7-0sidlesham-deresmaintaintheirhighstandardswithseven-goalromp 1 7004 0 0 /news/doverathleticunveilthesigningofformermillwallstrikerbenmay 1 3893 0 0 /news/in-formmargateprepareforironsvisit 2 9326 0 0 /news/kentleague/VCD/26thoct04.html 1 0 0 0 /news/2nddec05.html 2 0 0 0 /news/elmstead081217 4 14998 0 0 /news/ramsgate140319 3 10212 0 0 /news/punjabunited191219 4 14468 0 0 /news/wellingunited2-0eastthurrockunited-icantgetmyheadaroundbeingsoflat-ford 1 5366 0 0 /news/fleetreturntotheirbreadandbutter 2 9249 1 0 /news/551bc5e1a705e 2 11814 0 0 /news/thefacupishugefortheclubandhugefortheplayerssayssittingbournebossnickdavis 5 22527 0 0 /news/ashford061205.html 2 0 0 0 /news/thingsarebadbutnotasbadastheywereadmitsfolkestoneinvictabossneilcugley 2 9316 0 0 /news/kentleague/cray/30thaug03.html 1 0 0 0 /news/wilkinsmakesswiftreturntodover 1 3791 0 0 /southern-counties-east-football-league/19 7 35915 0 0 /news/wingsbossjamiedaydrawscomfortfrompositivevibesaheadoflutonclash-6312tosavewings 1 5272 0 0 /news/drmartens/eastern/sittingbourne/tonvsitt060304.html 1 0 0 0 /news/othernews/FavershamTown190904C.html 1 0 0 0 /news/drmartens/eastern/folkestone/kingvfolk170104.html 1 0 0 0 /news/vcdathletic2-2craywanderers-wevetoldeveryonetheyreplayingforashirtsaysjoefrancis 1 8189 0 0 /news/kentleague/maidstone/5thnov04.html 1 0 0 0 /news/holmesdale281119 3 8930 0 0 /news/wereexpectingatoughgameagainsteastprestonwarnsfisherbossstevefirkins 1 4235 0 0 /news/551bc5e88c573 2 10264 0 0 /news/ifanybodywantsasuccessfulmanagerimhere-jimward 1 4595 0 0 /news/anynewswillfollowhere 1 2536 0 0 /news/551a92509cc62 4 15350 0 0 /news/551a9718cb054 2 7370 0 0 /news/carsmarg011018 5 43312 0 0 /news/drmartens/eastern/ashford/28thoct04.html 1 0 0 0 /news/ashfordu18vramsgateu18.html 2 0 0 0 /news/drmartens/eastern/ashford/19thmar04.html 1 0 0 0 /news/wevegotthebestpairofcentrebacksinourleaguesaysfolkestoneinvictabossneilcugley 4 14189 0 0 /news/nickyforsterisagreatmanmanagerandmotivator-doverchairmanjimparmenter 1 3662 0 0 /news/551a96dbc5e95 1 3976 0 0 /news/crowborough290618 2 9485 0 0 /news/rusticscaptureblundellfromneighbouringwells 1 3369 0 0 /news/weveshownitcanbedonesaystunbridgewellsbossmartinlarkin 3 15438 0 0 /news/workbrom030218 4 37070 0 0 /news/werealllookingforwardtothechallengesaheadinthenewcampaignsayswellingbossjamieday 4 15389 0 0 /news/tilbury300804.html 2 0 0 0 /news/bromvfolk230304.html 1 0 0 0 /news/metrogas080519 2 8330 0 0 /news/maidmcdonagh310515 7 97616 4 3 /news/thefleetatwembleywebackthefleettodeliverourbiggestprize 1 4136 0 0 /news/sittingbournesearchfornewbackersaschairmanstepsdown 2 12489 0 0 /news/tunbridgewellsbossmartinlarkinissuesrallyingcryaheadofbigweekend 1 5680 0 0 /news/wejusthavetomakesurewerenotgoingtobepartofacupshockstorysaysmarkgoldberg 5 23232 0 0 /news/tonightsresults21stfebruary2006 3 10464 0 0 /news/hernebaybosssimonhalseywarnshissideagainstcomplancency 2 10272 0 1 /news/hollandsblair2-0hythetown-wevegottostaypositivesayshythetownassistantdarrenbeale 5 56814 1 1 /news/craycars261006 2 19760 1 1 /news/collinsunveilsformerspursstopperashisfirstsigning 1 3711 0 0 /news/erithtown110517 1 3468 0 0 /news/burmantellsfanstoraisetheroofasdartsreturntotheirbreadandbutter 2 8327 0 0 /news/warrilowdraftsinclarketocementplay-offplace 2 9624 1 0 /news/thereslotstosortoutbeforeweapplyforthekentleaguesaysashfordtownchairman 1 4293 0 0 /news/chathamtown3wingatefinchley1exclusiveinterview 4 26601 1 0 /news/551a9718a2588 1 3826 0 0 /news/ramsgate3-2horsham-ramskeepupwiththejoneseys 5 50486 3 2 /news/soccershortsmargatewerewithinhoursofclosingdown-piper 11 116897 10 10 /news/weneedtogainmaximumpointsifwearetowintheleaguetitlesaysblairbosspaulpiggott 3 11052 0 0 /news/therewardistherenowforbothclubssaysdartfordbosstonyburman 3 15266 0 0 /news/dartford150718 3 12675 0 0 /southern-counties-east-football-league/33 3 15229 0 0 /news/551bc99b421ba 1 2898 0 0 /news/cugleybeginssearchfornewgoalkeeper 1 5534 0 0 /kent-invicta-league/9 5 39199 1 1 /news/iwillbehappyifwecankeepwithinthepackaroundchristmassayslordswoodbossjasonlillis 3 11575 0 0 /news/itsgoingtobeanexcitingchristmassaysbromleycoachhugolangton 1 4682 0 0 /news/greenafcc090416 4 43150 1 0 /news/margateunveilgroundimprovementsplanforhartsdownpark 3 11421 0 0 /news/obrienlookingforwardtotonbridgereturn 2 7056 0 0 /news/tonbridgeangels0-0stalbanscity-weneverdonothingeasyhereadmitstommywarrilow 1 9158 0 0 /news/foleylearnsfromopeningdaydefeat 1 4950 0 0 /news/551bc5e0d9975 1 3956 0 0 /news/arbrdund220121 7 47733 0 0 /news/drmartens/eastern/folkestone/folkvdart130304.html 1 0 0 0 /news/wecangotocroydonandbeatthemsaysmargatebossoconnell 1 4427 0 0 /news/nodoubtthefanswanttobeathernebaysayswhitstabletownbossjimward 4 17474 0 0 /news/lordswood101117 1 3441 0 0 /news/cantnewp060119 5 54462 0 0 /news/getwellsoontommysampson 1 3536 0 0 /news/dartford1-2wellingunited-itsalwaysnicetogetoneoveryourlocalrivalssaysmatthorne 1 9548 0 0 /news/beckenhamtown0-2hythetown-cooksgoalwasoffsideadmitsluckyhythetownbossscottporter 1 9027 1 0 /news/551a97b189dcd 1 4968 0 0 /news/othernews/25thjuly03.html 2 0 0 0 /news/hernebay300319 5 16635 0 0 /news/isthmian170617 2 7036 0 0 /news/vcdathletic2-0thurrock-itwaslikeagameofchessadmitsvcdathleticbosstonyrussell 2 16670 0 0 /news/kentleague/deal/Sampson9A.html 1 0 0 0 /archive-2006-2014/137 2 9389 1 0 /news/princesparktostageshowpiecefinal 2 6174 0 0 /news/551a97b23ebb8 1 4424 0 0 /news/merrychristmas 1 2589 0 0 /news/wevegotladswhowillrunthroughabrickwallforsittingbournesaysbossjimward 3 13906 0 0 /news/551a967852f31 1 3955 0 0 /news/soccershortshistondeservetobethrownout 1 42971 1 1 /news/glebecant180715 4 46227 0 0 /news/paulbarnes190618 21 109939 17 17 /news/drmartens/premier/dover/1stnov04.html 1 0 0 0 /news/cray-valley.co.uk 1 0 0 0 /news/sheppeyunited310519 4 14566 0 1 /news/chathamtakeapoint-anddenness-fromashford 1 4001 0 0 /news/otfordunited151120 7 33727 1 1 /news/sct230916 3 12714 0 0 /news/idontwantfanstogohomewiththehumpsayscraybossianjenkins 2 9275 0 0 /news/sodjeendshisshorttramrideintimeforall-kentcupshowdown 1 4788 0 0 /news/wewillnotthrowallawayourhardworksayslangton 1 4920 1 0 /kent-invicta-league/24 2 10276 0 0 /news/551a931e1b131 3 13443 0 0 /news/tunbridgewells0-1greenwichborough-exclusiveinterviews 4 25220 0 0 /news/ourchristmasfixturesareverytoughsaysdealtownbossalbiebarker 1 3331 0 0 /news/ramsgatebosswardcatchusifyoucan 4 21697 0 0 /news/daishmembersshouldvotetosellstarstrikergash 2 7439 0 0 /news/margatestillhitwithsuspensionstokeypersonnel 2 8578 0 1 /assets/uploads/labels/ 4 1266 0 0 /news/dulwbrai070217 1 10217 0 0 /news/3rdnov05.html 1 0 0 0 /news/maidstoneunited5-0dulwichhamlet-imsohappyweperformedforanamazingcrowdsayssaunders 3 22529 0 0 /news/wevegottokeepourfeetonthegroundsayswellingbossjamieday 2 28243 1 1 /news/maidstone290105.html 2 0 0 0 /news/fiskslamsdalersbossovertitletalk 1 4588 0 0 /news/thamesmeadtown2-1erithbelvedere 1 4283 0 0 /news/551a95b423fd1 4 25730 0 0 /news/shepcroy050817 1 10111 0 0 /news/porterenduresinjurynightmare 3 11299 0 0 /news/oboylewantsbesteverseason 2 7025 0 0 /archive-2006-2014/270 2 8686 0 0 /news/wewerentupforthefightadmitsyorath 2 7819 0 0 /news/gateshavebeendisappointingadmitsfleetchairman 1 3310 0 0 /news/551a99e38356d 1 4028 0 0 /news/ferdinand300515 3 11397 0 0 /news/wecangofromstengthtostrenthinsistsfavershamchief 6 19900 0 0 /assets/select2/tests/selection/allowClear.html 1 307 0 0 /news/tonbridgeangels0-2doverathletic-browningssickeninginjurymarsrecordbreakingdoversday 7 147198 4 4 /news/551a9718e03b1 4 24965 0 0 /news/drmartens/eastern/dartford/18thjuly04.html 1 0 0 0 /news/beckenham060418 2 7080 0 0 /news/warrilowdowntobarebonesdefensively 2 9874 0 0 /news/551a9799c7174 1 5806 0 0 /news/551a9677849a6 1 3411 0 0 /news/bromley160318 4 18197 0 0 /news/22ndaug04.html 3 0 0 0 /news/551bc5e46ac75 1 3166 0 0 /news/sevehyth071020 3 36585 0 1 /news/551bc5dfa9d17 1 3864 0 0 /news/drmartens/eastern/tonbridge/3rdoct04.html 1 0 0 0 /news/sittingbourne0-0horshamymca-itwasafrustratinggameforusadmitsabbott 2 34788 1 0 /news/folkestoneappealoverfacharge 3 9139 0 0 /news/551a931e3262e 1 3296 0 0 /news/injury-hitsevenoaksaimtobounceback 6 41646 1 0 /news/22ndjan05.html 3 0 0 0 /news/551a9b482d704 4 13626 0 0 /news/lawrencesdisappearanceupsetsseager 1 4385 0 0 /news/hayesputscontractsonhold 2 9318 0 1 /news/deanharrisonwasthestand-outcandidateinareallyimpressivefieldsaysfisherchairman 3 11833 0 0 /news/soccershortsdealtownsignformermanchestercityprospect 3 47150 0 0 /news/wellingunited110619 4 19798 0 0 /news/lordswood270217 1 4316 0 0 /news/imexpectingahardfoughtlocalderbyagainstfavershamsayshernebaybosssamdenly 2 7896 0 0 /news/vickersbossrickybennettsayshissidewilladapttowintryconditions 1 4594 0 0 /news/whitstabletowntellunder-pressuremundaytostartpickinguppoints 1 4762 0 0 /news/matchreportshythetownrompto8-1victoryoversorryderes 1 9711 0 0 /assets/smartmenus/demo/bootstrap-navbar-fixed-top.html 1 2574 0 0 /news/soccershortsabbottinterestedinvacantwellingjob 2 20386 0 0 /news/kentleague/hythe/hythevslade081103.html 1 0 0 0 /news/thisisagreatdayforusaswecanannouncethatwearedebtfreesaysfolkestonechairman 4 22996 0 0 /news/preseasonresults2019 3 23598 0 0 /news/ileavetonbridgewithaheavyheartsaysdolby 2 7628 0 0 /news/rusthall2-2snodland 2 7644 0 0 /news/hernebay060815 3 10416 0 0 /news/551a9677a0e19 3 12561 0 0 /news/soccershortsformersouthendbossstevetilsonjoinsdoverathleticascover 1 12614 0 0 /news/ilford101205.html 1 0 0 0 /news/cordicewantstogetbacktowinningways 3 13450 0 0 /news/fiskwellgiveitourbestshotexclusiveinterview 2 7944 0 0 /news/tunbridgewells0-0crayvalley-wecannowfullyconcentrateonwembleysaysmartinlarkin 2 17310 0 0 /news/chattalbot160515 4 17010 0 0 /news/23rdjune03.html 2 0 0 0 /news/kentleague/deal/26thsept04.html 1 0 0 0 /news/ebbsfleet020120 2 7320 0 0 /news/walkerraidschathamfortwohighly-ratedyoungsters 6 19027 0 0 /news/facupspecialwehavenothingtofear 1 4224 0 0 /news/wellingtown301118 5 17450 0 0 /news/dulwich061117 2 7496 0 0 /news/drmartens/eastern/fisher/fisher.html 2 0 0 0 /news/chathamtown0-3romford-itwasourworstperformanceoftheseasonadmitskevinwatson 1 4841 0 0 /news/ifeltitwastherighttimetocallitadaysaysfrustratedkeithlevett 4 20706 0 0 /news/margate041220 2 7304 0 0 /news/theresnopointholdingbackatcarshaltonathleticsayswhitstabletownbossnickysouthall 2 7964 0 0 /assets/select2/tests/data/maximumInputLength.html 1 251 0 0 /news/braintree250916 3 10293 0 0 /assets/ckeditor/plugins/showblocks/images/ 1 497 0 0 /news/simonbalsdon230919 3 9953 0 0 /news/ebelnshi280215 2 17404 0 0 /news/wefeelthetimeisrighttostepdownsayssevenoakstownchairmantonysmart 5 20445 0 0 /news/istillwanttobehereintenyearssaysphoenixsportsmanagersteveoboyle 3 12324 0 0 /news/3rdjuly03.html 2 0 0 0 /news/sporstan270120 3 9176 0 0 /news/soccershortsiregretmyactionssayssuttonunitedbossdoswell 2 19632 0 0 /news/doverromptovictoryintable-toppingshowdown 2 6550 0 0 /news/lordswood100818 3 11125 0 0 /news/8thmar05.html 1 0 0 0 /news/theboysareupforgoingonarunsaysward 1 4079 0 0 /news/didctham290918 4 39759 0 0 /news/glebetoot030516 6 76890 2 2 /news/itsbeenveryhardthisseasonnotgoingupsaysdepartinghildenboroughbossandrewmckechnie 2 7862 0 0 /news/folkestoneinvicta0-0afchornchurch-cugleypositiveforlast-daysurvivalbid-exclusive 1 6436 0 0 /news/bluesquarefixtures 1 5396 0 1 /news/drmartens/eastern/folkestone/gravesend170704.html 1 0 0 0 /news/thamesmead110615 3 13332 0 0 /news/othernews/Foresters.html 1 0 0 0 /news/551bc5e58a9df 2 8624 0 0 /news/kentleague/sporting/sportvlord131203.html 1 0 0 0 /news/treblechasingwestwickhamemulateipswichtownbywinningprestigiouscup-exclusiveinterview 1 3371 0 0 /news/craywanderers3-1molesey-werepleasedwiththeprogressthatwevemadetodaysayskeithbird 3 28493 0 0 /news/whitstabletown1-2margateseagerthanksforshowingusrespect 3 20381 0 0 /news/ramsgate210519 4 13469 0 0 /news/holmesdale2-2rusthall 5 64094 3 3 /news/hythetown251120 2 6450 0 0 /news/beckenham110904.html 1 0 0 0 /news/551a9677dab31 1 5144 0 0 /news/551a956c80edb 1 4795 0 0 /news/folkestoneinvicta3-2billericaytown-saundersisalegendsayscugley-exclusive 1 6703 0 0 /news/sloughtown2bromley2 4 16373 0 0 /news/551a931e2a71c 4 14114 0 0 /news/ilikedderesprofessionalismandplanssaysnewsigninglyons 1 3703 0 0 /news/551bc5e230867 1 4320 0 0 /news/tonbethu140215 3 26742 0 0 /news/donttreatlordswoodlightlyhuntleytellshisside 2 8372 0 1 /news/dulwich261218 4 14584 0 0 /news/chairmanregainscontroloverteamaffairsascroydonneedtotakeanewdirection 6 20610 2 2 /news/itsreallyhardtokeepabovewatersaysboroboss 1 4888 0 0 /news/rymanleagueannouncefixtures 1 5033 0 0 /news/tonbridgebossestalktothefans 1 4746 0 0 /news/beckenham180219 4 15578 0 0 /news/canterbury190216 4 15645 0 0 /news/ryman/bromley/bromvgraysfr090803.html 2 0 0 0 /news/4thnov03.html 1 0 0 0 /news/soccershortsrockymcmillanstandsdownasglebemanager 3 34076 0 0 /news/551a96dca98ad 2 7940 0 0 /news/gwr190305.html 1 0 0 0 /news/dartstarget2000asfeelgoodfactorspreads 1 7849 0 0 /news/dartford2-1favershamtown-iwashopingtomakeabitofhistoryfortheclubsaysrayturner 3 62524 2 0 /news/sittingbourne110920 2 9962 0 0 /news/bromley040318 4 22586 0 0 /news/charltonathletic050121 3 10917 0 0 /news/advertisewithawinningteam 2 5134 0 0 /news/cugleysetsninepointtargetfromnextthreegames 4 20498 0 0 /news/551bc5e5e0ea0 1 3922 0 0 /news/551a931e251e7 1 4495 0 0 /news/gravesendnorthfleet1-3weymouth 2 11366 0 0 /news/ramsgate1-3hamptonrichmondboroughwardbemoanesnear-postfrailities 2 10075 0 0 /news/551a99e49fcd1 4 32211 1 1 /news/itstimetomoveonsaysdoverdirectorknight 1 4257 0 0 /national-league/28 2 9206 0 0 /news/551bc5e731abf 2 11595 0 0 /news/margateunveilplansforhartsdownpark 1 3239 0 0 /news/charltonathletic1-1millwalllionesses5-4pens-kiobelsbossdeniesmillwallcupglory 1 9175 0 0 /assets/uploads/content/Crockenhill_pitch 1 238894 0 0 /news/shorts060815 4 39378 0 0 /news/551a956c5387b 1 5006 0 0 /news/corialre121116 2 20338 0 0 /news/crewealexandra1-0ebbsfleetunited-wevenotgotwhatwevedeservedadmitsprouddaish 1 6825 0 0 /news/551a931d8fa3d 1 5118 0 0 /news/thefacupisaroadthatleadstogreatexcitingthingssaysramsgatebossjimward 2 8352 0 0 /news/march2011results 1 7432 0 0 /news/soccershorts140717 2 11884 0 0 /news/wealwell050318 4 31142 0 0 /news/wemustntgetleft-backinplay-offhuntsaysward-exclusive 2 7066 0 0 /news/webelievewearemakingbestuseofourbudgetsaysbromleybossmarkgoldberg 6 22813 0 0 /news/ebbsfleetunited3-1farsleyceltic-letsfinishoffthejobsaysdaish 3 45254 2 1 /news/updatedmonday0945-travelchaosforkentcommuters 1 3064 0 0 /news/ksports130917 4 13738 0 0 /news/kentleague/VCD/14thjuly04.html 1 0 0 0 /archive-2006-2014/72 1 4829 0 0 /news/jenkinssignsplayerstoplughisleakydefence-exclusive 1 5162 0 0 /news/lordswood3-1westwickham-robnormanisgoingtobeastarinthemakingsaysjasonlillis 1 5177 0 0 /news/551a9798de1bc 2 9672 0 0 /news/22ndaug04A.html 1 0 0 0 /news/punjab070819 4 18694 0 0 /news/itjustshowspeoplearewillingtohelpwhensomebodyneedsitsaysdarrenanslow 4 25846 0 0 /news/othernews/28thaug03.html 1 0 0 0 /news/margate070219 3 11427 0 0 /news/greenwich280716 1 4554 0 0 /news/kentleague/tunbridgewells/27thsept04.html 1 0 0 0 /news/myaimistobondeveryonesaysnewfolkestoneinvictachairman 1 8343 0 0 /news/chipstead190616 2 7932 0 0 /news/punjab010819 4 14020 1 0 /news/hytheast180818 4 38968 0 0 /news/iwantmyteamtobeanharduglyhorribleteamtoplayagainstsayswhitstablebosspeternott 1 3698 0 0 /news/ferkinsbringshistrustedteamwithhimtogreenwichborough-exclusive 1 4210 0 0 /news/charltonsstarsplaybelvederetoraisemoneyforillyoungster 2 6978 0 0 /news/maidstone161115 4 25530 1 1 /news/bromley201119 2 9056 0 0 /news/wellingunited200119 4 14202 1 0 /news/letshopewecanhaveasuccesfulendtoourseasonsaysbearstedbosstonycornwell 3 12742 0 0 /news/pre-seasonfriendlies-1 2 5439 0 0 /archive-2006-2014/157 2 8912 0 0 /news/harlowfat091004.html 1 0 0 0 /news/hernebay090720 4 15694 1 1 /news/greenwichborough3-1tunbridgewells-iwasquiteconfidentwewouldwinitsaysjohncumberbatch 5 52838 1 1 /news/wemustbeattheteamsaroundussaysdaish 1 4652 0 0 /news/lordsvgreen280204.html 1 0 0 0 /news/wallisstepsdownasfolkestoneinvictachairman 1 3095 0 0 /news/wemustfindourshootingbootssaysward 1 4335 0 0 /news/magnificentangelschairmanpaystributetowarrilow-andheroicplayers-exclusive 1 4489 1 0 /news/wingssignpairintimefortrophytie 2 6765 0 0 /news/drmartens/premier/dover/22jan04.html 1 0 0 0 /news/crayvalley081217 2 7270 0 0 /news/greenholl120415 4 67453 0 1 /news/kingstonian4-1thamesmeadtown-yougetpunishedatthislevelsayskeithmcmahon 5 45997 0 1 /news/551bc99d4d5e6 1 4176 0 0 /news/ryman/bromley/carsvbromfat011103.html 1 0 0 0 /news/elmslord190716 4 37694 0 0 /news/thefacupfourthqualifyingrounddraw 3 10973 0 0 /news/dartford3-0greatwakeringrovers-weshouldhavepunishedthembymoreadmitsburman 3 33285 1 1 /news/wembleyblownawaybyimpressivehernebay 2 17767 1 1 /news/metropolitanpolice1ramsgate0sat29thapril2006 1 5851 0 0 /news/wearelookingtoretaintheplatesayshernebaymanageranthonydeer 4 17834 0 0 /news/dartfordbosstonyburmansignsadambirchallonloanfromgillingham 3 11823 0 0 /news/weoweharrowafavoursaysburman 1 3705 0 0 /news/ramsgatemanagernominatedforprestigiousbbcsportsaward-exclusive 2 7341 0 0 /news/ramsgate080319 3 10458 0 0 /news/soccershortscounciltocovercostofdealtownsnewclubhouse 1 4328 0 0 /news/formerskipperreturnstofisher 2 11129 0 0 /news/whitstable260519 4 14697 0 0 /news/itsoutofourhandsadmitsburman 2 9540 0 0 /news/longmyenglandexperienceswillhelpthefleet 5 25172 0 0 /news/iwantustobesuccessfulsayssevenoakstownbossdarrenanslow 2 8799 0 0 /news/ramsgatevhythe120803.html 2 0 0 0 /news/favershamunveilsoutansigning 2 7747 0 0 /news/sevenoakstown4-4folkestoneinvicta-eight-goalepicgoodadvertforkentfootball-jones 1 7747 0 0 /news/phoenix120419 2 7942 0 0 /news/beckmill260718 1 8125 0 0 /news/thefacupsecondqualifyingrounddraw 3 13058 0 0 /news/wevegotgreatexpectationstobringthecuphomesaysaddicksbossstuartweston 3 14772 0 0 /news/othernews/22nddec03.html 1 0 0 0 /news/551bc99e4ba9f 1 5257 0 0 /news/keisterletslookforwardnotback 1 4389 0 0 /news/doyouwanttoworkfromhometosellbanneradvertisingapplynowstarttomorrow 1 2919 0 0 /news/iwouldliketogobackintomanagementsaysdouble-winnermickycollins 1 5212 0 0 /assets/qz-print/lib/ 6 2329 0 0 /news/craywands251215 3 13890 0 0 /news/savethewingscampaignonelastpushandwerethere-targetisnow6312 1 6115 0 0 /assets/smartmenus/libs/jquery/ 5 1826 0 1 /news/ithasbeenahardyearbutwellputitrightin2013intheleaguevowsmarkgoldberg 3 12643 0 0 /news/punjab180119 5 18427 0 0 /news/thiswasanopportunitythaticouldntturndownsayscorinthiansnewbossjamescollins 4 15819 0 0 /news/23rdoct05.html 2 0 0 0 /news/drmartens/eastern/folkestone/havantvfolkfat291103.html 1 0 0 0 /news/greenwich091118 3 11817 0 0 /news/hitfav190916 3 27515 0 0 /news/holmesdalewalkedoutandforfeitedgame-claimsanonymousholmesdaleplayer 1 3783 0 0 /news/551bc5e7cb47c 1 3234 0 0 /archive-2006-2014/26 3 14893 0 0 /news/davidsonbreakslegduringkentseniortrophytie 2 6198 0 0 /news/551bc99b25b22 1 5865 0 0 /archive-2006-2014/255 6 25436 0 0 /news/551a95b38e1f7 2 6762 0 0 /news/bynomeanswellbeunderestimatingourfacupopponentsinsistschathamtownbosskevinwatson 2 7567 0 0 /news/itsbeenarealstruggletokeepholdofmyplayerssayslewishamboroughbossdarrellqueeley 2 8982 0 0 /news/551bc5df37c77 1 4277 0 0 /news/22nddec03.html 1 0 0 0 /news/bearsted120916 2 8576 0 0 /news/walkerurgesfanstobackteamandstopcriticism 1 4766 0 0 /news/folkestoneinvicta3-2hernebay-bulgarianmakesgoodearlyimpression 1 4045 0 0 /news/falanaletsgettonbridgepromotedexclusiveinterview 4 19382 0 0 /news/thefinalcountdownresultsapril2008 3 20097 1 1 /news/9thjuly04.html 2 0 0 0 /news/sittingbourne010617 2 6914 0 0 /news/drmartens/eastern/dartford/4thdec04.html 1 0 0 0 /news/lordswood230916 2 6545 0 0 /news/fisher110119 4 15522 0 0 /news/deresappointfromwithin 1 2965 0 0 /news/resultsapril2016 3 36473 0 0 /news/iwouldlovenothingmorethanforustowinapieceofsilverwaresaysgillsbossjamesmarrs 2 9291 0 0 /news/collectingamassivethreepointsfromsevenoakswillnotbeeasyadmitshalsey 2 8352 0 0 /news/lovellwemuststayincontention-exclusiveinterview 1 3833 0 0 /news/thamesmeadtown3-1romford-ithoughtwewereabitunplayableattimessayskeithmcmahon 1 7963 0 0 /news/551bc99c5cee2 1 5891 0 0 /news/bromley101118 4 24629 0 0 /news/KentFAStatement200820 3 12473 0 0 /news/hythe220719 3 10659 0 0 /news/binkswevegotninecup-finalstoplayexclusive 3 14557 0 0 /news/wilkinsonreturnstodovertostiffencompetition 2 7563 1 0 /news/swalebrom030416 5 78614 1 1 /news/corinthian0-2beckenhamtown-ineedanewchallengesaysmattlonghurst 4 45215 0 0 /news/itssuchabonustotheteamwhenthefansgetcrabblerockingsaysdoverskipperiansimpemba 2 8314 0 0 /news/551bc99de9329 1 5196 0 0 /news/greeniesfridaypreview-3 4 26468 0 0 /news/hamble200805.html 1 0 0 0 /news/codyhastherawingredientsofatopstrikersaysgunn 2 8605 0 0 /news/maidstoneunitedstrikerdannyhocktonisoutforrevengeatcray 2 9218 0 0 /news/wejustneedtobealittlemoreconsistentadmitssittingbournebossnickdavis 1 3833 0 0 /news/imsuretheplayerswillputinagoodperformanceagainstdoversaysdartfordbosstonyburman 1 4243 0 0 /news/551bc99b01e16 1 8118 0 0 /news/551a931e077b8 1 5121 0 0 /assets/select2/vendor/ 7 2878 0 0 /news/erithbelvedere4-1cobham 1 5159 0 0 /news/dealtown031117 2 6864 0 0 /news/drmartens/eastern/ashford/24thmar04.html 1 0 0 0 /news/chatwalt220816 3 46426 1 0 /news/roarfavershamtowardsthetitle 1 3888 0 0 /news/bromley200320 2 7110 0 0 /news/phoenix021115 3 11439 0 0 /news/cugleyletsmakeagoodimpression-exclusiveinterview 5 24905 1 0 /news/bromchar270719 5 41237 0 0 /news/itwouldbenicetogetovertwothousandatstonebridgeroadsaysfleetbossstevebrown 3 13935 0 0 /news/551bc5dea4a6a 3 10701 0 0 /news/stoneschairmanpaystributetofund-raisingfans 1 3788 0 0 /news/croyvcd240816 2 20292 0 0 /news/doverathleticstrengthentheirboardwiththreenewadditions 1 4330 0 0 /news/551a96db9dab8 8 97130 6 4 /news/tunbridgewells1vcdathletic1aet-vcdathleticwin3-1onpenalties-exclusiveinterview 1 5762 0 0 /news/metrogas220415 3 11560 0 0 /news/footballassociationplaceafcfisherinkentleague 1 3540 1 0 /news/551a95b41f7fc 4 21773 0 0 /news/itsgreatforbromleytobeinvovledinatop-of-the-tableclashsaysbossmarkgoldberg 2 11758 0 0 /news/AshfordRefereesCharityRun240121 4 13305 0 0 /news/chathamtownnamejonathanpearceascommunityschemepatron 1 4090 0 0 /news/conference/gravesend/17thjuly03.html 2 0 0 0 /news/ifwecanplaywellithinkwecangotoarundelandwinsaysphoenixbosssteveoboyle 3 9846 0 0 /news/rusthall060918 3 13775 0 0 /news/551a99e34a33b 1 4031 0 0 /news/drmartens/premier/welling/dartford091104.html 1 0 0 0 /news/werestickingtogetherandfinishingoffthejobthattonyrussellstartedsaysjamescollins 3 15480 0 0 /news/lucrativeramsgatedealprisesgarethcornhillawayfromwhitstabletown 2 7228 0 0 /news/wevegottofancyourselvesnowsaysbeckenhamtownbossjasonhuntley 1 5133 0 0 /news/551bc5dc45146 1 3429 0 0 /news/thamesmead240818 3 13938 0 0 /news/soccershorts060619 3 23783 0 0 /news/29thsept03.html 1 0 0 0 /news/dulwich110318 1 3390 0 0 /news/sevenches170916 2 19953 0 1 /news/ashfordtown0-4moleseychiefexecutiveiapologiseforatrociousdisplay 4 23972 0 0 /archive-2006-2014/196 3 12574 0 1 /news/fisher030519 6 21804 1 0 /news/hendmarg170515 4 33376 0 0 /news/knightgetsnodforswansshowdown 1 4053 0 0 /news/hollands080319 4 16170 0 0 /news/ramswillknockbrightonoutoffayouthcupinsistsbossperry-exclusiveinterview 2 6658 0 0 /news/dulwichhamletfanscanasktheexpertsonfanownership 4 17108 0 0 /news/folkestoneinvicta2maldontown0exclusiveinterview 4 19882 0 0 /news/551bc99c9df92 1 5240 0 0 /news/drmartens/premier/welling/2ndjuly03.html 2 0 0 0 /news/kentseniorcupsemi-finaldraw-1 2 6050 0 0 /news/craywands121018 4 18462 0 0 /news/theclubisnotgoingtobebuiltovernightsayscrockenhillbosscraigclark 3 10736 0 0 /news/bromley270616 4 16750 0 0 /news/wearedowntothebarebonesadmitslordswoodbosspiggott-exclusiveinterview 5 20337 0 0 /news/refereeshavetoearnrespectfumescugley 2 13052 0 0 /news/wellingtown160220 4 21380 0 0 /news/phoenixsports180920 3 11791 0 0 /news/greenwich090817 1 3778 0 0 /news/hernebay200517 1 4901 0 0 /news/551bc5e3d3f79 2 9846 0 0 /news/luchforddefendsplayinghisteaminreserveshocker 2 11127 0 0 /news/551bc5e87cffb 2 8191 0 0 /news/weknowwhatwehavetodotostayupsaysmunday 1 5214 0 0 /news/fisher0-3phoenixsports-wewillturnthingsaroundsaysfisherjoint-bossbillywalton 3 29830 0 0 /news/551bc5e91b290 4 26590 1 1 /news/favershamunveillucrativesponsorshipdeal 1 4842 0 0 /news/551a9250906a5 1 4305 0 0 /news/16thmay05.html 2 0 0 0 /news/weneedtobeinthesouthpurelyforthefinancialaspectsayschathamtownbosskevinwatson 1 4510 0 0 /news/chathamtown0-2harrowborough-wedidntcausethemenoughthreatgoingforward-kevinwatson 3 13873 0 0 /news/hollands100818 1 4800 0 0 /news/551a9c92f1483 1 6893 0 0 /archive-2006-2014/280 4 17286 0 1 /news/vickersbeatthebigfreezetokeepinshape 1 3695 0 0 /news/tunbridgewells300720 3 10214 0 0 /news/craychar201217 1 9011 0 0 /news/dealtown291119 2 6570 0 0 /news/dartford1-1wellingunited-werehopingthatwemaygetsomegoodembargonewssoon-day 1 7321 0 0 /news/rusthall130818 1 4235 0 0 /assets/ckeditor/CHANGES.md 1 83175 0 0 /news/croytunb020915 5 54637 0 0 /news/wingsexpecttolosestarstrikerkedwell 5 19493 0 0 /news/resultsfebruary2020 3 29927 0 0 /news/soccershortsfolkestonecoachlindseytakesupgillsyouthrole 3 29192 1 1 /news/phoenixsports180119 4 16202 0 0 /news/ihopewecancreatesomerealexcitementbybeinginthedrawforthenextroundsaysrayturner 5 21696 0 0 /news/wembleywinnersfanslinestreetstohonourkentheroes 2 6827 0 0 /news/drmartens/premier/dover/13thaug04.html 1 0 0 0 /news/margatep-pwealdstone-ithoughtitwastherightdecisiontocallitoffsaysbutler 1 4213 0 0 /news/wemustdobettersaysperona-exclusive 2 8129 0 1 /news/lyddtown010819 3 11084 0 0 /news/551a9677cad45 1 3585 0 0 /news/edwardskentseniorcupcryingoutformakeover 3 13382 0 0 /news/maidstone280519 4 16518 0 0 /news/FAStatement190820 5 18677 0 0 /news/greenwich271218 3 10797 0 0 /assets/ckeditor/plugins/link/ 5 1887 0 0 /news/fisher210916 2 8318 0 0 /news/drmartens/eastern/erith&belvedere/carterton210904.html 1 0 0 0 /news/mileoak011105.html 2 0 0 0 /news/strikerlovellremainsonthesidelines 2 6922 0 0 /news/thisseasonhasbeenaroller-coasterwithupsanddownsreflectschathamtownbosskevinwatson 1 4622 0 0 /news/sykochallengedetails 1 3649 0 0 /news/chelmsfordcity1margate0 4 16493 1 1 /news/mcmahonvowstospendwiselywhennewstadiumisbuilt 2 9483 0 2 /news/corishep060419 5 59468 0 0 /news/dolbyunveiledasnewhastingsboss 2 9896 0 0 /fisher-2003-2006 13 38793 0 1 /news/iknowtheplayersivegotherewillgetusoutofthemessvowswhitstabletownbosspeternott 1 4860 1 0 /news/KentCountyLeagueStatement070720 10 0 10 10 /news/nationwide/7thjuly03.html 2 0 0 0 /news/carshaltonathletic2-0tonbridgeangels-iveletdownmymatecugleyadmitswarrilow-exclusive 1 6803 1 0 /news/holmesdaleunveildanmorrisastheirnewmanager 3 11495 0 0 /news/fleetlaunchthecrossbarchallenge 5 18838 0 0 /news/dolbyrelishingplay-offfinalshowdown 1 5157 0 0 /news/wewanttogetintotheplay-offssaysdartfordbosstonyburman 1 4929 0 0 /news/stonesbossjaysaundersinnegotiationswithgoalkeepertimroberts 1 3910 0 0 /news/derestraveltowarlinghamfordoubleheader 1 2784 0 0 /news/drmartens/premier/dover/12jan04.html 1 0 0 0 /news/gormanbelieveshissidecanwinpromotion-exclusiveinterviews 3 13676 1 0 /news/gillinghamunveilsimonratcliffeastheirnewladiesmanager 3 12687 0 0 /news/hareasksforfanspatienceduringearlywarm-upgames 1 4393 0 0 /news/ramsgate1-2afchornchurch-ourbigplayersdidntturnupadmitsward 2 11690 0 0 /news/drmartens/premier/welling/welling.html 2 0 0 0 /news/daishaddsquinntohisdepletedsquad 6 18908 1 0 /news/AFCtotton100905.html 1 0 0 0 /news/wecancompeteatconferencesouthlevelwejustneedabitofhelpsaystonbridgeangelschairman 3 22343 0 0 /news/ebbsfleet140116 4 18394 0 0 /news/kentrivalslookingup 2 10597 0 0 /news/551a956bbe55f 2 5670 0 0 /news/stamford081005.html 2 0 0 0 /news/drmartens/eastern/sittingbourne/sittvdart141003.html 1 0 0 0 /news/cantebelv221115 3 29130 0 0 /news/folkvroth061203.html 2 0 0 0 /news/chathamcompletepulmansigning-exclusive 5 16100 0 0 /news/kentleague/maidstone/17thnov03.html 1 0 0 0 /news/thenewboardiscommittedtochangethestructure-folkestoneinvicta 1 3906 0 0 /news/resultsjan2016 4 44074 0 0 /news/ihavenoaxetogrindsaysex-favershambosscopley 4 17065 1 2 /news/margatevfarnborough250803.html 1 0 0 0 /news/fordwelookafterourtopstrikepair-exclusiveinterview 3 11714 0 0 /news/551bc5e64ac1d 2 9340 0 0 /news/erithbelvedereunveilthesigningofjohnwilfort 2 8149 0 0 /news/551a96db3909b 2 8494 0 0 /news/youcannowdoyouronlineshoppingwithus 1 3593 0 0 /assets/fileman/php/dirtree.php 1 89 0 0 /news/commentlondonriots 1 2897 0 0 /news/ashfordmiddlesexwasalwaysatoughplacetogosaysstonesbossjaysaunders 1 3517 0 0 /news/ashfordravagedbyinjuriesforymcavisit-exclusiveinterview 2 11084 0 0 /news/wehavetotrytogetawayfromthebottomofthetablesayswhitstabletownbossnickysouthall 2 9980 0 0 /news/sceflstatement100420 3 11636 0 0 /news/margatesettounveiltheirnewmanagerlaterthisweek-exclusive 2 6378 0 0 /news/551a99e3ed403 2 18494 1 1 /news/resultsoctober2018 4 42342 0 0 /news/551a96786698b 1 4101 0 0 /news/551bc99e5b318 1 6997 0 0 /news/margatelookingtobounceback 1 4327 0 0 /news/drmartens/eastern/erith&belvedere/berkhamsted161104.html 1 0 0 0 /news/othernews/15thaug03.html 2 0 1 0 /news/kentseniorcupquarter-finaldraw 1 2859 0 1 /news/webelievewehavesignedthebestplayeratthislevelsayskfumanagersammacneil 4 18576 0 0 /news/allmanmakesdecisiononhisfuturewithinthenextcoupleofweeks 5 22291 0 0 /news/fisher130716 3 11967 0 0 /news/robbinsheapspressureontable-toppingrivals 1 4102 0 0 /news/istillfeelihavesomethingtooffersaysdoverathleticbossnickyforster 1 3289 0 0 /news/crockenhillcaughtusonagooddaysayshollandsblairbosspaulpiggott 4 19976 0 0 /news/weknewwereinadifficultsituationsaysdartfordbosstonyburman 2 7481 0 0 /news/dagenham030120 2 7518 0 0 /news/551a9cf57b1b8 2 8900 0 0 /archive-2006-2014/235 3 13177 0 0 /news/ryman/bromley/28thsept03.html 1 0 0 0 /news/551bc5dee4f4d 3 13288 0 0 /news/drmartens/eastern/ashford/26thsept04.html 1 0 0 0 /erith-belvedere-2003-2006/ 1 3053 0 0 /news/welldul040817 4 31902 0 1 /news/chathamtown0-2dulwichhamlet-theplayersarentgivingtheirbestsayswatts 2 10828 0 0 /news/farepresentativefailstoturnupatleaguemeeting 2 6962 0 0 /news/milesdelvesintotransfermarket 1 2956 0 0 /news/551a9718a5058 4 12606 1 0 /news/551a96db69375 4 15666 0 0 /news/doverathletic220518 3 10182 0 0 /news/myplayershaveconfidenceandbeliefineachothersayswandsassistantjoefrancis 1 3959 0 0 /news/itsadayforhernebayheroessayswembleywinnertommysampson 1 6645 0 0 /news/phoedart240716 6 119958 3 1 /news/wemustmatchopponentsbattlingqualitiessayslovell 1 3347 0 0 /news/ashfordarrangespecialbenefitmatchforcunningham 2 8273 0 0 /news/rymanreports 1 18703 0 0 /news/wecanonlygoupatthemomentsayslovell 1 4915 0 0 /archive-2006-2014/43 4 20537 0 0 /news/keevillisinmylong-termplanssaysmcmahon 2 8662 0 0 /news/wereplayingwellasateamsayscugley 2 8361 0 1 /news/soccershortsrobbinslandsexetercityscoutingjob 3 23141 0 0 /news/apmbrowning240515 3 14786 0 0 /news/yorathandsouthallwillleadustosuccessnextseasoninsistspiper 2 7254 0 0 /news/kessellrejectsdovermove 2 12262 0 0 /news/551bc5e045a1d 2 11438 0 0 /news/corinthian100818 1 3500 0 0 /news/maidstone020915 4 14741 0 0 /assets/ckeditor/plugins/about/ 5 1808 0 0 /news/iregretmovingtodartfordadmitscarley 2 7229 0 0 /news/weneedagoodeastersaysnott 1 4144 0 0 /news/dartsgills161115 4 56038 1 0 /news/craywands120118 1 4420 0 0 /news/theclubmeansbusinessandwewanttomakeaswiftreturnsayscraywanderersbosskeithbird 3 10659 0 0 /news/suttchip100518 2 18312 0 0 /news/imgladtobegettingbackintofootballafterbeatingthroatcancersayschrismccarthy 4 16562 0 0 /news/margatebeginsearchfornewmanagerafterpartingcompanywithtrott 1 4205 0 0 /news/elmstead031117 3 12069 0 0 /news/ashfordtownsettounveilrecordsponsorshipdeal 2 6168 0 0 /news/hessenthalermyteamwontsufferfromawinterhibernation 1 5048 0 0 /news/tunbridgewellsdreamoftriptogermany 1 3710 0 0 /news/bromwork060218 3 29277 0 0 /news/itsgoingtotaketimetobesuccessfuladmitscorinthiancoachdouglas 1 4045 0 0 /news/tonbridgeangels2-2maidstoneunited-fansbehaviourmarspulsatingderby 1 6499 0 0 /news/noonehasthedivinerightforsuccesssaysdoverathleticchairmanjimparmenter 1 4358 0 0 /news/551bc99c19980 1 6870 0 0 /news/chipstead2-0hernebayaet-hernebaymissthechancetoprogress 2 12793 0 0 /news/facupfirstrounddrawebbsfleetunitedhighlightstobescreenedonitv 2 6898 0 0 /news/kingstonian201104.html 2 0 0 0 /news/551a97b051e2f 1 5071 0 0 /news/leatherhead0-1hythetown-thenewhytheisabetterhythesaysscottporter 2 16888 0 0 /news/wevegottowinthefightinsistschatsleaderobrien 2 7722 0 0 /news/wethriveonbeingtheunderdogssayshythetowndefendertomparkinson 1 4885 0 0 /assets/select2/CONTRIBUTING.md 1 4911 0 0 /news/tonbridgeangels1-3hamptonrichmondborough 1 6134 0 0 /news/551bc5e250c8c 1 3083 0 0 /news/phoedere130916 3 24890 0 1 /news/wereluckyenoughthatwevegottwochancesofmedalssaystunbridgewellsbossmartinlarkin 2 10380 0 0 /news/seanmuggeridgetakessolechargeaftersimoncolbranquitscrowboroughathletic 3 10012 0 0 /national-league/33 2 9497 0 0 /news/englandlionesses280615 3 13709 0 0 /news/keisterreturnstomargate 2 7466 0 0 /news/hendon0-0ramsgate-wardpleasedwithhiscapitalgains 1 5608 1 0 /news/551bc99d50232 1 6070 0 0 /news/masonhailsfavershamsupport 1 4601 0 0 /news/phoenix080818 4 16789 0 0 /news/whitstablebay260617 3 13449 0 0 /news/bromleystrikermcbeantargetsplay-offpush 1 3868 0 0 /news/soccershortsramsgatestarsreturntohonourloyalservantwarrenschulz 5 39805 0 0 /news/fisher191016 2 8873 0 0 /news/lewisham171119 3 11024 0 0 /news/sevechic091119 2 20658 0 0 /news/cumbersmakesgoodfirstimpressionwithstonesfaithful-exclusive 1 4234 0 0 /news/doverathletichasarealbeliefinitsyouthsystemsaysacademymanagermichaelsandmann 1 4569 0 0 /news/hernebay291018 3 11604 0 0 /news/dartfordstrikermcdonaldpens18-monthdealwithcanaries 2 9016 0 0 /news/margate3-4maidstoneunited-strikercumberswantshisgillinghamchance 1 7132 0 0 /news/551a931e52b9e 3 10851 0 0 /news/wecantrelyonotherteamssayslovell 2 8010 0 0 /news/localoffendersassistwithramsgatesgroundimprovements 1 3435 0 0 /news/sittingbourne2-4bartonrovers 2 9384 0 0 /news/tomorrowwillbemylastgameinchargeofsittingbournesaysmarcseager 1 5472 0 0 /news/vcdathletic9-2lordswood-someonewasgoingtotakeahidingsoonerorlatersaysraypowell 2 18078 0 0 /news/551a9c91c0759 2 10656 0 0 /news/deal290718 1 4500 0 0 /news/sevenmaid140716 3 32160 0 0 /news/hopefullywecanmakeourgroundabitofafortresssayscharltonathleticstrikersampittuck 3 13876 0 0 /news/easthythe171015 6 61538 1 1 /news/itsamagnificienttimetobeatbromleysaysneilsmith 4 18606 1 0 /news/551a94af410a5 4 11785 0 0 /news/atop-sixfinishisstillwithinreachsaysdealtownbossderekhares 1 4210 0 0 /news/welling230218 4 15362 0 0 /news/wejustneedtokeeptherungoingsaysfavershamtowncoachclivewalker 3 13055 0 0 /news/tonbridgeangels0-1newportcountybraveangelsreflectonwhatwouldhavebeen 1 6163 0 0 /news/551a931e162a9 1 3580 0 0 /news/fleetreachverbalagreementwithnewsponsor 5 17906 0 0 /news/kentleague/beckenham/20thjuly03.html 2 0 0 0 /news/ticketsforkentsbiggesteverderbysoldout 1 3253 0 0 /news/551a931deb1be 3 13041 0 0 /news/wemustfindtherightmansaysmargatechief 1 3992 0 0 /news/weveworkedhardoverthelast18monthstogetourgrounduptoscratchsayspaulpiggott 2 9203 0 0 /news/551a9678b76f2 1 5784 0 0 /news/horsham271104.html 1 0 0 0 /news/551a97998e8c4 2 9581 0 0 /news/chipstead060715 4 14661 0 0 /news/fisher160718 1 3689 0 0 /news/leaguemerger180216 4 31591 1 1 /news/stoneschairmanwritesoffhispersonalloanstotemptnewinvestors 2 7602 0 0 /news/rusthall050918 1 4251 0 0 /news/dovebrom141017 2 17910 1 1 /news/weneedyoursupportatbourneparksaysstoneschairman 1 4049 0 0 /news/aylemarg011120 9 100980 0 0 /news/iamverypleasedtohaverhyslawsonjoiningtheclubsayslordswoodbosssimonhalsey 7 43856 2 2 /news/martinhayesunveilsloantransferofstrikerjonmain 1 4158 0 0 /news/resultsoct2015 3 34836 0 0 /news/ramsgatebeatstheweathertothedelightofmanagerjimward 1 3947 0 0 /news/wedliketobeatthatlevelwheregillinghamaresaysbromleyravenettesbossstevepayne 5 23108 1 1 /news/folkestoneinvicta2-2leatherhead5-3pens-werehopefulwecangetpromoted-delo 2 13082 0 0 /news/ramsassistantwarnsthanetfoesmargateweregoingtogivesomeoneaheavydefeat-exclusive 2 11284 0 0 /news/reserveteammanagerrequiredforwarlingham-tostartimmediately 1 2791 0 0 /news/thefatoprovidefundingfornewkentinvictaleague 1 3379 0 0 /news/kentleague/greenwich/26thaug03.html 1 0 0 0 /news/drmartens/premier/welling/8thJan04.html 1 0 0 0 /news/551bc5e91e0e9 3 14453 0 0 /news/bromley010718 4 17480 1 1 /news/wellingunited291019 2 6568 0 0 /news/maidstone260518 3 9459 0 0 /news/itstimeformyplayerstoshineandgrabthatbitofglorysaysmartinlarkin 2 12040 0 0 /news/18thsept04.html 1 0 0 0 /news/margateunveildreammanagementteam 1 2920 0 0 /news/dorkgreen130816 2 17786 0 0 /news/soccershortsblackmandevereuxandhessenthalerunveiledasassistantmanagers 6 51716 0 0 /assets/select2/src/scss/theme/ 1 373 0 0 /news/kentleague/maidstone/9thsept04.html 1 0 0 0 /news/leyton270805.html 2 0 0 0 /news/transfernewstalksaregoingwellwithmyhigherleaguetargetssaysburman 2 8811 0 0 /news/itsatwo-yearplantobechallengingorthetitlesayscanterburycitybosssimonaustin 1 4449 0 0 /news/itsdowntotheplayerstomakesurewefinishoffthejobsaystonybeckingham 3 12428 1 0 /news/ramsgate200704.html 2 0 0 0 /news/ourrewardistoplayatwembleysaysfleetstarmcphee-exclusive 1 3582 0 0 /news/sittingbourne2-0folkestoneinvicta-therewasnoneedforaustinsbadtacklefumesabbott 2 14194 0 0 /news/chatham081204.html 2 0 0 0 /archive-2006-2014/161 4 17229 0 0 /news/ebbsfleet180321 13 61343 0 2 /news/sevenash130416 8 149887 4 4 /news/kentleague/thamesmead/18thsept03.html 1 0 0 0 /archive-2006-2014/152 4 18228 0 0 /news/22ndsept05.html 2 0 1 0 /news/weneedtodoalittlebitmorebeforewecanbeconsideredseriouscontenderssaysstevechapman 3 11761 0 0 /news/itsgoodtomakehistoryfortheclubsayscrayvalleybossstevechapman 3 13958 0 1 /news/transferembargosettosinkfish 2 6770 0 0 /news/ebbsfleet220518 3 11310 0 0 /news/afcautism170820 3 9166 0 0 /news/crawforditstimeweshowedsomeheart-exclusiveinterviews 4 26224 0 0 /news/sevelord110818 5 54937 0 0 /news/ryman/bromley/11thjuly03.html 2 0 0 0 /news/kentleague/ramsgate/29thsept03.html 1 0 0 0 /news/adambirchallwilladdthatlittlebitofqualitytothesquadsaysdartfordbosstonyburman 4 15468 0 0 /news/551a99e530841 1 4837 0 0 /news/551a956bde16e 4 19130 0 1 /news/afccroy190216 4 14785 0 0 /news/weneedmoreexperienceinoursideadmitsyorath 2 8128 0 1 /news/551bc5e81da42 2 10360 0 0 /news/soccershorts070820 5 24962 1 1 /news/itsbeenthebestseasonsinceivebeenmanagersaysthamesmeadtownbosskeithmcmahon 3 13243 0 0 /archive-2006-2014/104 1 4936 0 0 /news/551a9c0e95239 3 24057 0 0 /news/maidstoneunited110320 2 9254 0 0 /news/phoetilb090116 3 25746 0 0 /news/551a9798ba853 2 9968 1 0 /news/folkestone020618 4 17298 0 0 /news/pitchero.com/clubs/whitstablebayfc 2 0 0 0 /news/craywandererslaunchacademyset-up 1 3776 0 0 /chatham-2003-2006/ 1 3007 0 0 /news/551bc5e52f8e5 2 15210 0 0 /news/warrilowhits-backatmindlessforumjibes-exclusive 2 10292 0 0 /news/hernebay260416 4 13817 0 0 /news/maidstoneunited2-2harrowborough-sloppydefendingcostusthepointsadmitshume 2 11924 1 0 /news/wehavetobetakenabitmoreseriouslysayscorinthianbossjamescollins 2 7872 0 0 /news/fleetfinallygetclearanceforscottishwingeranderson 3 9648 1 0 /news/festivematchreportshastingsunitedbeginsearchfornewboss 1 16483 0 0 /news/drmartens/eastern/ashford/2ndaug04.html 1 0 0 0 /news/fatrophyspecialhessenthalerseriousaboutextendedtrophyrun 2 7736 0 0 /news/551a9250d54af 3 19821 0 0 /news/crowboroughathleticdefenderchrisransomebecomesclubsshirtsponsor 8 28105 4 4 /news/rymanpos120515 4 12638 1 0 /news/ryman/bromley/1stsept03.html 1 0 0 0 /news/551a95b3998b5 2 6243 0 0 /news/welldonethefleet-weresoproud 1 2651 0 0 /news/itwouldbeniceifjohanterhorstcangooutonahighsaysneilcugley 4 20717 0 0 /news/tonyrussellquitserithtownafterleadingdockerstokentleaguesummit 4 15990 0 0 /news/strikermovementsinnorthkent 5 20198 0 0 /news/551a9678ac42a 1 6356 0 0 /news/farnieweneedbetterbackingexclusiveinterview 5 22470 0 0 /news/stonesreleaseroyston 1 3563 0 0 /news/23rddec05.html 2 0 0 0 /news/551a931eaf03e 2 7716 0 0 /news/greenwichborough2-2whitstabletownseagerourworsedefensivedisplayfor15months-exclusive 1 6476 0 0 /news/tonbridgeangels210121 2 15862 1 1 /news/551a9718bea53 4 13047 0 0 /news/kentleague/deal/Sampson6.html 1 0 0 0 /news/wereinafalsepositionsaysbromleycoachneilsmith 2 8518 0 0 /news/551bc5e47aa6a 1 4703 0 0 /news/551a925081721 5 32224 0 1 /news/erithtown240105.html 1 0 0 0 /news/beckenham070918 4 15874 0 0 /news/551a979a1ecca 2 11232 0 0 /news/551bc5db2ec42 2 6786 0 0 /news/wehavetoworkwithwhatwevegotsayscorinthianbosstonysitford 2 7691 0 0 /assets/ckeditor/plugins/dialog/ 5 1846 0 0 /news/greenwich050108 1 5633 0 0 /news/maidstoneunited0-1margate-margatewerethebettersideadmitshume 1 6012 0 0 /news/kentleague/erithtown/erithvlords081103.html 1 0 0 0 /news/stansfeld310820 3 12284 0 0 /news/todaysresults 1 3178 0 0 /archive-2006-2014/60 2 10192 0 0 /news/wewillbouncebackfromfacupexitinsistsburman 1 3917 0 0 /news/fisher3-0nortonsports-everyonelovestohateusbutwedontcaresaysnortonsbentaylor 3 28214 0 0 /news/kentsenfinal300415 4 20670 0 0 /news/dealtown091118 4 12520 0 0 /news/FAGuidance010620 3 11959 0 0 /news/ramsgate160417 1 4467 0 0 /isthmian-league/25 4 19795 0 1 /news/browntargetskentleaguereturn-exclusive 2 6916 0 0 /news/iamverydisappointedaboutthewayramsgatehaveactedovermydismissalsaysjustinluchford 4 27450 0 0 /news/theclubisreallypleasedthatsammotthasgotanenglandccall-upsayswellingbossjamieday 2 8846 0 0 /news/weneedtostartscoringgoalssaystrott-exclusiveinterview 1 4767 0 0 /news/colemandelightedwithhismovetomargate 1 3600 0 0 /news/551bc5e5efe3d 2 9558 0 0 /news/ryman/bromley/20thdec03.html 1 0 0 0 /news/wellhythe101216 6 73598 0 0 /news/folkestoneinvicta6-1badshotlea-stuartkingsfinishingwastopdrawersaysneilcugley 1 20903 1 1 /news/kentfootballstarvictimofseriousknifeattack 6 19628 0 1 /news/itsgreatthatpeoplesexpectationsaresohighsaysfavershamtownbossrayturner 2 7636 0 0 /news/kentleague/tunbridgewells/bearsteadu18120904.html 1 0 0 0 /news/wecantaffordtogoupsayscugley 3 15110 0 0 /news/greenwichborough3-0crowboroughathletic-imhereforthedurationsaysianjenkins 3 27626 0 0 /news/erithbelvedere2-2hythetown 2 18214 1 1 /news/ramsgatevdeal071003.html 2 0 0 0 /news/beckshep050417 4 40140 2 2 /news/fixturecongestionwillreallytestoursquad-daish 2 8456 0 0 /archive-2006-2014/132 3 13904 0 0 /news/itsmyjobtoputthingsrightsayscrayvalleybossstevechapman 4 15634 0 0 /news/wellingunited2-0eastbourneborough-teamsarenotgoingtomakeiteasyforussaysjamieday 1 7322 0 0 /archive-2006-2014/45 4 20402 0 0 /news/crayresvwhitreskicfinal290404.html 2 0 0 0 /news/551bc99c028e4 2 9304 0 0 /news/boroughimprovetheirpublicrelations-exclusive 2 7474 0 0 /news/arlesey201104.html 1 0 0 0 /news/wemustnotletitslipsaytitle-chasingmanagers 1 5446 0 0 /assets/fileman/lang/da.json 1 3288 0 0 /news/coldsnapforcesdoverathletictorethinktravelplanstofleetwood 1 5181 0 0 /news/ryman/bromley/29thsept03.html 1 0 0 0 /news/551bc5e39e5bf 1 6937 0 0 /news/folkestone080616 4 23186 0 0 /news/drmartens/eastern/sittingbourne/barton131104.html 1 0 0 0 /news/doverathletichostaugustcoachingsessions 6 21731 0 0 /news/phoenixsports010920 5 44579 3 3 /news/tonbridgeangelspmoleseyp 1 2612 0 1 /news/results/kentleaguetables6thdec.html 1 0 0 0 /news/imconfidentthativelefttheclubinasafepairofhandssaysterrynaden 3 18394 1 0 /news/yorkcitysignebbsfleettrio 1 3490 0 0 /news/conference/margate/10thjuly03.html 2 0 0 0 /news/weredeterminedtosucceedvowsseager 2 19640 1 1 /national-league/20 2 9999 0 0 /news/551a956bcfd65 3 12636 0 0 /news/folkestoneinvictafc.co.uk. 3 0 0 0 /news/folkestoneinvicta1-0hendonwedroppedbelowourstandardsadmitscugley-exclusiveinterview 2 11292 0 0 /news/theweekahead-1 2 9980 0 0 /news/kentleague/VCD/7thjuly03.html 2 0 0 0 /news/hughespartscompanywithbeckenham 2 7880 1 1 /news/kentrivalsbothconfidentofwinningdog-fight-exclusiveinterviews 2 10550 0 0 /news/itstimetogetourseasonupandrunningsayscrayvalleybosspaulgross 3 12460 0 0 /news/aldershot221005.html 1 0 0 0 /news/suttonathletic0-2corinthian-therearentanynegativesfromtodaysaysmattlonghurst 5 46465 0 0 /news/folkrook250515 3 11367 0 0 /news/fatrophyquarter-finaldrawdaishpreparsfortoughlasteighttripatburtonalbion 2 6476 0 0 /news/workandfamilycommitmentsforcesdealtownchairmantostepdown 5 22294 0 0 /news/hythe270119 3 12468 0 0 /news/kentleague/ramsgate/ramsvsidleyfavase230903.html 1 0 0 0 /news/cheshunt090405.html 2 0 0 0 /archive-2006-2014/283 4 16657 0 0 /news/conference/margate/margatevaldershot120803.html 2 0 0 0 /news/rymanleaguenewsinbriefcomingsandgoings 3 14672 0 0 /news/wellingtown310517 3 13861 0 0 /news/tuckerresignsafter20yearsatconeyhallexclusiveinterview 4 16510 1 0 /news/chatsappointbinksastheirnewskipper 5 15571 0 0 /news/iwillbedisapointedifwerenotplayingsoutherncountieseastfootballnextseasonsaysmacneil 2 10660 0 0 /news/idontknowtoomuchaboutorpingtontobehonestwithyouadmitsbearstedbosstonycornwell 1 4074 0 0 /news/551a9c0f183d2 1 4622 0 0 /news/thekentinvictaleagueisaresoundingsuccesssaysjohnmoules 2 19875 1 0 /news/551bc5e3cd5d7 1 4638 0 0 /news/hessenthalerpensnewdoverdeal 1 3079 0 0 /news/welosttoabetterteamadmitspennock-exclusiveinterview 2 10501 0 0 /news/weneed3gpitchestobeattheweathersaysstrugglingashfordchairman 1 6077 0 0 /news/craychairmanfightstokeephislover 1 4493 0 0 /news/bromvmole230803.html 1 0 0 0 /news/facarlsbergtrophythirdqualifyingroundreviseddraw 1 4500 0 0 /news/soccershortsebbsfleetkeepercalledupforengland 2 16514 0 0 /news/551a925094dcb 6 29083 0 0 /news/seagerpraiseshisplayersversatility 1 3693 0 0 /news/wemustremainfocusedinourpromotionchargesayslovell 1 4010 0 0 /news/sittingbournebossgaryabbottunveilsjoevinessigning 1 4453 0 0 /news/favershamtown3-0hythetown-theboysexecutedthegameplanbrilliantlysaysrayturner 2 20170 0 0 /news/itshouldbeanentertaininggameatholmesdalesayswoodstocksportsassistantchriscooper 3 11012 0 0 /news/bromleyagreeten-yeardealforcrystalpalaceladiessidetoplayathayeslane 3 11042 0 0 /news/tonbridge031117 2 9118 0 0 /news/551a9c0eb3bdb 3 11997 0 0 /news/551a956c2344c 1 3765 0 0 /news/doverathletic5-0chathamtown 1 3965 0 0 /news/weresteppingintotheunknownsaysdartfordcoachjohnmacrae 1 5182 0 0 /news/othernews/allsystemsgo.html 1 0 0 0 /news/cllrkiteweveshownlongtermfaithindartford 4 17768 0 0 /news/ryman/bromley/12thsept03.html 1 0 0 0 /news/wehaveplayerstohandlethepressuresaysburman-exclusive 1 4165 0 0 /news/tonbridgeangels2-1hendon-wereimprovingwitheverygamesayswarrilow 1 6088 0 0 /news/walkersuffersfreakinjurywhilstontrainingcourse 1 3268 0 0 /news/facupspecialwemustembraceourchancetoreachthefirstroundinsistsdolby 1 6726 0 0 /news/fleetsignfuller 4 11713 0 1 /news/551bc5e1b9022 2 9034 0 0 /news/croydon3-2horleytown-ineedfinancialhelpbigtimesayscroydonchairmandicksongill 3 28570 1 1 /news/threepointsoverwhitstablewillkeepusintheplay-offpacksaysgaryabbott 1 4587 0 0 /news/greeniesfridaypreview-weekendoftrophyandvasefootball 1 5010 0 0 /news/folkestoneinvicta2-4ashfordtownaet 3 14741 0 1 /news/kentskelliedisciplineappointedasnextsecretaryoftheisthmianleague 1 3849 0 0 /news/12thdec04.html 1 0 0 0 /news/bromley211119 4 18324 0 0 /news/whitstable210804A.html 2 0 0 0 /news/fiskleaveshythetownaresevenyearsservice 1 3980 0 0 /news/weredroppinglikefliesadmitsdolby-exclusive 1 3982 0 0 /assets/select2/src/scss/core.scss 1 579 0 0 /news/walkerremainspatientwithstrikersearch 6 24561 0 0 /news/tunbridgewells2-0shildon-wevegotnothingtocelebratesaystunbridgewellsbossmartinlarkin 3 26891 0 0 /news/ebbsfleet180520 2 7386 0 0 /news/paulmccarthy200217 3 12981 0 0 /news/tunbridgewells030120 2 8026 0 0 /news/bromley260418 3 14376 0 0 /assets/fileman/lang/hu.json 1 3374 0 0 /news/doverathletic011220 3 9289 0 0 /news/551bc99bb0b56 2 11516 0 0 /news/fisherfanianmurphyraisesnearly300followinggroundhoparoundlondon 3 12322 0 0 /news/theboysneedtobeplayingattheirbesttogetaresultagainstbristolroverssaysjamieday 4 14070 0 0 /news/tunbridgewellsstrivingtowardsconferencesouthfootball-exclusiveinterviews 1 7070 0 0 /news/551a9c0e57486 1 4880 0 0 /news/thamesmead080616 3 14058 0 0 /news/551a9797edf0d 4 15666 0 0 /news/551bc99da4fb7 1 5826 0 0 /news/severithbel260815 4 35058 0 0 /news/551a9c92a6e44 1 3802 0 0 /news/angelsvisittoswanshangsinthebalance 1 3632 0 0 /assets/uploads/events/ 4 1270 0 0 /news/march2010results 3 18816 0 0 /news/hollands140219 4 17729 0 0 /news/erith150105.html 1 0 0 0 /news/551a956bf199b 3 11604 0 0 /southern-counties-east-football-league/3 6 45889 2 1 /news/kentleague/erithtown/14thfeb04.html 1 0 0 0 /news/margateunveilsigningofmidfielderlukeianson 4 14692 0 0 /news/weveprovedwerenotabadfootballingsidesaysobrien 2 8574 0 0 /news/551a99e465960 1 3622 0 0 /news/erithtownbosssteveoboyleswoopsforexperiencedcampaignerlewwatts 3 12698 1 0 /news/beckenham101117 1 3535 0 0 /news/551bc5dca4cb1 2 10058 0 0 /news/551bc99a69617 3 12046 0 0 /news/whitstabletown0-3chipstead-peoplehavegottohavefireintheirbellies-lane 1 5706 0 0 /news/soccershorts150820 3 20090 0 0 /news/hessenthalercanstayhereforlifesaysjubiliantdoverchairman 1 5322 0 0 /news/551bc5e333849 3 11480 0 0 /news/kentleague/ramsgate/23rdoct03.html 1 0 0 0 /news/sevenlong211017 1 10324 0 0 /news/croydon071020 3 9947 0 0 /news/fisher3-3glebe-wehaveprogressedfromlastseasonsaysglebebossrockymcmillan 4 44815 1 1 /news/wewanttogoasfaraswecaninthefacupsaysdartsbosstonyburman 1 3852 0 0 /news/folkestoneinvictaunveilnewdirectors 1 5213 0 0 /news/hythetown2-1doverathletic-fiskshockedashissideproducegiant-killing 7 63339 5 5 /news/thiswholetransferwindowscenarioiskillingclubsatourlevelbemoansfleetboss 2 7765 0 0 /news/wellingDay241116 3 13467 0 0 /assets/smartmenus/demo/keyboard-navigation.html 1 3100 0 0 /news/craywanderers0-3crystalpalace-itsgreattoseetheirnextgenerationsaysjoefrancis 4 33144 0 0 /news/ebbsfleet250618 3 12093 0 0 /news/kingstoniansignsouthafricanpotterillfrombromley 3 9353 0 0 /news/551a96db53002 4 16593 0 0 /news/hernebay2-0collierswoodunited-idontfearournextvaseopponentssaysconfidenthalsey 1 7567 0 0 /news/fixtureswc13thmarch2006 3 10099 0 0 /news/thamesmead260405.html 1 0 0 0 /news/551a9677d3432 1 3515 0 0 /news/favasefinalpreview190518 4 22309 0 0 /news/beck030915 4 14093 0 0 /news/dartford1-4chelmsfordcity-hollowaysavewasthebestiveseen-burman 2 14364 0 0 /news/footballstarsturnoutinforceforsewell 1 4098 0 0 /news/folkestonechairmanslamssaundersexit 1 5026 0 0 /news/maidstone271205.html 1 0 0 0 /news/551a99e4610a7 3 12201 0 0 /news/551a97b0ddf6f 3 13248 0 0 /news/551a9718bfd4d 4 13714 1 0 /news/othernews/gotravelkentleaguetables270304.html 1 0 0 0 /news/play-offheroescugleytookthepressureawayfromussaysjackson 2 13529 0 0 /news/crayholm030918 4 35766 0 0 /news/beckenham170920 4 16446 0 0 /news/551bc5dce6a65 1 3331 0 0 /news/lackofmoneyisholdingseagerbackintransfermarket-exclusive 1 4219 0 0 /news/canterburynewstadium030219 4 15242 0 0 /news/dicksonsnappedupbydulwich 3 8836 0 0 /news/waltoncasuals2-1chathamtown-wehavetostartbeleivinginourselves-obrien 1 6387 0 0 /news/jenkinssetforsquadshowdowntalks 1 5139 0 1 /news/lordswood060418 2 6775 0 0 /news/551a9678ddf13 1 4024 0 0 /news/551a99e3b784f 3 17739 0 0 /news/conference/margate/12thjuly04.html 1 0 0 0 /news/sladevlord170104.html 2 0 0 0 /news/kentleague/sladegreen/sladevdeal270903.html 1 0 0 0 /news/hernebay100915 4 14968 0 0 /news/551a9250a2c19 2 7880 0 0 /news/wereplayingforpridenowadmitsward 2 7019 1 0 /news/lovellwantstrophytiessettledontheday-exclusiveinterview 2 7842 0 0 /news/punjab030120 2 7702 0 0 /news/thisisaclubontheupsaysfavershamtownbossrayturner 6 23132 0 0 /news/551a9c93339b8 2 11888 0 0 /news/playersdontplayformeformoneyinsistsobrien 2 10419 0 0 /news/croydon270519 3 9825 0 0 /news/mcmahontellswantawaystrikeryouveletmedown 5 16024 0 0 /news/metpolice230805.html 2 0 1 0 /news/thanksforthememorieschris 1 3522 1 0 /news/tonbridgeangels4-1whitstabletown-thereslightattheendofthetunnelsaysmunday 1 7762 0 0 /news/carshalton160804.html 2 0 0 0 /news/beckenham270217 2 17628 1 1 /news/sheppey080416 3 12165 0 0 /news/dover280517 2 7353 0 0 /news/551a9c9238758 6 65507 2 2 /news/ramsgate020915 4 13773 0 0 /news/fatrophyspecialabbottenjoyssittingbournesawaytrips 1 4061 0 0 /news/551a97b0ac9f9 1 5508 0 0 /news/drmartens/eastern/folkestone/maidstone030804.html 1 0 0 0 /news/551a931e22359 1 3127 0 0 /news/551bc5e7d9095 1 3153 0 0 /news/beforechristmaswewerebeatingthesidesaroundthetopsaysmeadbosskeithmcmahon 1 4217 0 0 /news/canterbury021015 4 14400 0 0 /news/ashford141216 3 12028 0 0 /southern-counties-east-football-league/43 2 9385 0 0 /news/parnhampromotedtonumbertwo 1 2964 0 0 /news/551a979aadc7c 1 4875 0 0 /news/grimsbytown3-0dartford-wevegotamountaintoclimbadmitstonyburman 3 25607 0 0 /news/soccershorts230515 4 27226 0 0 /news/itsgettingdarkatramsgate-exclusive 2 8739 0 0 /news/hernebaylosepointsafterfloodlighttrophywin 2 6164 0 0 /news/fiskexpectsanothertoughbattleagainstvickers 2 7907 0 0 /news/sportkent220819 5 54407 0 0 /news/imquietlyconfidentthateverythingwillturnoutallrightsayswellingunitedowner 1 4030 0 0 /news/pixielottcry290316 4 21994 0 0 /news/wewanttotakeourkentseniorcuptriptofolkestoneseriouslysaysdartsbosstonyburman 1 4085 0 0 /news/craywandsFlamingoPark140318 1 3969 0 0 /news/resultsnovember2011 1 8174 0 0 /news/thamesmeadtown2-0redhill-thepressurewasonustowinsayskeithmcmahon 5 52192 0 0 /news/551a967845624 1 5337 0 0 /southern-counties-east-football-league/11 10 65426 1 1 /news/maidstoneunited1-2afcwimbledon-improudofteambutourredcardcostusadmitswalker 2 14623 0 0 /news/whitstable150619 5 20621 0 0 /news/551a9b4831f95 4 12594 0 0 /news/becksev091116 2 19098 0 0 /news/551a979935d41 2 13034 0 0 /national-league/12 2 9586 0 0 /news/dulwich070916 2 8167 0 0 /news/beckenham100818 2 7266 0 0 /news/damianscannel011017 2 7602 0 0 /news/rochester161017 2 7036 0 0 /news/baldacchinoreturnstoerithbelvedere-exclusive 1 3859 0 0 /news/thanksforyoursupport 2 7596 0 0 /news/crayhast111118 4 36159 0 0 /news/folkestone100517 2 6465 0 0 /news/iwanttheclubtogrowandprogresseveryyearsaystonbridgeangelsbosstommywarrilow 2 9368 0 0 /news/gurunanakunveildennishughesastheirnewboss 2 6859 0 0 /news/wemustimproveourhomeformsaysmartin 1 3461 0 0 /news/farnieitstimetobond-exclusiveinterview 5 19298 0 0 /news/borehamwoodvisitprincesparkinwestviewcupclash 3 9374 0 0 /news/idehill210820 2 6438 0 0 /news/craythames290915 4 40350 0 0 /news/bromley2hamptonrichmondborough0 4 16594 0 0 /news/londonwomen0gravesendnorthfleetladies0 4 15506 0 0 /news/folkestone300705.html 1 0 0 0 /news/myfirststintofmanagementhasleftasourtasteinthemouthsayssimonpettit 6 29610 0 0 /news/wellingunited150619 3 11760 0 0 /news/551a931eb4d02 2 8803 0 0 /news/551a96dc35eaa 4 23274 0 0 /news/kentleague/lordswood/eastbournevlordsfac230803.html 1 0 0 0 /news/fisherbossgarylisneypullsoffdanyoungtransfercoup 2 7112 1 0 /news/folkestone120617 2 6414 0 0 /news/iwanttoachivebigthingsatmaidstoneunitedsaysgoalkeeperleeworgan 3 11501 0 0 /news/dulwhamp210717 1 8138 0 0 /news/bexken130517 3 9106 0 0 /news/letsmakeanameforourselvesonthedaysaysfolkestoneinvictabossneilcugley 2 8741 0 1 /news/551a97b0ba987 1 3081 0 0 /news/bearshythe090716 3 28557 0 0 /news/hastvfolk151103.html 2 0 0 0 /news/ifwegetsloppyhitchinwillpunishuswarnstonbridgeangelsbosstommywarrilow 2 10876 0 0 /news/dartford0-1gillingham-itsadreamtobeaconferencemanagersaysdartfordstonyburman 1 7537 0 0 /news/romford121119 4 16588 1 0 /news/551a9718cf6c2 2 6794 0 0 /news/ryman/bromley/chessington240704.html 1 0 0 0 /news/commentistodaythedaythatfootballreallydoescomehome 1 4980 0 0 /news/itwillbethebiggestnightforabouttenyearssaysfisherbossbillywalton 2 10845 0 0 /news/maybewellhaveourdaymaybeourdayisthisyearbutletsgetpastsuttonfirst-neilsmith 1 4960 0 0 /news/551a95b40d36d 4 21086 0 0 /news/tonbridgeangels2-2ramsgate-thisisourturningpointsayslast-gaspherodavis 2 12054 0 0 /news/phoenix071018 3 14415 0 0 /news/fivemorevictorieswillkeepusinthedivisionsayssittingbournejoint-bossmattwyatt 2 10537 0 0 /news/canterbury230715 4 17998 0 0 /news/otford080616 2 7998 0 0 /news/battleofthanettrottstillinshock-wardwantslocalbraggingrights-exclusiveinterviews 5 31165 0 0 /news/kentleague/ramsgate/17thdec03.html 1 0 0 0 /news/551bc5deba18d 1 4161 0 0 /news/ithinkourluckwillrunoutatsomestagewarnscugley 1 4312 0 0 /news/551a956cf0ddb 1 5527 0 0 /news/kentcounty/21stsept03.html 1 0 0 0 /news/551bc5e76b6a8 1 4241 0 0 /news/macclesfield190819 3 11801 1 0 /news/erithtown060905.html 1 0 0 0 /news/glebe170320 3 23096 0 0 /news/551bc99db2d79 1 5659 0 0 /news/backingtheboystofavaseglory 2 5970 0 0 /news/bengal130805.html 1 0 0 0 /news/NationalLeague311220 2 7946 0 0 /news/drmartens/premier/dover/2ndaug04.html 1 0 0 0 /news/hollandsblairfaceobstaclestogetstarmeadowuptoscratchtohostkentleaguefootball 1 5303 0 0 /news/wejustwanttokeepourwinningrungoingsaysalexobrien 1 5853 0 0 /news/chathamtownunveilobrienastheirnewboss 2 6815 0 0 /news/dealtown270519 3 13590 0 0 /news/crayvalley291018 4 16962 0 0 /news/551bc5e54d506 2 12216 0 0 /news/folkvfishlgecup111103.html 2 0 0 0 /news/drmartens/eastern/tonbridge/13thaug04.html 1 0 0 0 /news/iwantaherotogetusoverthelinesaysthamesmeadtownbosskeithmcmahon 3 17856 0 0 /news/lingfieldmoveisrightformesaysbeckingham 1 4651 0 0 /news/tonbridgeangels1-1weston-super-mare-youslipandyougetpunishedsaystommywarrilow 2 17828 0 0 /news/mymainaimistohelpmeridianbecomeabetterclubfromtoptobottomsaysliamkelly 4 17822 0 0 /news/hythetown220218 2 8058 0 0 /news/aveley230405.html 1 0 0 0 /news/tunwells300615 11 90007 5 3 /news/wellingunited4-2eastleigh-leeclarkeisafantasticassetsayswingsbossjamieday 1 7362 1 1 /news/maidstone050320 2 9022 0 0 /news/margate260519 4 14809 0 0 /news/iwantdistancebetweenusandthestonessaysjenkins 2 7922 0 0 /news/iveseenenoughthatwecanworkonsayspositivedartfordbosstonyburman 1 4519 0 0 /news/tonbridgeangels240620 3 9585 1 1 /news/canterburycityunveilmajorsponsorshipdeal 1 4046 0 0 /news/overlandgetsthenod-exclusiveinterview 5 23778 0 0 /news/thamesmeadtown0-0heybridgeswifts-thistiecouldevengothedistancewarnskeithmcmahon 2 13592 1 0 /archive-2006-2014/69 2 9972 0 0 /news/551bc99a5a056 3 12898 0 0 /news/deepdowniknowweshouldhavegottowembleyadmitstitlewinninghernebaybosssimonhalsey 1 6519 0 0 /index/Mobile/kline_week 1 4630 0 0 /news/thekentleaguetitleisupforgrabsadmitsmcmahon-exclusive 2 9850 1 0 /news/chathambossbinkshopesforbetterluck 1 4026 0 0 /news/551bc99da9ac9 1 5908 0 0 /news/ryman/bromley/13thoct04.html 1 0 0 0 /news/bromley051218 4 14653 0 0 /kent-county-league/10 5 35449 1 1 /news/maidstoneunitedshouldbeaconferencesouthclubsaystwo-goalheroroyston-exclusiveinterview 1 4307 0 0 /news/sporstan090320 3 31730 0 0 /news/derespreview130705.html 2 0 0 0 /news/ithinktheresafewtwistsandturnstogointhekentinvictatitleracesaysscottsaunders 1 4191 0 0 /news/551a967789393 1 4073 0 0 /news/tonbridgeangels2-1hayesyeadingunited-welefteveryoneontheedgeoftheirseats-warrilow 7 98244 0 2 /news/551bc5dd5a682 3 12911 0 0 /news/halifax080305.html 3 0 0 0 /news/canterbury311218 4 14797 0 0 /news/vcdhyt260119 4 49400 0 0 /archive-2006-2014/194 3 13010 1 0 /news/sceflstatement310720 3 11478 0 0 /news/beckenham030119 5 23247 0 0 /news/stevenscontrolexpectedtobefinalisedinsix-weeks 2 6337 0 0 /news/wemustallpitchintobeatdulwichinsistsmiles-exclusiveinterview 2 7240 0 0 /news/551bc5dc8a64d 2 9704 0 0 /news/551bc5de78c29 3 13199 0 0 /news/dovergrantwalkersickleave 1 3690 0 0 /news/thurrock0-2doverathletic-hessenthalertargetsgillspair 2 12296 0 0 /news/551a979a0c59f 2 9966 0 0 /news/craywanderers0-0hendon-wevegottogetbettersayscraywanderersbossianjenkins 1 6826 0 0 /news/deresfansset-upkentleaguepredictionleague 1 3201 0 0 /news/dartford230819 3 11939 0 1 /news/letshopewecangotowellingandcauseamassiveupsetsaysthamesmeadtownbosskeithmcmahon 1 5021 0 0 /news/bromley1-3wellingunited-wingswinderbywithsecondhalfcomeback 2 10268 0 0 /news/weshouldvegotsomethingoutofthegameadmitslovell 1 4484 0 0 /news/wehaveputtogetherastrongandattractivesuperleaguebidsaysgillschairmanmartinandrews 2 7578 0 0 /news/ebelyaxl180115 3 29069 0 0 /archive-2006-2014/106 1 5043 0 0 /assets/select2/tests/options/data.html 1 239 0 0 /news/soccershorts230619 4 17981 0 0 /news/sittingbourne270118 1 4130 0 0 /news/ivegotmoreoptionstoplaywithsayswarrilow 1 4689 0 0 /news/seagersunbeatensidefacesterntest-exclusiveinterview 2 8535 0 0 /news/hendon121004.html 2 0 0 0 /news/551a9250cb340 2 7050 0 1 /news/hythetownfc.co.uk 1 0 0 0 /news/hernebay240818 3 12573 0 0 /news/551a925104700 2 9513 0 0 /news/rickybennettcharity300317 3 10253 0 0 /news/glebbrom190717 2 20882 0 0 /news/wearefarfromthefinishedarticlesaysramsgatebosstimdixon 1 3509 0 0 /news/tonbridgeangels4-0hendon-wemuststayintheplay-offspotssayswarrilow 1 6765 0 0 /news/lewes250321 14 61791 5 7 /news/551a95b386dcc 4 16722 0 0 /news/hopefullywecangetsomedecentresultsagainstourpromotionrivalssayswingsbossjamieday 1 4724 0 0 /news/isthmianleague030920 2 6946 0 0 /news/chatham260220 2 9736 0 0 /news/wellingtown090717 2 8002 0 0 /archive-2006-2014/259 6 25922 0 0 /news/kfuelt180916 3 36051 0 0 /news/kentleaguechallengeshielddockersfacefighttolandwood 1 5333 1 0 /news/readingreplay310804.html 2 0 0 0 /news/soccershortsinjurypronegoalkeepermittenhasplayedhislastgameforfolkestonesayscugley 2 19398 0 0 /news/551bc99b4b44c 2 9272 0 0 /news/croyholl020316 4 11653 0 0 /news/21stjuly04.html 1 0 0 0 /news/551a979adf25f 1 5403 0 0 /assets/fileman/php/download.php 1 45 0 0 /news/thestonesarecominghomewevewaited23yearsforthissaysbillwilliams 1 10636 0 0 /news/playersdontsignatthistimeoftheyearsayswalker 6 22074 0 0 /thamesmead-2003-2006 13 39327 0 1 /news/leweseve111219 3 26696 0 0 /news/551a96db8328c 1 7156 0 0 /news/craywanderers1-0southpark-last-gasplaurenthamicideliverssouthparkaknockoutpunch 2 70286 1 2 /news/ebbsfleetunited1-3maidstoneunited-itsthebeginningofanimportantweekforus-hume 1 5072 0 0 /news/ramsgatewelcomemoroccansrepresentativeside-exclusiveinterview 1 4555 0 0 /news/551a9250d01bf 5 23157 0 0 /news/marktompkinstakesupgeneralmanagerroleaterithtown 4 15701 0 0 /news/dockersbossoboylebringsincable 1 4026 0 0 /news/erithbel020317 1 3571 0 0 /news/favershamtown2-1maidstoneunited-wewerentattheracesadmitsjaysaunders 1 5884 0 0 /news/551bc5e4edb02 1 3309 0 0 /news/graveshake180515 3 11275 0 0 /news/thedreamstartshere 5 16048 0 0 /news/chathamtown0-1ashfordtown-sodjeimpressesbutlackoffirepowerconcernsmiles 2 12994 0 0 /news/phoenix290915 4 15842 0 0 /news/551bc5da62f1b 3 22096 0 0 /news/bridholm050915 4 43058 0 0 /news/551bc99d9f4ef 1 5849 0 0 /news/etownphoe210115 2 21646 0 0 /folkestone-2003-2006 12 36601 0 1 /news/welling050805.html 1 0 0 0 /archive-2006-2014/56 2 9984 0 0 /news/weknowitsaworkinprogresssayshythetownassistantdarrenbeale 4 18274 0 0 /news/erith210804.html 1 0 0 0 /news/foleyunveiledaschathamtownsnewboss 1 3844 0 0 /news/alexobrienrelishingkingstoniantest 1 4043 0 0 /news/consdeal080220 7 76687 0 1 /news/551bc99b96cbd 1 4290 0 0 /news/tonbridgeangels1-1eastbourneborough-themostimportantthingwastostayup-tommywarrilow 3 27011 0 0 /news/soccershortsextrawalkerreturnstomaidstoneunited 1 6839 0 0 /news/551bc99cf2670 1 6008 0 0 /news/welling190216 3 11937 0 0 /news/ryman/bromley/bansvbrom170104.html 1 0 0 0 /news/crowmaid200717 1 3402 0 0 /news/bromley23122018 6 21632 1 0 /news/551bc5e4b696b 1 3440 0 0 /news/weattempttobouncebackatthefirstattemptsaysthamesmeadtownbosskeithmcmahon 4 13750 0 0 /news/soccershorts 4 76175 2 2 /news/mcmahonwantsadreamstarttoseason 1 4268 0 0 /news/drmartens/eastern/sittingbourne/sittvking240104.html 1 0 0 0 /news/halsteadutd.co.uk 2 0 0 0 /news/kentleague/tunbridgewells/tunvslade130903.html 1 0 0 0 /news/dartford0-3afchornchurch-welostwithdignitysaysproudburman 2 12156 0 0 /news/invictaleague260216 5 29645 2 2 /news/wereincontrolofourowndestinysaysplay-offchasingwarrilow-exclusive 2 11221 0 0 /news/margate040117 4 15234 0 0 /news/551bc5dac1c6b 2 9870 0 0 /news/maidstoneunited2-1tonbridgeangels 1 6448 0 1 /news/551a9c9214377 1 5199 0 0 /news/resultssept2015 4 44777 1 0 /news/551bc5e8e80cd 3 15562 0 0 /news/holmesdale290718 3 11100 0 0 /news/551a97189eb81 4 17998 0 0 /assets/select2/tests/dropdown/ 5 1946 0 0 /news/551a967882130 4 37350 0 1 /assets/fileman/php/renamefile.php 1 45 0 0 /news/werekeepingtheleagueinformedaboutthestandsituationsaysneilcugley 1 3693 0 0 /news/erithtudor060617 2 6776 0 0 /news/wewillsoonclimbuptheleagueifwetakeourchancessaysrusthallbosspaulmcdonagh 3 10867 0 0 /news/wellingdover010115 4 16009 0 0 /kent-invicta-league/20 2 9917 0 0 /news/dartford1-0ebbsfleetunited-dartfordcandowellinthiscompetitionsayscoachjasonlong 2 19194 0 0 /news/withsomeyoungplayersitlookstobeabrightfuturefortheclubsaysstevemckimm 2 7330 0 0 /news/cugleyholdscrisismeetingtoimproveinvictasfortunes 1 5178 0 0 /news/wehavetowinourbattlestobeatnewcastlebenfieldsayshernebaybosssimonhalsey 1 5235 0 0 /news/Grayspreview180705.html 1 0 0 0 /news/thamesmeadtown2-1whitstabletown-ryanbriggscanonlygetbettersaysmcmahon 2 15442 0 0 /news/wellinglaunchinitiativetoraisemoneyfornewfloodlights 2 7332 0 0 /news/wecanbearoundthetopcometheendoftheseasonsaysmaidstoneunitedcoachjackparkinson 2 9862 0 0 /news/551a95b417e19 4 18954 0 0 /news/551bc5e690c9d 3 13082 0 0 /news/pitchero.com/clubs/favershamtownfc 1 0 0 0 /news/othernews/youthleaguetables.html 1 0 0 0 /news/wingmarg140120 3 8972 0 0 /news/551a97b17f01b 1 4813 0 0 /news/princesparkhasliveduptoourexpectations-exclusive 1 4667 0 0 /news/thebigproblemwevegotiswehaventscoredenoughgoalssaysmargatebosssimonosborn 5 20932 0 0 /news/KSTFinalPreview160404.html 1 0 0 0 /news/doverathletic270820 3 9303 0 0 /news/soccershortsmoreclubswillsufferfinanciallywarnsjenner 1 10897 0 0 /news/royalistsareabananaskinwarnsbromleybosswakeling 1 3655 0 0 /news/nationalleague260321 1 4029 0 0 /news/betternewsforhamshare 1 3170 0 1 /news/sofaritsbeenagoodstarttotheseasonsayshernebaybosssamdenly 3 11336 0 0 /news/managershavetheireyesonthebigprize-exclusiveinterviews 1 7909 0 0 /news/tonbridgeangels0-2doverathletic-wewanttodoaswellaswecansaysdoverbosschriskinnear 4 35113 0 0 /news/551bc99b1f3b2 2 10540 0 0 /news/tonbridge050317 1 4324 0 0 /news/bromley2billericaytown2 3 12329 0 0 /news/crayval011216 2 7195 0 0 /news/551a956bc93f8 2 8540 0 0 /news/kentfabeginsearchforanewcharitypartner 4 18626 0 0 /news/ifeelitsveryimportanttogainmomentumgoingintocupfinalsayslyddtownbossdavesmith 3 9968 0 0 /news/werehappywithourseasonsofarsayshollandsblairbosspaulpiggott 1 3900 0 0 /news/chathamtown300919 4 13144 0 0 /news/dartfordwerejusttoogoodforusadmitsseager 1 3417 0 0 /erith-belvedere-2003-2006/3 4 11871 0 0 /news/bravewalkertargetsdaggersvisitforhisreturn 1 3695 0 0 /news/ivehadenoughofgamesbeingcalledoffsaystonbridgeangelsbosstommywarrilow 2 13302 0 0 /news/delightedmcmahonunveilsnorthwoodsigning 1 3192 0 0 /news/wardcallsforcharachterduringramsgatesbadpatch 2 10472 0 0 /news/meridian300819 3 12155 1 0 /news/soccershortsfanstocontributetowardsfolkestoneinvictasmonthlycva 1 8373 0 0 /news/wehavetomakesureoutgoodfootballtranslatesintopointssayssevenoakstownbosslevett 1 3994 1 0 /news/lordswood130615 4 14697 0 0 /news/deresforcedtoswitchmidweekmatch 2 5584 0 0 /assets/select2/src/js/banner.amd.json 1 101 0 0 /news/ontheairwaysangrywingsbossfordmakeshispoint 1 7719 0 0 /news/beckenhamtown1-4sevenoakstown-friendsaveshisheroicsforcomeback-exclusiveinterviews 1 6092 0 0 /news/drmartens/eastern/ashford/9thnov03.html 1 0 0 0 /news/chatham300804.html 1 0 0 0 /news/gillinghamtostagekentseniorcupfinaltomark125thanniversary 5 20630 0 0 /news/wefaceatallordertoreachtheplay-offsadmitsford 2 8694 0 1 /news/sittingbourne080920 2 7598 0 0 /news/jonathanstone260220 3 11155 1 0 /news/wewillcontinuetocampaignfor3gtobeallowedhigherupthepyramidsaysstonesco-owner 1 7361 0 0 /news/erithtownbosstonyrussellbeginstorebuildhiscoachingstaff 1 4622 0 0 /news/551bc5dc4e163 2 10866 0 0 /news/erithbelvederebeginsearchfornewsecretary 1 3663 0 0 /news/margatemissoutonprolificstrikertuohy 1 3513 0 0 /news/kentleague/thamesmead/4thoct04.html 1 0 0 0 /news/seagerpraisesmarathonmanparker 1 3984 0 0 /news/whitstabletown4-1wembley-lambwevegottobuildonthefoundationslaidbyseagerhalsey 1 5796 0 0 /news/24thjuly04.html 2 0 0 0 /news/footballworldsupportsewell 2 6500 0 1 /news/551a96db726b6 4 15749 0 0 /news/phoenix080116 3 10095 0 0 /news/chathamtown2sittingbourne3 1 4734 1 0 /news/maidstoneunited1-0sittingbourne-whenthelightswentoutithoughtherewegoagain-saunders 2 11123 0 0 /news/parkwood060519 2 8698 0 0 /news/charltonathletic040121 4 14020 0 0 /news/gettingjaymayatthislatestageoftheseasonisamassivebonussayswarrilow 2 9315 0 0 /news/dovercalltheshotswewontselladambirchallinsistsdoverchairman 1 3762 0 0 /news/27thsept04.html 2 0 0 0 /news/maidstoneunited1-3kingstonian-imnotgoingtocrucifyturnersayshume 1 6704 0 0 /news/551bc5db1a1d8 5 61923 3 2 /news/drmartens/eastern/erith&belvedere/29thnov03.html 1 0 0 0 /news/woundedanimalsfightbackwarnsseager 1 5799 0 0 /news/earlystartforkentishclash 1 3344 0 0 /isthmian-league/14 4 19874 0 0 /news/wellsmeettodiscussfutureplans 4 13474 0 0 /news/weresearchingfortherightmanforthejobsaysfisherboard 1 3649 1 0 /news/bromley131017 1 4728 0 0 /news/crowboroughathletic2-3sittingbourne-miltonquitstofindregularfootball 2 8692 0 0 /news/theseasonsaimisonlyhalfdonesayslyddtowncoachliamsmith 2 7176 0 0 /kent-county-league/13 5 31745 1 1 /news/551a9798573c6 4 15650 1 0 /assets/fileman/php/copyfile.php 1 45 0 0 /news/551a956b7783e 3 17229 0 0 /news/551a97b0d432c 3 14076 0 0 /news/billericaytown2folkestoneinvicta0 4 18858 2 0 /news/itsabouttimethatwegotintothefacupsecondroundsaysdartfordbosstonyburman 4 18086 0 0 /news/everyonenowattheclubareallpullingintherightdirectionsayschipsteadbossleeroots 2 9340 0 0 /news/kentleague/sladegreen/15thsept03.html 1 0 0 0 /news/ourpoorrunwillendinsistsburman 1 3771 0 0 /news/trialistssayaurevoirtoinvicta 5 26458 0 0 /news/sevenoaks050517 1 4440 0 0 /news/margateissuerallyingcrytostayawayfans 1 3371 0 0 /news/carlrichardssonplaysforbromleyssecondstring 4 11697 0 0 /news/551bc5df5f9fe 1 4321 0 0 /news/tompkinswantsachancetomanageatahigherlevel-exclusive 2 8302 0 0 /news/greeseve190315 2 21656 0 0 /news/casuals140904.html 1 0 0 0 /news/iwanttowintheleaguesaysobrien 1 4666 0 0 /news/551bc5e30b732 2 14248 0 0 /news/drmartens/premier/dover/3rdjuly03.html 2 0 0 0 /news/othernews/padwood29thjune03.html 2 0 0 0 /news/551a99e494f66 3 11664 0 0 /news/551bc99be0cbb 2 9256 0 0 /news/wellingunited201120 6 20900 0 0 /news/vcdathleticsettoappealafterrymanleaguerelegation 2 8906 0 0 /news/551a9718b0f22 4 16202 0 0 /news/facarlsbergtrophyfirstrounddraw 3 8634 0 0 /assets/select2/composer.json 1 470 0 0 /news/soccershortsformerebbsfleetchairmanmoulesappointedvice-chairmanofkentcountyleague 2 13861 1 0 /news/lyddtown310818 3 11592 0 0 /news/iwantpeopletothinkaboutwhatwedoallthetimesayssevenoakstownbosssimonjones 1 4535 0 0 /assets/fileman/conf.json 1 1512 0 0 /news/ramshan190817 8 198555 5 6 /news/551a979830791 4 17553 0 0 /news/avevcd310317 3 29067 2 2 /news/thamesmead300805.html 2 0 0 0 /news/facarlsbergtrophythirdqualifyingrounddraw 1 2977 0 0 /news/nortonsportswelcomedintokentleague 1 3193 0 0 /news/craywanderersp-pleatherhead 1 2859 0 0 /news/folkestoneinvicta2-0corinthian-casuals-awinningfarewellfromdepartingstarnames 2 9876 0 0 /news/charalambousreturnstomargate 4 30936 1 2 /news/551a9798337fe 1 5151 0 0 /news/december2009fixtures1-12december2009 1 4766 0 0 /news/sheppey210417 2 7394 0 0 /news/invictaextendhighly-ratedkeepersstay 1 3077 0 0 /news/ithinkwecouldhavedoneabitbetteradmitsbeckenhamtownbossjasonhuntley 1 3873 0 0 /news/creditcrunchsupportthecluborrisklosingacoupleofplayerswarnscraychairman 2 8202 0 0 /news/551a931e0e599 2 9830 0 0 /news/ourleaguepositiondoesntmakegoodreadingadmitsramsbossjimward 3 41827 1 0 /news/551bc99e61a50 1 4692 0 0 /news/dartford1-1harlowtown-maysreturnisabigbonusforussaysburman 2 9895 0 0 /news/drmartens/eastern/dartford/1Jan2004.html 1 0 0 0 /news/fisheraredesperateforfacupprizemoneysaysjoint-managerbillywalton 3 12926 0 1 /news/southallscoachingisafillipforourpromotionbidsaysward-exclusive 2 11054 0 0 /news/ashfvbrom250803.html 1 0 0 0 /news/15thjuly04.html 1 0 0 0 /news/eritmile240917 6 49264 5 5 /news/othernews/coneyhall100804.html 1 0 0 0 /news/weareveryhappytohelpgreenwichboroughsaysdartfordco-chairmanbillarcher 6 19238 0 0 /news/551bc5dd672d3 3 15540 0 0 /news/vitalpointsatstakeforoursouthernleaguetrio-exclusiveinterviews 2 10170 0 0 /news/phoenixsports1-0croydon-hopefullywecanhaveabitofavaserunsayssteveoboyle 3 28001 0 0 /archive-2006-2014/239 3 12542 0 0 /news/abreathofnewlifespreadsacrosshomelands 1 4548 0 0 /news/myplayersthinktheyrebetterthanwhattheyaresometimesfumeswarrilow 1 4638 0 0 /news/bromvbans211003.html 1 0 0 0 /news/sladegreen0-4paghamheaslewooddemandsareactionaftercupshocker-exclusive 3 18787 0 0 /news/conference/gravesend/14thjuly04.html 1 0 0 0 /news/doverathletic0margate0 4 10201 0 0 /news/croydon020818 2 7188 0 0 /news/folkestone180519 4 14726 0 0 /news/ebbsfleetunited1-0burtonalbionaet-longcallstheshotsasfleetmarchclosertowembleyarch 1 6717 0 0 /news/thestandardoffootballinmedwayisgoingupsayshollandsblairbosspaulpiggott 1 4094 0 0 /news/resultsjanuary2019 4 35978 0 0 /news/thamesmeadtown1-3folkestoneinvicta-afewofmyplayershaveletdowntheclubfumesmeadboss 1 8191 0 0 /news/enticingofferstowatchthecomebackkingsofkentfootball 1 5355 0 0 /news/statattackaverageattendancefigures 1 3075 0 0 /news/cordicehasntgivenuphopeonhisnumberonetarget 4 18458 0 0 /news/saturdaysmatchreportsinvictaexpecttolosenormantodartford 3 18500 0 0 /news/sct070518 4 17318 0 1 /news/551a92505d62c 4 14073 0 0 /news/margvnorthwich270903.html 2 0 0 0 /news/severams110918 4 46812 0 0 /news/whitstablebay280617 2 6468 0 0 /news/drmartens/premier/welling/10thoct04.html 1 0 0 0 /news/thebigkickoffdaishcompletesdoublesigningoneveofnewseason 1 3353 0 0 /news/ramsgateplayersinvolvedinaccidenten-routetohastingsgame 2 8178 0 0 /news/cumberbatchhailsexcellentmatatasigning-exclusiveinterview 1 4269 0 0 /news/margate280519 4 13361 0 0 /news/sittverit181103.html 2 0 0 0 /news/kentleague/thamesmead/thamesmead.html 1 0 0 0 /news/harlow220105.html 2 0 0 0 /news/floodlightcollapsecausespostponement 3 8797 0 0 /news/ramsgate2-3tonbridgeangels-angelsflyingatthetopofthetable 5 34656 1 2 /news/letskeepourwinningrungoingsayslovell-exclusive 2 7932 0 0 /news/dorksitt221215 4 50939 0 1 /news/cray050818 3 12579 0 0 /news/fisher081015 4 14242 0 0 /news/conference/margate/margatevexeter160803.html 1 0 0 0 /news/551a96db561a4 1 3727 0 0 /news/idontthinkwecancatchwokingnowadmitswingsbossjamieday 1 3833 0 0 /news/flyingphoenixarerightlybeingtippedasthetitlefavourtiessaysmattlonghurst 3 13862 0 0 /news/TheNationalLeagueStatement021020 2 5958 0 0 /news/folkestoneinvictagetcouncilbacking 2 8769 0 0 /news/croydon0-4hartleywintney-iwillbehappywithmidtablefinishsayscroydonbossdicksongill 1 8122 0 0 /news/favershamtown2-1greenwichborough-wewanttogooutwithabangsaysshearer 2 16598 0 0 /news/kentleague/maidstone/22ndjuly03.html 2 0 0 0 /kent-county-league/ 1 4535 0 0 /news/hythetown2-2hernebay4-5pens-maybeourwake-upcallhascomeattherighttime-porter 2 16700 0 0 /news/larkinhasascoretosettle 1 4112 0 0 /news/ebbsbrom170215 3 28187 0 0 /news/england280916 3 15857 0 0 /news/551bc5deacd3f 1 2979 0 0 /news/lordswood2erithbelvedere2 4 14134 1 0 /news/GWR160805.html 1 0 0 0 /news/billericaytownfc.co.uk. 1 0 0 0 /kent-invicta-league/5 5 39921 1 1 /news/billericaytown1-1tonbridgeangels-warrilowruesleggesthirdredcard 3 16700 1 1 /news/551a96dc0b355 1 3212 0 0 /news/551bc5e637b72 2 9528 0 0 /news/sittmers281017 2 19738 0 0 /news/conference/margate/30aug04.html 1 0 0 0 /news/ramsgate-fc.co.uk 2 0 0 0 /news/soccershorts050816 4 34244 0 0 /news/551bc5e0a5239 1 6966 0 0 /archive-2006-2014/110 3 15215 0 0 /news/wellgotoeastbournewithoureyeswideopensayscorinthianbossmattlonghurst 4 22176 0 0 /news/leaguesurvivalcomesbeforecupglorysaysward 2 8726 0 0 /news/551a9c922dc70 2 10360 0 0 /news/tondov031016 4 43978 0 0 /news/hollands220219 4 15870 0 0 /news/whit250515 3 14421 0 0 /news/drmartens/eastern/sittingbourne/9thsept04A.html 1 0 0 0 /news/expectanttonbridgesettogatecrashstoneshomecomingparty 1 4687 0 0 /news/becklord250217 1 13372 0 0 /news/rymanleagueplay-offheartbreakpromotionisamustnextyearsaysjenkins 1 3871 0 0 /news/551a99e3a0626 3 20163 0 0 /news/heaslewoodwearerealisticwithwhatwecanachieve-exclusiveinterview 4 20720 0 0 /news/exclusivestatementfromclivewalker-andreactionfromashfordtownco-owner 2 10074 0 1 /news/ebbsfleet140820 3 12289 0 0 /news/mysidecanhandlethepressureinsistsdouble-chasingmcmahon-exclusive 2 8804 0 0 /news/othernews/pitches25thjuly03.html 2 0 0 0 /news/551bc5d97869a 3 15788 0 0 /news/littlehamptontown1-0greenwichborough-myplayershavegottolearnquicksaysjohncumberbatch 4 35420 0 0 /news/weneedsolidfoundationssaysconcerneddaish 2 6358 0 0 /news/faversham050717 1 4740 0 0 /news/drmartens/eastern/ashford/27thsept04.html 1 0 0 0 /news/thestandardssetwerenotmaintainedandthatsnotgoodenoughformesaysrayturner 4 21293 0 0 /news/ramsgate310119a 3 12240 0 0 /news/sladevbeck011103.html 2 0 0 0 /archive-2006-2014/93 1 4815 0 0 /archive-2006-2014/224 2 8770 0 0 /news/551a96783e957 1 4600 0 0 /news/missedchancesarecostingusdearlyadmitssittingbournebossjoedowley 1 3782 0 0 /news/hessenthalerplottingacoupleoftrophyupsets-exclusive 2 9220 0 0 /news/otfohals040315 6 84979 2 2 /news/wevegotsomeexcitingtimestocomeatashfordtowninsiststhorogood-exclusiveinterview 2 13975 0 0 /news/551a96dba9847 1 4452 0 0 /news/itsimportanttogetpeoplethroughthegatesaysabbott 1 4006 0 1 /news/ourgirlsdontwanttogivethecupupsayscharltonathleticbossstuartweston 2 7807 0 0 /news/conference/gravesend/7thjuly04.html 1 0 0 0 /news/551bc5e277eef 2 8168 0 0 /news/thamesmead170917 2 9446 0 0 /archive-2006-2014/268 2 8619 1 0 /news/3rdnov04.html 1 0 0 0 /news/551a96782fc3d 3 10722 0 0 /news/conference/margate/carshalton160804.html 1 0 0 0 /news/everyplayerhasbeenexcellentforusthisyearsaysburman 2 8474 0 1 /news/551bc5e0dd569 1 4295 0 0 /news/margate121017 1 4595 0 0 /news/championshipwinningpartyletsendtheseasoninstylesaysburman-exclusive 1 4569 0 0 /news/kentcountyleaguestatement021220 5 30866 1 2 /news/wingsplayer-managerjamiedaytriestolifthistiredtroops 1 4214 1 0 /news/sittingbourne270320 2 7152 0 0 /news/551a95b378a8d 1 3321 0 0 /news/NationalLeagueStatement141220 2 5864 0 0 /news/eastdulw020516 5 56247 1 0 /archive-2006-2014/243 3 12767 0 0 /news/erithtown3-5woodstocksports-icouldnothaveaskedforanymoresaysscottappleton 1 8732 0 0 /news/551bc5e8d1584 3 12290 0 0 /news/18thnov04.html 2 0 1 0 /news/fatrophyspecialwarrilowwantsmoregiantkillingacts 2 10062 0 0 /news/burgesshilltown3-1folkestoneinvicta-thatperformancewasntgoodenoughadmitsneilcugley 4 31660 0 0 /assets/js/ie/ 6 2242 0 0 /tonbridge-2003-2006/ 1 3026 0 0 /news/welling090717 1 4085 0 0 /news/idontwanttoriptheheartoutofglebesaysnewmanagersimoncopley 3 17164 0 0 /news/werelookingtoimproveandtowinthingssaysmargateplayer-assistantjohnkeister 1 4411 0 0 /news/whitewemustaddressourlasttwodisplays 2 8864 0 0 /news/beckenham020815 4 19594 0 0 /news/551a97b0d8190 3 14847 0 0 /news/drmartens/eastern/dartford/20thsept04.html 1 0 0 0 /news/hythetown170919 3 10661 0 0 /news/ebbsfleetunited2-1dartford-imdelightedthatwevecameoutontop-liamdaish 1 6857 0 0 /news/imwellhappytobehonestwithyousayscraywanderersbossianjenkins 1 4312 0 0 /news/soccershorts290519 3 14615 0 0 /news/bromley270519 10 90640 6 5 /news/ihopeimwrongbutthepitcheswilldictategamessaystonbridgeangelsbosstommywarrilow 3 15943 0 0 /news/551a97b292fcb 1 4664 0 0 /news/bertreturnsfromhisverybriefretirement 5 18585 0 0 /assets/fonts/academy/academy_engraved-webfont.woff 1 37484 0 0 /news/apmcon170815 5 25522 1 1 /news/ramscapturelondonerwaugh-exclusiveinterview 1 4804 0 1 /news/551a96dc0ce76 2 8992 0 0 /news/theboysthriveonplayingbiggamesagainsthigheroppositionsayshythetownbossscottporter 3 14534 1 0 /news/ashfordtownappointealhamasyouthteammanager 1 3099 0 0 /news/551a956bebedd 3 16023 0 0 /news/shockoverdeathofyoungangel 1 3722 0 0 /news/lewisham180118 4 16322 0 0 /news/FAStatement011220 1 4716 0 0 /news/kentfallssilentat130pmtopaytributetosyko 1 3952 0 1 /news/551a925087d80 2 6181 0 0 /news/551a925107b43 3 14081 0 0 /news/sheppey180920 4 16233 0 0 /news/chathamtown1-3sittingbourne 1 4842 0 0 /assets/ckeditor/plugins/specialchar/ 5 1835 0 0 /news/551a92504ddfe 2 6642 0 0 /news/craywands190118 1 5516 0 0 /news/thamesmeadtown1-2craywanderers-iwontputastrongsideoutinthisagainsayskeithmcmahon 3 31150 0 0 /deal-2003-2006/2 3 8592 0 0 /news/aclonglebe230915 3 24699 0 0 /news/deressecuretheirparkviewroadfuture 1 4406 0 0 /news/kentishfootballjoinstwitter 3 7700 0 0 /news/551a956cb7fd0 1 4508 0 0 /news/tunbridgewells091118 4 16657 0 0 /news/orpington030317 4 14900 0 0 /news/illcarryondoingthejobvowsunder-pressurebromleybossmarkgoldberg 1 4000 0 0 /news/hythe010117 1 4348 0 0 /news/croydon090218 2 7365 1 0 /news/craywandererstoreachouttosixmilliontelevisionviewersinthefareast 3 11018 0 0 /news/551bc5e859e13 2 7286 0 0 /news/myplayershavemadehistoryforsevenoakstownsaysaproudjones 1 3637 1 0 /news/22ndmay04.html 1 0 0 0 /news/551bc5e423de7 1 4171 0 0 /assets/select2/src/scss/_dropdown.scss 1 1029 0 0 /news/othernews/youthleaguetablesfinal2004.html 1 0 0 0 /news/drmartens/eastern/tonbridge/eastbourne011104.html 1 0 0 0 /news/altrinchamrelegated 1 2955 0 0 /news/551bc99adf9d8 1 4886 0 0 /news/551a99e4f1045 1 5652 0 0 /news/folkestoneinvictamakebigmoneysigningfromashford 1 3447 0 0 /news/performancescanbebetteradmitspennock-exclusiveinterview 4 20960 0 0 /news/551bc5dacb7e3 4 44194 1 0 /news/ashftonb140518 4 48756 0 0 /news/canterbury050715 5 18127 0 1 /news/thefacupfourthqualifyingrounddraw-1 5 16842 0 0 /news/551bc5df4a8b3 1 3896 0 0 /news/championsdoverathleticsheroesgettheirhandsofsilverware 1 3430 0 0 /news/551bc5e2a40d9 3 11230 0 0 /news/thamesmeadtown0-0thurrock4-2pensmyplayershavedonetheclubreallyproudsaysmcmahon 2 18114 0 0 /news/12thfeb05.html 2 0 0 0 /news/wewanttobeatlastyearsrecordsaysfisherbossgarylisney 2 7864 0 0 /news/soccershortsguyeldridgequitssuttonathleticaftersevenyearsincharge 7 134866 2 2 /news/wearedeterminedtobuildforthefuturesaysstonesbossjaysaunders 3 11925 1 2 /news/theendofthelineforrymanleagueservice 1 3312 0 0 /news/thorogoodpromisesashfordtownfansabetterseason-exclusiveinterview 5 27302 1 0 /news/17thoctZ.html 1 0 0 0 /news/kentleague/cray/KSTSF080304.html 1 0 0 0 /news/whitstableattractbiggestcrowdforsevengamesthankstoourcoverage 2 6119 0 1 /news/pottersbar111005.html 2 0 0 0 /news/dolbyforcedtodelveintoreserves-exclusiveinterview 2 8174 0 0 /news/oldbideh120518 6 104818 0 0 /news/imenjoyingmyfootballatfavershamtownsaysstrikeradrianstone 9 102059 8 7 /news/backingthefleettowembleygloryiwontbottleitwhenputonthespotinsistsmoore 2 9424 0 1 /news/idbethefirsttoadmitthatwehaventscoredenoughgoalssaysramsgatebosstimdixon 2 9716 0 0 /news/beckenhamtown1-2erithbelvedere 8 85116 2 3 /news/551a931dc200c 1 3790 0 0 /news/bromvtonb270104.html 1 0 0 0 /news/beckstoostrongforcorinthiansayshuntley 1 3341 0 0 /news/gravesendgoalkeeperselectedforengland 2 6219 0 0 /news/itsimportantwetryandkeepourrungoingsaysfolkestoneinvictabossneilcugley 3 13703 0 0 /news/551a9c0e7c3ba 1 3090 0 0 /news/ambitiousopkmoveintodansonsformerhome 1 3427 0 0 /news/vcdathletic250920 2 7122 0 0 /news/folkestoneinvicta220421 66 262715 3 21 /news/fatrophydrawreactionhumeasksforvocalsupporttochopdownforest 2 12788 0 0 /news/fiskhits-backattompkinslong-balljibes-exclusive 1 3911 0 0 /news/bromvdartfordfac.html 1 0 0 0 /news/551a92507339d 2 7097 0 0 /news/angelsinheavenwemustlivewithinourmeansinconferencesouth-tommywarrilow 1 5368 0 0 /news/boroughenjoyagooddayoutonthecoast-exclusiveinterview 1 4697 0 0 /news/ashbytellshisdefencetoshapeup 1 3193 0 0 /news/551a99e3463f1 1 3913 0 0 /assets/select2/tests/selection/ 5 2460 0 0 /news/iwantthisgroupofplayerstobethebestgroupinourhistory-sayserithtownbosstonyrussell 2 9643 0 0 /news/551bc5dfc08f0 1 4474 0 0 /news/facupdrawkentderbywerenotthereyetsaysobrien 2 11914 0 0 /news/canterbury260419 5 20046 0 0 /news/porterhasgottotakethisopportunitysaysorientbossslade 1 4121 0 0 /news/erithandbelvedere250419 2 7558 0 0 /news/croydon030120 3 11972 0 0 /news/erithandbelvedere290220 5 19475 0 0 /news/tonbridge041217 3 20619 1 1 /news/tonbridge030317 1 3918 0 0 /news/551bc99d8c44b 1 4587 0 0 /news/oconnellreflectsonhistimeinkent 5 36794 0 0 /news/matchreportsinvictaandstonesrelegationconcerns 1 8861 0 0 /news/dartford241116 3 10713 0 0 /news/551a931e310e1 1 3321 0 0 /news/longsignsforfleet-saturdayspre-seasonround-uplastupdated1310 5 28690 0 0 /news/551a9cf573896 2 12162 0 0 /news/551a99e36fd72 3 30472 1 0 /news/myplayersbottleditandletmedownbigtimeragesmcmahon-exclusiveinterview 1 4937 0 0 /news/afccroy290116 5 18471 0 0 /news/551a9799ab276 1 5013 0 0 /news/stonesswoopforkentleaguestardefender-exclusive 1 4103 0 0 /news/k%20sports020819 3 12108 0 0 /news/551a97b103cf5 3 12786 0 0 /news/everygameisimportantnowsaysfolkestoneinvictabossneilcugley 1 4583 0 0 /news/concernsoverplayerssafetyfollowinganthonyhoggshorrorinjury 10 138673 3 9 /news/ashfordunitedf.com 1 0 0 0 /news/afccroydonathletic070918 4 13986 0 0 /news/551a96dc6f521 4 20646 0 0 /news/sheppey030217 1 4035 0 0 /news/newboysgivenchancetoshineagainstaverygoodnon-leagueside 9 88554 3 4 /news/kentleague/deal/Sampson5.html 1 0 0 0 /news/kentleague/cray/6thoct04.html 1 0 0 0 /news/bromalde21112017 3 13071 0 0 /news/favershamtownbossrayturnertiesdownjackharris 3 12416 0 0 /folkestone-2003-2006/6 4 12142 0 0 /news/x-2 3 7526 0 0 /news/eritroch090817 1 3052 0 0 /news/drmartens/premier/welling/fixtures.html 2 0 0 0 /news/idontwanttofinishwherewedidlastyearsaystonbridgeangelsbosstommywarrilow 5 25187 0 0 /news/canterburycity120419 4 15702 0 0 /news/newportcounty2wellingunited2 4 11902 0 0 /news/metrostans020416 2 18974 0 0 /news/FAStatement220221 6 27359 1 1 /news/oconnellexpectedtobeunveiledasmargatesnewboss 2 5921 0 0 /news/ianpulmandepartureleavesahugevoidformetotrytofillsaysramsgatebosstimdixon 1 3322 0 0 /news/kentleague/ramsgate/29thsept04.html 1 0 0 0 /news/conference/margate/25thsept04.html 1 0 0 0 /news/eduseirepayswarrilowforkeepingthefaith-exclusive 1 5186 0 1 /news/soccershorts040719 3 18065 0 0 /news/ashfguer300319 3 30378 0 0 /news/551bc5e916812 3 13636 0 0 /news/fishcant201118 5 41512 0 0 /news/wardexcitedaboutlocaltalentcomingthrough-exclusive 1 5080 0 0 /news/ramsgatewillbeatoughgamewarnsstonesbossjaysaunders 1 3717 0 0 /news/weregoingtoworkhardtogetoutofthisleaguesaystonbridgeangelsbosstommywarrilow 1 4673 0 0 /news/551bc5db806ad 3 11928 0 0 /archive-2006-2014/95 1 4918 0 0 /news/9thJune04.html 2 0 0 0 /news/wefacesomedifficultgamesaheadwarnsbromleyassistanthaydenbird 1 4145 0 0 /news/weregoingtowembleyfleetconfidenttheycanbreaktrophyfinalcrowdrecord 2 7385 0 0 /news/551a9799eeba1 2 11116 0 0 /news/whitstablecharitycupfallsvictimtotheweather 1 2886 0 0 /news/tunwells081115 3 12999 0 0 /news/holmesdale0-5corinthian-fingerscrosseditmightbethirdtimeluckysaysmattlonghurst 2 18788 0 0 /news/NationalLeague141120 3 15223 0 0 /news/551a931d93abf 1 2789 0 0 /news/vcdathletic3-1brentwoodtown-playerscantdealwithourmovementsaystonyrussell 1 9044 0 0 /news/551bc5e79db6d 2 6220 0 0 /news/greenwich071204.html 1 0 0 0 /news/bromley200619 3 11190 0 0 /news/deanpooleywillmakeanexcellentadditiontooursquadsaysfleetbossstevebrown 3 10406 0 0 /news/eastbourne030805.html 2 0 0 0 /assets/uploads/content/Neil_Smith_celebrates_FA_Cup_win.html 1 44640 0 0 /news/551bc5e2d4b87 1 3676 0 0 /news/piscinaholdsshowdowntalkswithdolbytonight-exclusiveinterview 1 4734 0 0 /news/doverreleasefiveoftheirchampionshipwinningsquad 1 3692 0 0 /news/lewfor040917 5 48013 0 1 /news/croydon240918 6 17203 0 0 /news/551a967905150 1 4162 0 0 /news/23rdaug04T.html 1 0 0 0 /assets/ckeditor/plugins/iframe/images/ 1 374 0 0 /news/551bc5e5e3cc5 1 4280 0 0 /news/551a97b1c2062 2 8250 1 1 /news/afccroy270515 5 18322 1 1 /news/FAStatement101220 9 45772 1 1 /news/lewisham291219 5 33600 2 2 /news/ashfordtown0-1sittingbourne-weenjoyplayingawayfromhomesaysbrady 1 5586 0 0 /news/wellingunited1-3worcestercity-moreworcesterwoeforwings 2 20167 1 1 /news/wellingtown250518 4 16982 0 0 /news/maidstoneunited4-1dartford 1 6104 0 0 /news/welling020518 4 15550 0 0 /news/kscfinal300415 5 51892 1 1 /news/chelmsford181204.html 2 0 0 0 /news/rochester040920 5 16147 0 1 /news/551bc5dec2f32 3 12995 0 0 /isthmian-league/35 5 23824 0 0 /news/AFCWimbledon251005.html 1 0 0 0 /news/soccershortsjonesrueselliottsdeparturetoredhill 2 16453 0 0 /assets/fileman/lang/es.json 1 3610 0 0 /news/551a979a7fdd8 1 4362 0 0 /news/barking011105.html 1 0 0 0 /news/peoplesayweregoingtostruggle-imgoingtoprovethemwrongvowsangelsbosstommywarrilow 1 5172 0 0 /news/favershamtown1-2dulwichhamlet-werenotgettingthebreaksadmitsjustinluchford 2 12042 0 0 /news/itsabouttimewehadsomeluckadmitsmoore 2 7772 1 1 /news/craywanderersappointtommywarrilowtokeeptheclubintherymanleague 3 11877 0 0 /news/farnobg260916 3 12455 0 0 /assets/select2/src/js/select2/ 1 561 0 0 /news/ebbsfleetunited1-1colchesterunited-theresstillroomforimprovementadmitsdaish 1 6048 0 0 /news/wearereallypleasedwiththeteamwehavesaysmargateassistantstuartcash 4 14818 0 1 /archive-2006-2014/240 3 12571 0 0 /news/thamvslad210204.html 2 0 0 0 /news/551bc5e0078f9 3 15062 0 0 /news/erithbelv180915 4 14930 0 0 /news/tonbridge201215 3 13347 0 0 /news/thekentwomenscupisthemaintrophywesetoursightsonsaysgillinghambossjamesmarrs 4 19842 0 0 /news/551a96785a7aa 1 4237 0 0 /archive-2006-2014/81 3 14992 0 0 /news/metropolitanpolice3-3sittingbourne-brickiesgoalkeeperrescuespoint 2 8514 0 0 /news/canterbury300419 5 23535 0 1 /news/doverathleticreadytoproduceanotherfacupgiant-killing 1 6242 0 0 /news/boroughsackmanagerialpair-exclusive 1 2887 0 0 /news/soccershortsvickersannouncelegendssquads 1 5177 0 1 /news/faversham110619 4 14169 0 0 /news/25thjuly04.html 1 0 0 0 /news/vcdathletic3-0greenwichborough-wejustdidntturnupadmitsbillywalton 1 9051 0 0 /news/vcdathletic1-0eastbournetownweveknockedoutaverygoodsideadmitsfordexclusive 5 27437 0 0 /news/sladevcray100204.html 2 0 0 0 /news/vcdathletic1hernebay1exclusiveinterviews 3 14894 0 0 /news/kentleague/whitstable/whitstable.html 1 0 0 0 /news/afccroydonathletic310818 1 3711 0 0 /news/daishsolveshisdefensiveinjurycrisis 1 3263 0 0 /archive-2006-2014/32 1 4974 0 0 /news/glebe300817 1 3500 0 0 /news/Bromleycrystalpalace250715 4 19802 0 0 /news/26thjune2003.html 2 0 0 1 /news/weneedeverybodysigningfromthesamehymnsheetsayswarrilow 1 5364 0 0 /news/forthcomingfixtures6thfebruary2006 4 15353 0 0 /news/ourfixtureback-logisridiculousbemoanstunbridgewellsbossmartinlarkin 1 4266 0 1 /news/rusthall100818 1 4178 0 0 /news/kcfafindstephensonguiltyforspittingatkentfootballreferee 1 4241 1 0 /news/folkestoneinvictasettoearn20kthrougheducation 2 9892 0 0 /news/ryman/bromley/14thmar04.html 1 0 0 0 /news/551bc5df707d7 1 3540 0 0 /news/sittingbournesnapuphighly-ratedgoalkeeperreed 1 3714 0 0 /news/maidstone090519 3 11433 0 0 /news/othernews/3rdaug04.html 1 0 0 0 /news/vcdathletic260720 2 6696 0 0 /news/kentleague/thamesmead/10thdec04.html 1 0 0 0 /news/drmartens/premier/welling/24thoct03.html 1 0 0 0 /news/anyonefordarts 5 16370 0 0 /news/drmartens/eastern/dartford/2nddec04.html 1 0 0 0 /news/phoenix220319 3 10713 0 0 /news/conference/margate/25thjuly03.html 2 0 0 0 /news/kentleague/VCD/tunbridgewells071204.html 1 0 0 0 /news/551a96db63e27 1 3564 0 0 /news/tunbridgewells110119 4 15238 0 0 /news/dartford0-3borehamwood-welosttoabettersideconfessesburman-exclusiveinterview 2 11280 0 0 /news/551a95b3d1ab4 4 14122 2 2 /news/werelookingtogetbacktowinningwayssayshernebaybosssamdenly 3 10757 0 0 /news/tonbridgeangels280220 2 9106 0 0 /news/bromu18ve&b040404.html 1 0 0 0 /news/wealwaysgointoeveryseasonwithaspirationstodobettersayscraysjoefrancis 2 7856 0 0 /news/wemusttakeourcupformintotheleaguesaysseager 2 7765 0 0 /news/fleetreadyfortheirdayofdestiny 2 7161 0 0 /news/dolbywantstogivefanssomethingtoshoutabout 3 11596 0 0 /news/erithbelvedereapologiseforcrockenhillcancellation 4 13045 0 0 /news/551a97b084d3b 1 3167 0 0 /news/maldon170905.html 1 0 0 0 /news/theresnoreasontosuggestthatwecannotbeasgoodasanyonesaysfolkestonebossneilcugley 1 3427 0 0 /news/erithbelvedere4-0lancing-deresanswertheircriticsintruestyle 1 4920 1 0 /national-league/30 2 9785 0 0 /news/craywanderersacademyisafantasticsettingtofurtheryourcareersaysdarrenanslow 1 5939 0 0 /archive-2006-2014/113 2 10214 0 0 /news/maidstone200805.html 2 0 0 0 /news/burmanwaitsforoffersforin-formstrikermcdonald 1 4807 0 0 /news/ourlastfivegamesoftheseasonaredifficultsaysramsgatebossjimward 2 10124 1 1 /news/14thjuly04.html 3 0 0 0 /news/551bc99b59b70 1 6994 0 0 /news/walthamforest290105.html 2 0 0 0 /news/sandemanfairclough050715 4 16553 0 0 /news/resultsfornovember2008 2 11306 0 0 /news/17thsept04.html 1 0 0 0 /news/5thjan05.html 2 0 0 0 /ashford-2003-2006/5 3 7974 0 0 /news/glebeandbromleygreensecuregroundsharedealstoprogress 3 11107 0 0 /news/crayvalleypm1-1lancing-toscoreinthefacupismagicsayshistorymakerlewiswood 9 142951 3 3 /news/carshaltonwillbeatoughnuttocrackadmitsmunday 2 8183 0 0 /news/3rdapr05.html 2 0 0 0 /news/strikercoopershownthedoor 3 8959 0 0 /news/weneedexperiencetowinthekentleaguetitlesaysporter 1 4394 0 0 /news/brackleytown190518 3 13002 0 0 /news/kentleague/sladegreen/12thdec04.html 1 0 0 0 /news/thebigkickoffcraywandererssignchapmantohelppromotionbid-exclusive 1 4968 0 0 /news/saturdaysbigkentfacuptieisprobablythehottestticketintownsaysnickysouthall 2 9682 0 0 /news/ebbsfleetunited1-1kidderminsterharriers-daishtakeshispoint 2 12490 0 0 /news/weregoinguptooxfordtofinishoffthejobvowsosborne 1 4858 0 0 /news/kennington250518 3 11547 0 0 /news/imkeepingtheladsontheirtoessaystonbridgeangelsbosstommywarrilow 5 22315 0 0 /news/hopefullynowpeoplewilltakeusabitmoreseriouslysayssittingbournebossgaryabbott 1 4162 0 0 /news/ramsgatelloydblackman091218 5 21195 0 0 /news/kentseniortrophyfinalourtrophyfaminewillcometoanendvowsbeckscoachhughes 1 4380 0 0 /news/551a931e57f8e 2 6396 0 0 /news/ashford030619 4 13829 0 0 /news/crayvalleywatson210817 1 5513 0 0 /news/551a956b73d30 3 14151 0 0 /news/nationwide/gillingham/3rdjuly03.html 2 0 0 0 /national-league/23 3 14625 0 0 /news/551a956c0d515 1 3200 0 0 /news/kentleague/lordswood/lordsvcray251003.html 1 0 0 0 /news/stonesbegintheirjourneybackhomethisyearvowschairman 1 2943 0 0 /news/phoenixsports2-2blyspartans2-4pens-spot-onwatkinsmadeamendssayscarlrolls 1 9817 0 0 /news/itsabouteverybodybelievingwecanwinthisgameandithinkwecansaysjoefrancis 2 8622 0 0 /news/folkhythe241016 1 3259 0 0 /news/551bc5da5e7a1 2 7476 0 0 /news/myambitionistobethefirstmanagertowinattheoldwembleyandthenewonevowstommysampson 1 5579 0 0 /news/robbinsquitscash-strappedtunbridgewells 2 7277 0 0 /news/canterbury221219 4 12920 0 0 /news/tonbridgeangels1-0maidstoneunited-wegottheresultforthefanssaysstevemckimm 3 31322 0 0 /news/soccershortswellprobablyhavetoreachfacupquarter-finalstobeonthebox-martinhayes 2 20294 1 1 /news/erithbelv041215 3 10569 0 0 /news/robbinsaddsmorenutsboltstohissquad-exclusive 5 19593 0 1 /news/greenwichboroughunveilianjenkinsastheirnewmanager 1 4257 0 0 /news/hythgree111218 3 33636 0 0 /news/sevenoaksbeginsearchfornewmanagementteam 2 6671 0 0 /news/burmanletsbecomerymankingsonsaturday 2 9622 0 0 /news/dealtown1-2ashfordunited-ithoughtwewerequitecomfortablesaysashfordbosspaulchambers 1 8149 0 0 /news/maldon301004.html 2 0 0 0 /news/whitstable230216 4 14718 0 0 /news/erithtown171116 2 6968 0 0 /news/wiskerlivesuptohisbilling 2 7834 1 0 /news/dartford2-2tonbridgeangels-wereconfidentofgettingintoplay-offs-sawyer 2 15390 0 0 /news/abusyweekendofkentishfootball 1 3027 0 0 /news/gillsladies300915 4 14885 0 0 /news/551a99e33a377 1 4289 0 0 /news/551bc5db459a6 3 10616 0 0 /news/fleettown1-1ramsgate-imnothappywithapoint-ward 3 76689 1 2 /news/sevenoaks130818 3 13947 0 0 /news/bromdov251016 3 33093 0 0 /news/martinrelishinghisdreammovetopalace 2 8914 0 0 /news/metrogas180321 29 91552 5 12 /news/britishgassponsorsouthernleague 5 16583 0 0 /news/bashvfolk081103.html 2 0 0 0 /news/cugleystillnegotiatingdealwithstrikerbremner 2 8588 0 0 /news/kentleague/thamesmead/27thoct03.html 1 0 0 0 /news/relegatedfolkestoneinvictakeepfaithwithcugley 1 6079 0 0 /news/whitstable260418 2 7647 0 0 /news/charltonathletic1-2gillingham-anexplayeralwayswantstoproveapointsaysjamesmarrs 2 14794 0 0 /news/iwantanexperiencedbackbonetomyteamsayserithtownbosstonyrussell 1 4565 0 0 /news/theweekaheadwc200306 1 3173 0 0 /news/551a9678d7cc0 1 5323 0 0 /news/fordmyexperiencedsidewillnotfreeze 2 8920 0 0 /news/onourdaywecanlivewiththebestsidesintheleaguesaysfavershambossrayturner 1 4238 0 0 /news/erithandbelvedere020819 4 15166 0 0 /news/frozenfebruary 2 6355 0 0 /news/croyathvbrom020304A.html 1 0 0 0 /news/551bc5e7046df 3 16957 0 0 /news/551bc99cb0e55 2 11232 1 1 /news/maidstone030804.html 2 0 0 0 /news/weregoingtowembleykentmanagerstellheroicfleetnowgoonandwinit 1 5757 0 0 /news/wellingordoverhaventapproachedmesaysward-exclusiveinterview 1 3948 0 0 /news/doverJDT090805.html 2 0 0 0 /news/croydon010819 4 13514 0 0 /news/551bc5dbb1167 4 16073 0 1 /news/bromleyontheorientibeleiveintheromanceofthefacupsaysbromleyskippertutuhenriques 1 5736 0 0 /news/whitstablerelishseasideshowdownwithmargate-exclusiveinterview 4 17830 0 0 /news/croydonbosstompkinssignstrio 2 8315 0 0 /news/itwillbenicetogointoagameasunderdogssayschathamtownbosskevinwatson 2 8322 0 0 /news/trophydrawunkindtokentsremainingtwo 2 6806 0 0 /news/sittingbourne2greatwakeringrovers1 3 12793 0 0 /news/favasesecondrounddrawhernebaygoingintotheunknown-sayschairman 1 4391 0 0 /news/croydon4-7guernsey 4 38243 1 1 /news/tonbridgeangels3-2ramsgatemainservesupsixofthebest 2 11757 0 0 /news/charltcardiff100515 2 16230 0 0 /news/551bc5db0516e 2 8916 0 0 /news/boxingmightgetusonestepaheadofeveryoneelsesaysramsgatebossjimward 2 10355 0 0 /news/orpington060815 3 11085 0 0 /news/beckcrys150716 3 28245 0 0 /news/22ndapr04.html 2 0 0 0 /news/551bc99bd43b8 2 9522 0 0 /news/thanetbasedstrikerfacesdecisiontime-dartsorrams 3 10955 0 0 /news/551a96dbd3bc5 2 7954 0 0 /news/illputmoneyonatop-fivefinishsayslordswoodbossjasonlillis 3 12692 1 0 /news/itsabouttimeweremovedthosestainessaysward-exclusive 1 4847 0 0 /news/ourobjectiveistoapplyforthekentinvictaleaguesaysapmcontrastbosskrisbrowning 3 14957 0 0 /news/pennockwearecapableofgettingintoplay-offs 3 11747 0 0 /news/beckenhamtown4-2corinthian-theresnodisgraceinlosingtobeckenhamadmitsjamescollins 4 38544 0 0 /news/19thsept05G.html 4 0 1 0 /news/beckstpe260219 5 46732 0 0 /news/craywands270418 1 4559 0 0 /news/bromley070615 4 17578 0 0 /news/drmartens/eastern/ashford/ashfvfolk270104.html 1 0 0 0 /news/551bc5dfbcee2 1 4669 1 0 /news/551bc99caabcc 1 7213 0 0 /news/551a931e7c5ad 3 15660 0 0 /news/crockenhill0-4lyddtown-wewanttogoashighaswecanintheleaguesayslyddbossdavesmith 2 17544 0 0 /news/hythehaveblownthetitle-hughes 2 8371 0 0 /news/ashfvcd190419 5 56737 0 0 /news/tonbridgeangels220421 24 88543 1 4 /news/angelsgettheirmainman 4 14290 0 1 /news/wehavetobeatourbesttobeatfavershamtownsaysmaidstoneunitedbossjaysaunders 2 11610 0 0 /news/551a96771cb05 1 3912 0 0 /news/551a931dab6ff 1 3170 0 0 /news/resultsforaprilmay2010 7 45131 1 0 /news/ramslookingforplayersfornewly-formedladiesteam 4 14585 0 0 /news/bromleyfc.tv. 1 0 0 0 /news/thefacupdraw2012-2013 1 4067 0 0 /southern-counties-east-football-league/4 4 36020 1 1 /assets/js/jqplot/ 8 3457 0 0 /news/ryman/bromley/stainvbrom090304.html 1 0 0 0 /news/theresnoplacelikehomesayspennock-exclusiveinterview 1 4240 0 0 /news/dulwich301118 4 15261 0 0 /news/NationalLeagueclubstatement200221 6 39106 1 1 /news/crayvalley2-0afccroydonathletic-wereamillionmilesawayfromwembleysaysstevechapman 5 43226 0 0 /news/gillingham080121 3 10224 0 0 /southern-counties-east-football-league/32 3 14589 0 0 /news/joeford150519 2 6246 0 0 /news/ireallyfancyourselvestodoreallymagicalthingsatfleetwoodsaysdannywaldren 3 21343 0 0 /news/itsfantastictobeonthesamepitchaschelseasaysbromleyassistantmurrayjones 1 4446 0 0 /southern-counties-east-football-league/9 4 36249 1 1 /news/ourseasonisnotdeadsaystonbridgeangelsassistantalexobrien 1 4316 1 1 /news/peckham290417 4 15246 0 1 /news/asherith190915 6 105788 2 1 /ramsgate-2003-2006/4 2 5710 0 0 /news/katiejoynes260420 3 9593 0 1 /news/tonbridgeangelsprovethattheirdiamondgeezers 3 22798 1 1 /news/fisher1-4holmesdale-impreparedtoquitifsomeonecandobetterthanmesaysbillywalton 5 51710 0 0 /news/byronwalkersreturnisamassiveboostsayshernebaybosssimonhalsey 2 9438 0 0 /news/dealtown010116 3 10374 0 0 /news/2nddec04.html 1 0 0 0 /news/imreadyformanagementsayshalsey 1 4690 0 0 /news/wellstruggletokeepholdoffalfiemaysayscorinthianbossmattlonghurst 3 13904 0 0 /news/gillingham210519A 3 13451 0 0 /news/551a967717378 1 3023 0 0 /news/kentleague/tunbridgewells/7thjuly03.html 2 0 0 0 /news/iwanttofindaladandfulfilhisdreamofbecomingaprofessionalfootballersaysrobquinn 4 17169 0 0 /news/kentleaguecupfinalreport080504A.html 2 0 0 0 /news/thepressureisoffusatgatesheadsaysdartfordbosstonyburman 1 5263 0 0 /news/whitstable111120 2 6986 0 0 /news/greenleyt300718 4 32465 0 0 /news/craywands180817 1 4247 0 0 /vcd-2003-2006/ 1 2996 0 0 /news/dulwichhamlet3-1doverathleticwhitewecanhandlethepressuretofinishtop 1 6151 0 0 /news/warrilowvowstokeepunbeatenrungoing 1 3886 0 0 /news/angelsdayofdestinywevegotthefinishinglineaheadofustommywarrilow 1 6208 0 0 /news/longmarg120516 7 184135 2 4 /news/551a97986e309 5 30107 1 0 /news/thefacupdraw2013 6 31820 1 0 /news/soccershortsashfordunitedsnapupprolificstrikerstuartzanone 1 8878 1 0 /news/stevenstakeoverdelaysareharmingpreparationsfornewseason 1 3607 0 0 /news/nationalleague220116 4 15298 0 0 /news/crayhythe210916 2 18890 0 0 END_SIDER

Cancel